diff --git a/Moonlight.xcodeproj/project.pbxproj b/Moonlight.xcodeproj/project.pbxproj index d5a3658..35513c9 100644 --- a/Moonlight.xcodeproj/project.pbxproj +++ b/Moonlight.xcodeproj/project.pbxproj @@ -24,6 +24,12 @@ 9865DC38213287FE0005B9B9 /* LoadingFrameViewController.m in Sources */ = {isa = PBXBuildFile; fileRef = FB4A23B71A9D3637004D2EF2 /* LoadingFrameViewController.m */; }; 9865DC3C2132922E0005B9B9 /* GameController.framework in Frameworks */ = {isa = PBXBuildFile; fileRef = 9865DC3B2132922E0005B9B9 /* GameController.framework */; }; 9865DC3E21332D660005B9B9 /* MainFrameViewController.m in Sources */ = {isa = PBXBuildFile; fileRef = FB89462519F646E200339C8A /* MainFrameViewController.m */; }; + 98882A062AF60F7000C5A11C /* libavcodec.a in Frameworks */ = {isa = PBXBuildFile; fileRef = 98882A032AF60F5300C5A11C /* libavcodec.a */; }; + 98882A072AF60F7200C5A11C /* libavformat.a in Frameworks */ = {isa = PBXBuildFile; fileRef = 98882A052AF60F5300C5A11C /* libavformat.a */; }; + 98882A082AF60F7400C5A11C /* libavutil.a in Frameworks */ = {isa = PBXBuildFile; fileRef = 98882A042AF60F5300C5A11C /* libavutil.a */; }; + 98882A0C2AF60F9E00C5A11C /* libavcodec.a in Frameworks */ = {isa = PBXBuildFile; fileRef = 98882A0A2AF60F9000C5A11C /* libavcodec.a */; }; + 98882A0D2AF60FA000C5A11C /* libavformat.a in Frameworks */ = {isa = PBXBuildFile; fileRef = 98882A0B2AF60F9000C5A11C /* libavformat.a */; }; + 98882A0E2AF60FA300C5A11C /* libavutil.a in Frameworks */ = {isa = PBXBuildFile; fileRef = 98882A092AF60F9000C5A11C /* libavutil.a */; }; 988FCD41293B091B003050E2 /* KeyboardInputField.m in Sources */ = {isa = PBXBuildFile; fileRef = 988FCD40293B091B003050E2 /* KeyboardInputField.m */; }; 988FCD42293B091B003050E2 /* KeyboardInputField.m in Sources */ = {isa = PBXBuildFile; fileRef = 988FCD40293B091B003050E2 /* KeyboardInputField.m */; }; 9890CF6B203B7EE1006C4B06 /* libxml2.tbd in Frameworks */ = {isa = PBXBuildFile; fileRef = 9890CF6A203B7EE1006C4B06 /* libxml2.tbd */; }; @@ -188,6 +194,12 @@ 986E28A528EA989100758361 /* Moonlight v1.9.xcdatamodel */ = {isa = PBXFileReference; lastKnownFileType = wrapper.xcdatamodel; path = "Moonlight v1.9.xcdatamodel"; sourceTree = ""; }; 9874E8962AE95E1D00130A3C /* Moonlight v1.10.xcdatamodel */ = {isa = PBXFileReference; lastKnownFileType = wrapper.xcdatamodel; path = "Moonlight v1.10.xcdatamodel"; sourceTree = ""; }; 98783FEA242EAC5D00F00EF4 /* Moonlight v1.5.xcdatamodel */ = {isa = PBXFileReference; lastKnownFileType = wrapper.xcdatamodel; path = "Moonlight v1.5.xcdatamodel"; sourceTree = ""; }; + 98882A032AF60F5300C5A11C /* libavcodec.a */ = {isa = PBXFileReference; lastKnownFileType = archive.ar; name = libavcodec.a; path = libs/FFmpeg/lib/iOS/libavcodec.a; sourceTree = ""; }; + 98882A042AF60F5300C5A11C /* libavutil.a */ = {isa = PBXFileReference; lastKnownFileType = archive.ar; name = libavutil.a; path = libs/FFmpeg/lib/iOS/libavutil.a; sourceTree = ""; }; + 98882A052AF60F5300C5A11C /* libavformat.a */ = {isa = PBXFileReference; lastKnownFileType = archive.ar; name = libavformat.a; path = libs/FFmpeg/lib/iOS/libavformat.a; sourceTree = ""; }; + 98882A092AF60F9000C5A11C /* libavutil.a */ = {isa = PBXFileReference; lastKnownFileType = archive.ar; name = libavutil.a; path = libs/FFmpeg/lib/tvOS/libavutil.a; sourceTree = ""; }; + 98882A0A2AF60F9000C5A11C /* libavcodec.a */ = {isa = PBXFileReference; lastKnownFileType = archive.ar; name = libavcodec.a; path = libs/FFmpeg/lib/tvOS/libavcodec.a; sourceTree = ""; }; + 98882A0B2AF60F9000C5A11C /* libavformat.a */ = {isa = PBXFileReference; lastKnownFileType = archive.ar; name = libavformat.a; path = libs/FFmpeg/lib/tvOS/libavformat.a; sourceTree = ""; }; 988FCD3F293B091B003050E2 /* KeyboardInputField.h */ = {isa = PBXFileReference; lastKnownFileType = sourcecode.c.h; path = KeyboardInputField.h; sourceTree = ""; }; 988FCD40293B091B003050E2 /* KeyboardInputField.m */ = {isa = PBXFileReference; lastKnownFileType = sourcecode.c.objc; path = KeyboardInputField.m; sourceTree = ""; }; 9890CF6A203B7EE1006C4B06 /* libxml2.tbd */ = {isa = PBXFileReference; lastKnownFileType = "sourcecode.text-based-dylib-definition"; name = libxml2.tbd; path = usr/lib/libxml2.tbd; sourceTree = SDKROOT; }; @@ -396,11 +408,14 @@ 98A2E31129B5256200CA17A7 /* OpenSSL.xcframework in Frameworks */, 9865DC30213260B40005B9B9 /* libmoonlight-common-tv.a in Frameworks */, 9865DC3C2132922E0005B9B9 /* GameController.framework in Frameworks */, + 98882A0D2AF60FA000C5A11C /* libavformat.a in Frameworks */, + 98882A0E2AF60FA300C5A11C /* libavutil.a in Frameworks */, FB1A67EA21324DF300507771 /* libxml2.tbd in Frameworks */, FB1A67E821324DE300507771 /* libopus.a in Frameworks */, 98181BEB2791278F00E43572 /* libSDL2.a in Frameworks */, FB1A67E521324A1F00507771 /* CoreData.framework in Frameworks */, 98B9CE6D27B2144B00B473C4 /* AVKit.framework in Frameworks */, + 98882A0C2AF60F9E00C5A11C /* libavcodec.a in Frameworks */, ); runOnlyForDeploymentPostprocessing = 0; }; @@ -412,13 +427,16 @@ 9890CF6B203B7EE1006C4B06 /* libxml2.tbd in Frameworks */, 98CFB82F1CAD481B0048EF74 /* libmoonlight-common.a in Frameworks */, FB8946ED19F6AFE800339C8A /* libopus.a in Frameworks */, + 98882A082AF60F7400C5A11C /* libavutil.a in Frameworks */, FB290CF419B2C406004C83CF /* CoreGraphics.framework in Frameworks */, FB290CF819B2C406004C83CF /* CoreData.framework in Frameworks */, 98181BED2791281100E43572 /* CoreMotion.framework in Frameworks */, + 98882A072AF60F7200C5A11C /* libavformat.a in Frameworks */, FB290CF619B2C406004C83CF /* UIKit.framework in Frameworks */, FB290CF219B2C406004C83CF /* Foundation.framework in Frameworks */, FB4679011A57048000377732 /* CoreFoundation.framework in Frameworks */, 98181BE92791277400E43572 /* libSDL2.a in Frameworks */, + 98882A062AF60F7000C5A11C /* libavcodec.a in Frameworks */, ); runOnlyForDeploymentPostprocessing = 0; }; @@ -478,6 +496,12 @@ FB290CF019B2C406004C83CF /* Frameworks */ = { isa = PBXGroup; children = ( + 98882A032AF60F5300C5A11C /* libavcodec.a */, + 98882A052AF60F5300C5A11C /* libavformat.a */, + 98882A0A2AF60F9000C5A11C /* libavcodec.a */, + 98882A0B2AF60F9000C5A11C /* libavformat.a */, + 98882A042AF60F5300C5A11C /* libavutil.a */, + 98882A092AF60F9000C5A11C /* libavutil.a */, 98A2E31029B5256200CA17A7 /* OpenSSL.xcframework */, 98B9CE6C27B2144B00B473C4 /* AVKit.framework */, 98181BEC2791281100E43572 /* CoreMotion.framework */, @@ -1159,6 +1183,7 @@ "$(inherited)", "$(PROJECT_DIR)/libs/opus/lib/tvOS", "$(PROJECT_DIR)/libs/SDL2/lib/tvOS", + "$(PROJECT_DIR)/libs/FFmpeg/lib/tvOS", ); MARKETING_VERSION = 8.5.0; MTL_ENABLE_DEBUG_INFO = YES; @@ -1207,6 +1232,7 @@ "$(inherited)", "$(PROJECT_DIR)/libs/opus/lib/tvOS", "$(PROJECT_DIR)/libs/SDL2/lib/tvOS", + "$(PROJECT_DIR)/libs/FFmpeg/lib/tvOS", ); MARKETING_VERSION = 8.5.0; MTL_ENABLE_DEBUG_INFO = NO; @@ -1356,6 +1382,7 @@ "$(inherited)", "$(PROJECT_DIR)/libs/opus/lib/iOS", "$(PROJECT_DIR)/libs/SDL2/lib/iOS", + "$(PROJECT_DIR)/libs/FFmpeg/lib/iOS", ); MARKETING_VERSION = 8.5.0; PRODUCT_BUNDLE_IDENTIFIER = "com.moonlight-stream.$(PRODUCT_NAME:rfc1034identifier)"; @@ -1397,6 +1424,7 @@ "$(inherited)", "$(PROJECT_DIR)/libs/opus/lib/iOS", "$(PROJECT_DIR)/libs/SDL2/lib/iOS", + "$(PROJECT_DIR)/libs/FFmpeg/lib/iOS", ); MARKETING_VERSION = 8.5.0; PRODUCT_BUNDLE_IDENTIFIER = "com.moonlight-stream.$(PRODUCT_NAME:rfc1034identifier)"; diff --git a/libs/FFmpeg/include/libavcodec/ac3_parser.h b/libs/FFmpeg/include/libavcodec/ac3_parser.h new file mode 100644 index 0000000..ff8cc4c --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/ac3_parser.h @@ -0,0 +1,36 @@ +/* + * AC-3 parser prototypes + * Copyright (c) 2003 Fabrice Bellard + * Copyright (c) 2003 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_AC3_PARSER_H +#define AVCODEC_AC3_PARSER_H + +#include +#include + +/** + * Extract the bitstream ID and the frame size from AC-3 data. + */ +int av_ac3_parse_header(const uint8_t *buf, size_t size, + uint8_t *bitstream_id, uint16_t *frame_size); + + +#endif /* AVCODEC_AC3_PARSER_H */ diff --git a/libs/FFmpeg/include/libavcodec/adts_parser.h b/libs/FFmpeg/include/libavcodec/adts_parser.h new file mode 100644 index 0000000..f85becd --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/adts_parser.h @@ -0,0 +1,37 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_ADTS_PARSER_H +#define AVCODEC_ADTS_PARSER_H + +#include +#include + +#define AV_AAC_ADTS_HEADER_SIZE 7 + +/** + * Extract the number of samples and frames from AAC data. + * @param[in] buf pointer to AAC data buffer + * @param[out] samples Pointer to where number of samples is written + * @param[out] frames Pointer to where number of frames is written + * @return Returns 0 on success, error code on failure. + */ +int av_adts_header_parse(const uint8_t *buf, uint32_t *samples, + uint8_t *frames); + +#endif /* AVCODEC_ADTS_PARSER_H */ diff --git a/libs/FFmpeg/include/libavcodec/avcodec.h b/libs/FFmpeg/include/libavcodec/avcodec.h new file mode 100644 index 0000000..7fb44e2 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/avcodec.h @@ -0,0 +1,3154 @@ +/* + * copyright (c) 2001 Fabrice Bellard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_AVCODEC_H +#define AVCODEC_AVCODEC_H + +/** + * @file + * @ingroup libavc + * Libavcodec external API header + */ + +#include "libavutil/samplefmt.h" +#include "libavutil/attributes.h" +#include "libavutil/avutil.h" +#include "libavutil/buffer.h" +#include "libavutil/channel_layout.h" +#include "libavutil/dict.h" +#include "libavutil/frame.h" +#include "libavutil/log.h" +#include "libavutil/pixfmt.h" +#include "libavutil/rational.h" + +#include "codec.h" +#include "codec_id.h" +#include "defs.h" +#include "packet.h" +#include "version_major.h" +#ifndef HAVE_AV_CONFIG_H +/* When included as part of the ffmpeg build, only include the major version + * to avoid unnecessary rebuilds. When included externally, keep including + * the full version information. */ +#include "version.h" + +#include "codec_desc.h" +#include "codec_par.h" +#endif + +struct AVCodecParameters; + +/** + * @defgroup libavc libavcodec + * Encoding/Decoding Library + * + * @{ + * + * @defgroup lavc_decoding Decoding + * @{ + * @} + * + * @defgroup lavc_encoding Encoding + * @{ + * @} + * + * @defgroup lavc_codec Codecs + * @{ + * @defgroup lavc_codec_native Native Codecs + * @{ + * @} + * @defgroup lavc_codec_wrappers External library wrappers + * @{ + * @} + * @defgroup lavc_codec_hwaccel Hardware Accelerators bridge + * @{ + * @} + * @} + * @defgroup lavc_internal Internal + * @{ + * @} + * @} + */ + +/** + * @ingroup libavc + * @defgroup lavc_encdec send/receive encoding and decoding API overview + * @{ + * + * The avcodec_send_packet()/avcodec_receive_frame()/avcodec_send_frame()/ + * avcodec_receive_packet() functions provide an encode/decode API, which + * decouples input and output. + * + * The API is very similar for encoding/decoding and audio/video, and works as + * follows: + * - Set up and open the AVCodecContext as usual. + * - Send valid input: + * - For decoding, call avcodec_send_packet() to give the decoder raw + * compressed data in an AVPacket. + * - For encoding, call avcodec_send_frame() to give the encoder an AVFrame + * containing uncompressed audio or video. + * + * In both cases, it is recommended that AVPackets and AVFrames are + * refcounted, or libavcodec might have to copy the input data. (libavformat + * always returns refcounted AVPackets, and av_frame_get_buffer() allocates + * refcounted AVFrames.) + * - Receive output in a loop. Periodically call one of the avcodec_receive_*() + * functions and process their output: + * - For decoding, call avcodec_receive_frame(). On success, it will return + * an AVFrame containing uncompressed audio or video data. + * - For encoding, call avcodec_receive_packet(). On success, it will return + * an AVPacket with a compressed frame. + * + * Repeat this call until it returns AVERROR(EAGAIN) or an error. The + * AVERROR(EAGAIN) return value means that new input data is required to + * return new output. In this case, continue with sending input. For each + * input frame/packet, the codec will typically return 1 output frame/packet, + * but it can also be 0 or more than 1. + * + * At the beginning of decoding or encoding, the codec might accept multiple + * input frames/packets without returning a frame, until its internal buffers + * are filled. This situation is handled transparently if you follow the steps + * outlined above. + * + * In theory, sending input can result in EAGAIN - this should happen only if + * not all output was received. You can use this to structure alternative decode + * or encode loops other than the one suggested above. For example, you could + * try sending new input on each iteration, and try to receive output if that + * returns EAGAIN. + * + * End of stream situations. These require "flushing" (aka draining) the codec, + * as the codec might buffer multiple frames or packets internally for + * performance or out of necessity (consider B-frames). + * This is handled as follows: + * - Instead of valid input, send NULL to the avcodec_send_packet() (decoding) + * or avcodec_send_frame() (encoding) functions. This will enter draining + * mode. + * - Call avcodec_receive_frame() (decoding) or avcodec_receive_packet() + * (encoding) in a loop until AVERROR_EOF is returned. The functions will + * not return AVERROR(EAGAIN), unless you forgot to enter draining mode. + * - Before decoding can be resumed again, the codec has to be reset with + * avcodec_flush_buffers(). + * + * Using the API as outlined above is highly recommended. But it is also + * possible to call functions outside of this rigid schema. For example, you can + * call avcodec_send_packet() repeatedly without calling + * avcodec_receive_frame(). In this case, avcodec_send_packet() will succeed + * until the codec's internal buffer has been filled up (which is typically of + * size 1 per output frame, after initial input), and then reject input with + * AVERROR(EAGAIN). Once it starts rejecting input, you have no choice but to + * read at least some output. + * + * Not all codecs will follow a rigid and predictable dataflow; the only + * guarantee is that an AVERROR(EAGAIN) return value on a send/receive call on + * one end implies that a receive/send call on the other end will succeed, or + * at least will not fail with AVERROR(EAGAIN). In general, no codec will + * permit unlimited buffering of input or output. + * + * A codec is not allowed to return AVERROR(EAGAIN) for both sending and receiving. This + * would be an invalid state, which could put the codec user into an endless + * loop. The API has no concept of time either: it cannot happen that trying to + * do avcodec_send_packet() results in AVERROR(EAGAIN), but a repeated call 1 second + * later accepts the packet (with no other receive/flush API calls involved). + * The API is a strict state machine, and the passage of time is not supposed + * to influence it. Some timing-dependent behavior might still be deemed + * acceptable in certain cases. But it must never result in both send/receive + * returning EAGAIN at the same time at any point. It must also absolutely be + * avoided that the current state is "unstable" and can "flip-flop" between + * the send/receive APIs allowing progress. For example, it's not allowed that + * the codec randomly decides that it actually wants to consume a packet now + * instead of returning a frame, after it just returned AVERROR(EAGAIN) on an + * avcodec_send_packet() call. + * @} + */ + +/** + * @defgroup lavc_core Core functions/structures. + * @ingroup libavc + * + * Basic definitions, functions for querying libavcodec capabilities, + * allocating core structures, etc. + * @{ + */ + +/** + * @ingroup lavc_encoding + * minimum encoding buffer size + * Used to avoid some checks during header writing. + */ +#define AV_INPUT_BUFFER_MIN_SIZE 16384 + +/** + * @ingroup lavc_encoding + */ +typedef struct RcOverride{ + int start_frame; + int end_frame; + int qscale; // If this is 0 then quality_factor will be used instead. + float quality_factor; +} RcOverride; + +/* encoding support + These flags can be passed in AVCodecContext.flags before initialization. + Note: Not everything is supported yet. +*/ + +/** + * Allow decoders to produce frames with data planes that are not aligned + * to CPU requirements (e.g. due to cropping). + */ +#define AV_CODEC_FLAG_UNALIGNED (1 << 0) +/** + * Use fixed qscale. + */ +#define AV_CODEC_FLAG_QSCALE (1 << 1) +/** + * 4 MV per MB allowed / advanced prediction for H.263. + */ +#define AV_CODEC_FLAG_4MV (1 << 2) +/** + * Output even those frames that might be corrupted. + */ +#define AV_CODEC_FLAG_OUTPUT_CORRUPT (1 << 3) +/** + * Use qpel MC. + */ +#define AV_CODEC_FLAG_QPEL (1 << 4) +#if FF_API_DROPCHANGED +/** + * Don't output frames whose parameters differ from first + * decoded frame in stream. + * + * @deprecated callers should implement this functionality in their own code + */ +#define AV_CODEC_FLAG_DROPCHANGED (1 << 5) +#endif +/** + * Request the encoder to output reconstructed frames, i.e.\ frames that would + * be produced by decoding the encoded bistream. These frames may be retrieved + * by calling avcodec_receive_frame() immediately after a successful call to + * avcodec_receive_packet(). + * + * Should only be used with encoders flagged with the + * @ref AV_CODEC_CAP_ENCODER_RECON_FRAME capability. + * + * @note + * Each reconstructed frame returned by the encoder corresponds to the last + * encoded packet, i.e. the frames are returned in coded order rather than + * presentation order. + * + * @note + * Frame parameters (like pixel format or dimensions) do not have to match the + * AVCodecContext values. Make sure to use the values from the returned frame. + */ +#define AV_CODEC_FLAG_RECON_FRAME (1 << 6) +/** + * @par decoding + * Request the decoder to propagate each packet's AVPacket.opaque and + * AVPacket.opaque_ref to its corresponding output AVFrame. + * + * @par encoding: + * Request the encoder to propagate each frame's AVFrame.opaque and + * AVFrame.opaque_ref values to its corresponding output AVPacket. + * + * @par + * May only be set on encoders that have the + * @ref AV_CODEC_CAP_ENCODER_REORDERED_OPAQUE capability flag. + * + * @note + * While in typical cases one input frame produces exactly one output packet + * (perhaps after a delay), in general the mapping of frames to packets is + * M-to-N, so + * - Any number of input frames may be associated with any given output packet. + * This includes zero - e.g. some encoders may output packets that carry only + * metadata about the whole stream. + * - A given input frame may be associated with any number of output packets. + * Again this includes zero - e.g. some encoders may drop frames under certain + * conditions. + * . + * This implies that when using this flag, the caller must NOT assume that + * - a given input frame's opaques will necessarily appear on some output packet; + * - every output packet will have some non-NULL opaque value. + * . + * When an output packet contains multiple frames, the opaque values will be + * taken from the first of those. + * + * @note + * The converse holds for decoders, with frames and packets switched. + */ +#define AV_CODEC_FLAG_COPY_OPAQUE (1 << 7) +/** + * Signal to the encoder that the values of AVFrame.duration are valid and + * should be used (typically for transferring them to output packets). + * + * If this flag is not set, frame durations are ignored. + */ +#define AV_CODEC_FLAG_FRAME_DURATION (1 << 8) +/** + * Use internal 2pass ratecontrol in first pass mode. + */ +#define AV_CODEC_FLAG_PASS1 (1 << 9) +/** + * Use internal 2pass ratecontrol in second pass mode. + */ +#define AV_CODEC_FLAG_PASS2 (1 << 10) +/** + * loop filter. + */ +#define AV_CODEC_FLAG_LOOP_FILTER (1 << 11) +/** + * Only decode/encode grayscale. + */ +#define AV_CODEC_FLAG_GRAY (1 << 13) +/** + * error[?] variables will be set during encoding. + */ +#define AV_CODEC_FLAG_PSNR (1 << 15) +/** + * Use interlaced DCT. + */ +#define AV_CODEC_FLAG_INTERLACED_DCT (1 << 18) +/** + * Force low delay. + */ +#define AV_CODEC_FLAG_LOW_DELAY (1 << 19) +/** + * Place global headers in extradata instead of every keyframe. + */ +#define AV_CODEC_FLAG_GLOBAL_HEADER (1 << 22) +/** + * Use only bitexact stuff (except (I)DCT). + */ +#define AV_CODEC_FLAG_BITEXACT (1 << 23) +/* Fx : Flag for H.263+ extra options */ +/** + * H.263 advanced intra coding / MPEG-4 AC prediction + */ +#define AV_CODEC_FLAG_AC_PRED (1 << 24) +/** + * interlaced motion estimation + */ +#define AV_CODEC_FLAG_INTERLACED_ME (1 << 29) +#define AV_CODEC_FLAG_CLOSED_GOP (1U << 31) + +/** + * Allow non spec compliant speedup tricks. + */ +#define AV_CODEC_FLAG2_FAST (1 << 0) +/** + * Skip bitstream encoding. + */ +#define AV_CODEC_FLAG2_NO_OUTPUT (1 << 2) +/** + * Place global headers at every keyframe instead of in extradata. + */ +#define AV_CODEC_FLAG2_LOCAL_HEADER (1 << 3) + +/** + * Input bitstream might be truncated at a packet boundaries + * instead of only at frame boundaries. + */ +#define AV_CODEC_FLAG2_CHUNKS (1 << 15) +/** + * Discard cropping information from SPS. + */ +#define AV_CODEC_FLAG2_IGNORE_CROP (1 << 16) + +/** + * Show all frames before the first keyframe + */ +#define AV_CODEC_FLAG2_SHOW_ALL (1 << 22) +/** + * Export motion vectors through frame side data + */ +#define AV_CODEC_FLAG2_EXPORT_MVS (1 << 28) +/** + * Do not skip samples and export skip information as frame side data + */ +#define AV_CODEC_FLAG2_SKIP_MANUAL (1 << 29) +/** + * Do not reset ASS ReadOrder field on flush (subtitles decoding) + */ +#define AV_CODEC_FLAG2_RO_FLUSH_NOOP (1 << 30) +/** + * Generate/parse ICC profiles on encode/decode, as appropriate for the type of + * file. No effect on codecs which cannot contain embedded ICC profiles, or + * when compiled without support for lcms2. + */ +#define AV_CODEC_FLAG2_ICC_PROFILES (1U << 31) + +/* Exported side data. + These flags can be passed in AVCodecContext.export_side_data before initialization. +*/ +/** + * Export motion vectors through frame side data + */ +#define AV_CODEC_EXPORT_DATA_MVS (1 << 0) +/** + * Export encoder Producer Reference Time through packet side data + */ +#define AV_CODEC_EXPORT_DATA_PRFT (1 << 1) +/** + * Decoding only. + * Export the AVVideoEncParams structure through frame side data. + */ +#define AV_CODEC_EXPORT_DATA_VIDEO_ENC_PARAMS (1 << 2) +/** + * Decoding only. + * Do not apply film grain, export it instead. + */ +#define AV_CODEC_EXPORT_DATA_FILM_GRAIN (1 << 3) + +/** + * The decoder will keep a reference to the frame and may reuse it later. + */ +#define AV_GET_BUFFER_FLAG_REF (1 << 0) + +/** + * The encoder will keep a reference to the packet and may reuse it later. + */ +#define AV_GET_ENCODE_BUFFER_FLAG_REF (1 << 0) + +/** + * main external API structure. + * New fields can be added to the end with minor version bumps. + * Removal, reordering and changes to existing fields require a major + * version bump. + * You can use AVOptions (av_opt* / av_set/get*()) to access these fields from user + * applications. + * The name string for AVOptions options matches the associated command line + * parameter name and can be found in libavcodec/options_table.h + * The AVOption/command line parameter names differ in some cases from the C + * structure field names for historic reasons or brevity. + * sizeof(AVCodecContext) must not be used outside libav*. + */ +typedef struct AVCodecContext { + /** + * information on struct for av_log + * - set by avcodec_alloc_context3 + */ + const AVClass *av_class; + int log_level_offset; + + enum AVMediaType codec_type; /* see AVMEDIA_TYPE_xxx */ + const struct AVCodec *codec; + enum AVCodecID codec_id; /* see AV_CODEC_ID_xxx */ + + /** + * fourcc (LSB first, so "ABCD" -> ('D'<<24) + ('C'<<16) + ('B'<<8) + 'A'). + * This is used to work around some encoder bugs. + * A demuxer should set this to what is stored in the field used to identify the codec. + * If there are multiple such fields in a container then the demuxer should choose the one + * which maximizes the information about the used codec. + * If the codec tag field in a container is larger than 32 bits then the demuxer should + * remap the longer ID to 32 bits with a table or other structure. Alternatively a new + * extra_codec_tag + size could be added but for this a clear advantage must be demonstrated + * first. + * - encoding: Set by user, if not then the default based on codec_id will be used. + * - decoding: Set by user, will be converted to uppercase by libavcodec during init. + */ + unsigned int codec_tag; + + void *priv_data; + + /** + * Private context used for internal data. + * + * Unlike priv_data, this is not codec-specific. It is used in general + * libavcodec functions. + */ + struct AVCodecInternal *internal; + + /** + * Private data of the user, can be used to carry app specific stuff. + * - encoding: Set by user. + * - decoding: Set by user. + */ + void *opaque; + + /** + * the average bitrate + * - encoding: Set by user; unused for constant quantizer encoding. + * - decoding: Set by user, may be overwritten by libavcodec + * if this info is available in the stream + */ + int64_t bit_rate; + + /** + * number of bits the bitstream is allowed to diverge from the reference. + * the reference can be CBR (for CBR pass1) or VBR (for pass2) + * - encoding: Set by user; unused for constant quantizer encoding. + * - decoding: unused + */ + int bit_rate_tolerance; + + /** + * Global quality for codecs which cannot change it per frame. + * This should be proportional to MPEG-1/2/4 qscale. + * - encoding: Set by user. + * - decoding: unused + */ + int global_quality; + + /** + * - encoding: Set by user. + * - decoding: unused + */ + int compression_level; +#define FF_COMPRESSION_DEFAULT -1 + + /** + * AV_CODEC_FLAG_*. + * - encoding: Set by user. + * - decoding: Set by user. + */ + int flags; + + /** + * AV_CODEC_FLAG2_* + * - encoding: Set by user. + * - decoding: Set by user. + */ + int flags2; + + /** + * some codecs need / can use extradata like Huffman tables. + * MJPEG: Huffman tables + * rv10: additional flags + * MPEG-4: global headers (they can be in the bitstream or here) + * The allocated memory should be AV_INPUT_BUFFER_PADDING_SIZE bytes larger + * than extradata_size to avoid problems if it is read with the bitstream reader. + * The bytewise contents of extradata must not depend on the architecture or CPU endianness. + * Must be allocated with the av_malloc() family of functions. + * - encoding: Set/allocated/freed by libavcodec. + * - decoding: Set/allocated/freed by user. + */ + uint8_t *extradata; + int extradata_size; + + /** + * This is the fundamental unit of time (in seconds) in terms + * of which frame timestamps are represented. For fixed-fps content, + * timebase should be 1/framerate and timestamp increments should be + * identically 1. + * This often, but not always is the inverse of the frame rate or field rate + * for video. 1/time_base is not the average frame rate if the frame rate is not + * constant. + * + * Like containers, elementary streams also can store timestamps, 1/time_base + * is the unit in which these timestamps are specified. + * As example of such codec time base see ISO/IEC 14496-2:2001(E) + * vop_time_increment_resolution and fixed_vop_rate + * (fixed_vop_rate == 0 implies that it is different from the framerate) + * + * - encoding: MUST be set by user. + * - decoding: unused. + */ + AVRational time_base; + +#if FF_API_TICKS_PER_FRAME + /** + * For some codecs, the time base is closer to the field rate than the frame rate. + * Most notably, H.264 and MPEG-2 specify time_base as half of frame duration + * if no telecine is used ... + * + * Set to time_base ticks per frame. Default 1, e.g., H.264/MPEG-2 set it to 2. + * + * @deprecated + * - decoding: Use AVCodecDescriptor.props & AV_CODEC_PROP_FIELDS + * - encoding: Set AVCodecContext.framerate instead + * + */ + attribute_deprecated + int ticks_per_frame; +#endif + + /** + * Codec delay. + * + * Encoding: Number of frames delay there will be from the encoder input to + * the decoder output. (we assume the decoder matches the spec) + * Decoding: Number of frames delay in addition to what a standard decoder + * as specified in the spec would produce. + * + * Video: + * Number of frames the decoded output will be delayed relative to the + * encoded input. + * + * Audio: + * For encoding, this field is unused (see initial_padding). + * + * For decoding, this is the number of samples the decoder needs to + * output before the decoder's output is valid. When seeking, you should + * start decoding this many samples prior to your desired seek point. + * + * - encoding: Set by libavcodec. + * - decoding: Set by libavcodec. + */ + int delay; + + + /* video only */ + /** + * picture width / height. + * + * @note Those fields may not match the values of the last + * AVFrame output by avcodec_receive_frame() due frame + * reordering. + * + * - encoding: MUST be set by user. + * - decoding: May be set by the user before opening the decoder if known e.g. + * from the container. Some decoders will require the dimensions + * to be set by the caller. During decoding, the decoder may + * overwrite those values as required while parsing the data. + */ + int width, height; + + /** + * Bitstream width / height, may be different from width/height e.g. when + * the decoded frame is cropped before being output or lowres is enabled. + * + * @note Those field may not match the value of the last + * AVFrame output by avcodec_receive_frame() due frame + * reordering. + * + * - encoding: unused + * - decoding: May be set by the user before opening the decoder if known + * e.g. from the container. During decoding, the decoder may + * overwrite those values as required while parsing the data. + */ + int coded_width, coded_height; + + /** + * the number of pictures in a group of pictures, or 0 for intra_only + * - encoding: Set by user. + * - decoding: unused + */ + int gop_size; + + /** + * Pixel format, see AV_PIX_FMT_xxx. + * May be set by the demuxer if known from headers. + * May be overridden by the decoder if it knows better. + * + * @note This field may not match the value of the last + * AVFrame output by avcodec_receive_frame() due frame + * reordering. + * + * - encoding: Set by user. + * - decoding: Set by user if known, overridden by libavcodec while + * parsing the data. + */ + enum AVPixelFormat pix_fmt; + + /** + * If non NULL, 'draw_horiz_band' is called by the libavcodec + * decoder to draw a horizontal band. It improves cache usage. Not + * all codecs can do that. You must check the codec capabilities + * beforehand. + * When multithreading is used, it may be called from multiple threads + * at the same time; threads might draw different parts of the same AVFrame, + * or multiple AVFrames, and there is no guarantee that slices will be drawn + * in order. + * The function is also used by hardware acceleration APIs. + * It is called at least once during frame decoding to pass + * the data needed for hardware render. + * In that mode instead of pixel data, AVFrame points to + * a structure specific to the acceleration API. The application + * reads the structure and can change some fields to indicate progress + * or mark state. + * - encoding: unused + * - decoding: Set by user. + * @param height the height of the slice + * @param y the y position of the slice + * @param type 1->top field, 2->bottom field, 3->frame + * @param offset offset into the AVFrame.data from which the slice should be read + */ + void (*draw_horiz_band)(struct AVCodecContext *s, + const AVFrame *src, int offset[AV_NUM_DATA_POINTERS], + int y, int type, int height); + + /** + * Callback to negotiate the pixel format. Decoding only, may be set by the + * caller before avcodec_open2(). + * + * Called by some decoders to select the pixel format that will be used for + * the output frames. This is mainly used to set up hardware acceleration, + * then the provided format list contains the corresponding hwaccel pixel + * formats alongside the "software" one. The software pixel format may also + * be retrieved from \ref sw_pix_fmt. + * + * This callback will be called when the coded frame properties (such as + * resolution, pixel format, etc.) change and more than one output format is + * supported for those new properties. If a hardware pixel format is chosen + * and initialization for it fails, the callback may be called again + * immediately. + * + * This callback may be called from different threads if the decoder is + * multi-threaded, but not from more than one thread simultaneously. + * + * @param fmt list of formats which may be used in the current + * configuration, terminated by AV_PIX_FMT_NONE. + * @warning Behavior is undefined if the callback returns a value other + * than one of the formats in fmt or AV_PIX_FMT_NONE. + * @return the chosen format or AV_PIX_FMT_NONE + */ + enum AVPixelFormat (*get_format)(struct AVCodecContext *s, const enum AVPixelFormat * fmt); + + /** + * maximum number of B-frames between non-B-frames + * Note: The output will be delayed by max_b_frames+1 relative to the input. + * - encoding: Set by user. + * - decoding: unused + */ + int max_b_frames; + + /** + * qscale factor between IP and B-frames + * If > 0 then the last P-frame quantizer will be used (q= lastp_q*factor+offset). + * If < 0 then normal ratecontrol will be done (q= -normal_q*factor+offset). + * - encoding: Set by user. + * - decoding: unused + */ + float b_quant_factor; + + /** + * qscale offset between IP and B-frames + * - encoding: Set by user. + * - decoding: unused + */ + float b_quant_offset; + + /** + * Size of the frame reordering buffer in the decoder. + * For MPEG-2 it is 1 IPB or 0 low delay IP. + * - encoding: Set by libavcodec. + * - decoding: Set by libavcodec. + */ + int has_b_frames; + + /** + * qscale factor between P- and I-frames + * If > 0 then the last P-frame quantizer will be used (q = lastp_q * factor + offset). + * If < 0 then normal ratecontrol will be done (q= -normal_q*factor+offset). + * - encoding: Set by user. + * - decoding: unused + */ + float i_quant_factor; + + /** + * qscale offset between P and I-frames + * - encoding: Set by user. + * - decoding: unused + */ + float i_quant_offset; + + /** + * luminance masking (0-> disabled) + * - encoding: Set by user. + * - decoding: unused + */ + float lumi_masking; + + /** + * temporary complexity masking (0-> disabled) + * - encoding: Set by user. + * - decoding: unused + */ + float temporal_cplx_masking; + + /** + * spatial complexity masking (0-> disabled) + * - encoding: Set by user. + * - decoding: unused + */ + float spatial_cplx_masking; + + /** + * p block masking (0-> disabled) + * - encoding: Set by user. + * - decoding: unused + */ + float p_masking; + + /** + * darkness masking (0-> disabled) + * - encoding: Set by user. + * - decoding: unused + */ + float dark_masking; + +#if FF_API_SLICE_OFFSET + /** + * slice count + * - encoding: Set by libavcodec. + * - decoding: Set by user (or 0). + */ + attribute_deprecated + int slice_count; + + /** + * slice offsets in the frame in bytes + * - encoding: Set/allocated by libavcodec. + * - decoding: Set/allocated by user (or NULL). + */ + attribute_deprecated + int *slice_offset; +#endif + + /** + * sample aspect ratio (0 if unknown) + * That is the width of a pixel divided by the height of the pixel. + * Numerator and denominator must be relatively prime and smaller than 256 for some video standards. + * - encoding: Set by user. + * - decoding: Set by libavcodec. + */ + AVRational sample_aspect_ratio; + + /** + * motion estimation comparison function + * - encoding: Set by user. + * - decoding: unused + */ + int me_cmp; + /** + * subpixel motion estimation comparison function + * - encoding: Set by user. + * - decoding: unused + */ + int me_sub_cmp; + /** + * macroblock comparison function (not supported yet) + * - encoding: Set by user. + * - decoding: unused + */ + int mb_cmp; + /** + * interlaced DCT comparison function + * - encoding: Set by user. + * - decoding: unused + */ + int ildct_cmp; +#define FF_CMP_SAD 0 +#define FF_CMP_SSE 1 +#define FF_CMP_SATD 2 +#define FF_CMP_DCT 3 +#define FF_CMP_PSNR 4 +#define FF_CMP_BIT 5 +#define FF_CMP_RD 6 +#define FF_CMP_ZERO 7 +#define FF_CMP_VSAD 8 +#define FF_CMP_VSSE 9 +#define FF_CMP_NSSE 10 +#define FF_CMP_W53 11 +#define FF_CMP_W97 12 +#define FF_CMP_DCTMAX 13 +#define FF_CMP_DCT264 14 +#define FF_CMP_MEDIAN_SAD 15 +#define FF_CMP_CHROMA 256 + + /** + * ME diamond size & shape + * - encoding: Set by user. + * - decoding: unused + */ + int dia_size; + + /** + * amount of previous MV predictors (2a+1 x 2a+1 square) + * - encoding: Set by user. + * - decoding: unused + */ + int last_predictor_count; + + /** + * motion estimation prepass comparison function + * - encoding: Set by user. + * - decoding: unused + */ + int me_pre_cmp; + + /** + * ME prepass diamond size & shape + * - encoding: Set by user. + * - decoding: unused + */ + int pre_dia_size; + + /** + * subpel ME quality + * - encoding: Set by user. + * - decoding: unused + */ + int me_subpel_quality; + + /** + * maximum motion estimation search range in subpel units + * If 0 then no limit. + * + * - encoding: Set by user. + * - decoding: unused + */ + int me_range; + + /** + * slice flags + * - encoding: unused + * - decoding: Set by user. + */ + int slice_flags; +#define SLICE_FLAG_CODED_ORDER 0x0001 ///< draw_horiz_band() is called in coded order instead of display +#define SLICE_FLAG_ALLOW_FIELD 0x0002 ///< allow draw_horiz_band() with field slices (MPEG-2 field pics) +#define SLICE_FLAG_ALLOW_PLANE 0x0004 ///< allow draw_horiz_band() with 1 component at a time (SVQ1) + + /** + * macroblock decision mode + * - encoding: Set by user. + * - decoding: unused + */ + int mb_decision; +#define FF_MB_DECISION_SIMPLE 0 ///< uses mb_cmp +#define FF_MB_DECISION_BITS 1 ///< chooses the one which needs the fewest bits +#define FF_MB_DECISION_RD 2 ///< rate distortion + + /** + * custom intra quantization matrix + * Must be allocated with the av_malloc() family of functions, and will be freed in + * avcodec_free_context(). + * - encoding: Set/allocated by user, freed by libavcodec. Can be NULL. + * - decoding: Set/allocated/freed by libavcodec. + */ + uint16_t *intra_matrix; + + /** + * custom inter quantization matrix + * Must be allocated with the av_malloc() family of functions, and will be freed in + * avcodec_free_context(). + * - encoding: Set/allocated by user, freed by libavcodec. Can be NULL. + * - decoding: Set/allocated/freed by libavcodec. + */ + uint16_t *inter_matrix; + + /** + * precision of the intra DC coefficient - 8 + * - encoding: Set by user. + * - decoding: Set by libavcodec + */ + int intra_dc_precision; + + /** + * Number of macroblock rows at the top which are skipped. + * - encoding: unused + * - decoding: Set by user. + */ + int skip_top; + + /** + * Number of macroblock rows at the bottom which are skipped. + * - encoding: unused + * - decoding: Set by user. + */ + int skip_bottom; + + /** + * minimum MB Lagrange multiplier + * - encoding: Set by user. + * - decoding: unused + */ + int mb_lmin; + + /** + * maximum MB Lagrange multiplier + * - encoding: Set by user. + * - decoding: unused + */ + int mb_lmax; + + /** + * - encoding: Set by user. + * - decoding: unused + */ + int bidir_refine; + + /** + * minimum GOP size + * - encoding: Set by user. + * - decoding: unused + */ + int keyint_min; + + /** + * number of reference frames + * - encoding: Set by user. + * - decoding: Set by lavc. + */ + int refs; + + /** + * Note: Value depends upon the compare function used for fullpel ME. + * - encoding: Set by user. + * - decoding: unused + */ + int mv0_threshold; + + /** + * Chromaticity coordinates of the source primaries. + * - encoding: Set by user + * - decoding: Set by libavcodec + */ + enum AVColorPrimaries color_primaries; + + /** + * Color Transfer Characteristic. + * - encoding: Set by user + * - decoding: Set by libavcodec + */ + enum AVColorTransferCharacteristic color_trc; + + /** + * YUV colorspace type. + * - encoding: Set by user + * - decoding: Set by libavcodec + */ + enum AVColorSpace colorspace; + + /** + * MPEG vs JPEG YUV range. + * - encoding: Set by user to override the default output color range value, + * If not specified, libavcodec sets the color range depending on the + * output format. + * - decoding: Set by libavcodec, can be set by the user to propagate the + * color range to components reading from the decoder context. + */ + enum AVColorRange color_range; + + /** + * This defines the location of chroma samples. + * - encoding: Set by user + * - decoding: Set by libavcodec + */ + enum AVChromaLocation chroma_sample_location; + + /** + * Number of slices. + * Indicates number of picture subdivisions. Used for parallelized + * decoding. + * - encoding: Set by user + * - decoding: unused + */ + int slices; + + /** Field order + * - encoding: set by libavcodec + * - decoding: Set by user. + */ + enum AVFieldOrder field_order; + + /* audio only */ + int sample_rate; ///< samples per second + +#if FF_API_OLD_CHANNEL_LAYOUT + /** + * number of audio channels + * @deprecated use ch_layout.nb_channels + */ + attribute_deprecated + int channels; +#endif + + /** + * audio sample format + * - encoding: Set by user. + * - decoding: Set by libavcodec. + */ + enum AVSampleFormat sample_fmt; ///< sample format + + /* The following data should not be initialized. */ + /** + * Number of samples per channel in an audio frame. + * + * - encoding: set by libavcodec in avcodec_open2(). Each submitted frame + * except the last must contain exactly frame_size samples per channel. + * May be 0 when the codec has AV_CODEC_CAP_VARIABLE_FRAME_SIZE set, then the + * frame size is not restricted. + * - decoding: may be set by some decoders to indicate constant frame size + */ + int frame_size; + +#if FF_API_AVCTX_FRAME_NUMBER + /** + * Frame counter, set by libavcodec. + * + * - decoding: total number of frames returned from the decoder so far. + * - encoding: total number of frames passed to the encoder so far. + * + * @note the counter is not incremented if encoding/decoding resulted in + * an error. + * @deprecated use frame_num instead + */ + attribute_deprecated + int frame_number; +#endif + + /** + * number of bytes per packet if constant and known or 0 + * Used by some WAV based audio codecs. + */ + int block_align; + + /** + * Audio cutoff bandwidth (0 means "automatic") + * - encoding: Set by user. + * - decoding: unused + */ + int cutoff; + +#if FF_API_OLD_CHANNEL_LAYOUT + /** + * Audio channel layout. + * - encoding: set by user. + * - decoding: set by user, may be overwritten by libavcodec. + * @deprecated use ch_layout + */ + attribute_deprecated + uint64_t channel_layout; + + /** + * Request decoder to use this channel layout if it can (0 for default) + * - encoding: unused + * - decoding: Set by user. + * @deprecated use "downmix" codec private option + */ + attribute_deprecated + uint64_t request_channel_layout; +#endif + + /** + * Type of service that the audio stream conveys. + * - encoding: Set by user. + * - decoding: Set by libavcodec. + */ + enum AVAudioServiceType audio_service_type; + + /** + * desired sample format + * - encoding: Not used. + * - decoding: Set by user. + * Decoder will decode to this format if it can. + */ + enum AVSampleFormat request_sample_fmt; + + /** + * This callback is called at the beginning of each frame to get data + * buffer(s) for it. There may be one contiguous buffer for all the data or + * there may be a buffer per each data plane or anything in between. What + * this means is, you may set however many entries in buf[] you feel necessary. + * Each buffer must be reference-counted using the AVBuffer API (see description + * of buf[] below). + * + * The following fields will be set in the frame before this callback is + * called: + * - format + * - width, height (video only) + * - sample_rate, channel_layout, nb_samples (audio only) + * Their values may differ from the corresponding values in + * AVCodecContext. This callback must use the frame values, not the codec + * context values, to calculate the required buffer size. + * + * This callback must fill the following fields in the frame: + * - data[] + * - linesize[] + * - extended_data: + * * if the data is planar audio with more than 8 channels, then this + * callback must allocate and fill extended_data to contain all pointers + * to all data planes. data[] must hold as many pointers as it can. + * extended_data must be allocated with av_malloc() and will be freed in + * av_frame_unref(). + * * otherwise extended_data must point to data + * - buf[] must contain one or more pointers to AVBufferRef structures. Each of + * the frame's data and extended_data pointers must be contained in these. That + * is, one AVBufferRef for each allocated chunk of memory, not necessarily one + * AVBufferRef per data[] entry. See: av_buffer_create(), av_buffer_alloc(), + * and av_buffer_ref(). + * - extended_buf and nb_extended_buf must be allocated with av_malloc() by + * this callback and filled with the extra buffers if there are more + * buffers than buf[] can hold. extended_buf will be freed in + * av_frame_unref(). + * + * If AV_CODEC_CAP_DR1 is not set then get_buffer2() must call + * avcodec_default_get_buffer2() instead of providing buffers allocated by + * some other means. + * + * Each data plane must be aligned to the maximum required by the target + * CPU. + * + * @see avcodec_default_get_buffer2() + * + * Video: + * + * If AV_GET_BUFFER_FLAG_REF is set in flags then the frame may be reused + * (read and/or written to if it is writable) later by libavcodec. + * + * avcodec_align_dimensions2() should be used to find the required width and + * height, as they normally need to be rounded up to the next multiple of 16. + * + * Some decoders do not support linesizes changing between frames. + * + * If frame multithreading is used, this callback may be called from a + * different thread, but not from more than one at once. Does not need to be + * reentrant. + * + * @see avcodec_align_dimensions2() + * + * Audio: + * + * Decoders request a buffer of a particular size by setting + * AVFrame.nb_samples prior to calling get_buffer2(). The decoder may, + * however, utilize only part of the buffer by setting AVFrame.nb_samples + * to a smaller value in the output frame. + * + * As a convenience, av_samples_get_buffer_size() and + * av_samples_fill_arrays() in libavutil may be used by custom get_buffer2() + * functions to find the required data size and to fill data pointers and + * linesize. In AVFrame.linesize, only linesize[0] may be set for audio + * since all planes must be the same size. + * + * @see av_samples_get_buffer_size(), av_samples_fill_arrays() + * + * - encoding: unused + * - decoding: Set by libavcodec, user can override. + */ + int (*get_buffer2)(struct AVCodecContext *s, AVFrame *frame, int flags); + + /* - encoding parameters */ + float qcompress; ///< amount of qscale change between easy & hard scenes (0.0-1.0) + float qblur; ///< amount of qscale smoothing over time (0.0-1.0) + + /** + * minimum quantizer + * - encoding: Set by user. + * - decoding: unused + */ + int qmin; + + /** + * maximum quantizer + * - encoding: Set by user. + * - decoding: unused + */ + int qmax; + + /** + * maximum quantizer difference between frames + * - encoding: Set by user. + * - decoding: unused + */ + int max_qdiff; + + /** + * decoder bitstream buffer size + * - encoding: Set by user. + * - decoding: May be set by libavcodec. + */ + int rc_buffer_size; + + /** + * ratecontrol override, see RcOverride + * - encoding: Allocated/set/freed by user. + * - decoding: unused + */ + int rc_override_count; + RcOverride *rc_override; + + /** + * maximum bitrate + * - encoding: Set by user. + * - decoding: Set by user, may be overwritten by libavcodec. + */ + int64_t rc_max_rate; + + /** + * minimum bitrate + * - encoding: Set by user. + * - decoding: unused + */ + int64_t rc_min_rate; + + /** + * Ratecontrol attempt to use, at maximum, of what can be used without an underflow. + * - encoding: Set by user. + * - decoding: unused. + */ + float rc_max_available_vbv_use; + + /** + * Ratecontrol attempt to use, at least, times the amount needed to prevent a vbv overflow. + * - encoding: Set by user. + * - decoding: unused. + */ + float rc_min_vbv_overflow_use; + + /** + * Number of bits which should be loaded into the rc buffer before decoding starts. + * - encoding: Set by user. + * - decoding: unused + */ + int rc_initial_buffer_occupancy; + + /** + * trellis RD quantization + * - encoding: Set by user. + * - decoding: unused + */ + int trellis; + + /** + * pass1 encoding statistics output buffer + * - encoding: Set by libavcodec. + * - decoding: unused + */ + char *stats_out; + + /** + * pass2 encoding statistics input buffer + * Concatenated stuff from stats_out of pass1 should be placed here. + * - encoding: Allocated/set/freed by user. + * - decoding: unused + */ + char *stats_in; + + /** + * Work around bugs in encoders which sometimes cannot be detected automatically. + * - encoding: Set by user + * - decoding: Set by user + */ + int workaround_bugs; +#define FF_BUG_AUTODETECT 1 ///< autodetection +#define FF_BUG_XVID_ILACE 4 +#define FF_BUG_UMP4 8 +#define FF_BUG_NO_PADDING 16 +#define FF_BUG_AMV 32 +#define FF_BUG_QPEL_CHROMA 64 +#define FF_BUG_STD_QPEL 128 +#define FF_BUG_QPEL_CHROMA2 256 +#define FF_BUG_DIRECT_BLOCKSIZE 512 +#define FF_BUG_EDGE 1024 +#define FF_BUG_HPEL_CHROMA 2048 +#define FF_BUG_DC_CLIP 4096 +#define FF_BUG_MS 8192 ///< Work around various bugs in Microsoft's broken decoders. +#define FF_BUG_TRUNCATED 16384 +#define FF_BUG_IEDGE 32768 + + /** + * strictly follow the standard (MPEG-4, ...). + * - encoding: Set by user. + * - decoding: Set by user. + * Setting this to STRICT or higher means the encoder and decoder will + * generally do stupid things, whereas setting it to unofficial or lower + * will mean the encoder might produce output that is not supported by all + * spec-compliant decoders. Decoders don't differentiate between normal, + * unofficial and experimental (that is, they always try to decode things + * when they can) unless they are explicitly asked to behave stupidly + * (=strictly conform to the specs) + * This may only be set to one of the FF_COMPLIANCE_* values in defs.h. + */ + int strict_std_compliance; + + /** + * error concealment flags + * - encoding: unused + * - decoding: Set by user. + */ + int error_concealment; +#define FF_EC_GUESS_MVS 1 +#define FF_EC_DEBLOCK 2 +#define FF_EC_FAVOR_INTER 256 + + /** + * debug + * - encoding: Set by user. + * - decoding: Set by user. + */ + int debug; +#define FF_DEBUG_PICT_INFO 1 +#define FF_DEBUG_RC 2 +#define FF_DEBUG_BITSTREAM 4 +#define FF_DEBUG_MB_TYPE 8 +#define FF_DEBUG_QP 16 +#define FF_DEBUG_DCT_COEFF 0x00000040 +#define FF_DEBUG_SKIP 0x00000080 +#define FF_DEBUG_STARTCODE 0x00000100 +#define FF_DEBUG_ER 0x00000400 +#define FF_DEBUG_MMCO 0x00000800 +#define FF_DEBUG_BUGS 0x00001000 +#define FF_DEBUG_BUFFERS 0x00008000 +#define FF_DEBUG_THREADS 0x00010000 +#define FF_DEBUG_GREEN_MD 0x00800000 +#define FF_DEBUG_NOMC 0x01000000 + + /** + * Error recognition; may misdetect some more or less valid parts as errors. + * This is a bitfield of the AV_EF_* values defined in defs.h. + * + * - encoding: Set by user. + * - decoding: Set by user. + */ + int err_recognition; + +#if FF_API_REORDERED_OPAQUE + /** + * opaque 64-bit number (generally a PTS) that will be reordered and + * output in AVFrame.reordered_opaque + * - encoding: Set by libavcodec to the reordered_opaque of the input + * frame corresponding to the last returned packet. Only + * supported by encoders with the + * AV_CODEC_CAP_ENCODER_REORDERED_OPAQUE capability. + * - decoding: Set by user. + * + * @deprecated Use AV_CODEC_FLAG_COPY_OPAQUE instead + */ + attribute_deprecated + int64_t reordered_opaque; +#endif + + /** + * Hardware accelerator in use + * - encoding: unused. + * - decoding: Set by libavcodec + */ + const struct AVHWAccel *hwaccel; + + /** + * Legacy hardware accelerator context. + * + * For some hardware acceleration methods, the caller may use this field to + * signal hwaccel-specific data to the codec. The struct pointed to by this + * pointer is hwaccel-dependent and defined in the respective header. Please + * refer to the FFmpeg HW accelerator documentation to know how to fill + * this. + * + * In most cases this field is optional - the necessary information may also + * be provided to libavcodec through @ref hw_frames_ctx or @ref + * hw_device_ctx (see avcodec_get_hw_config()). However, in some cases it + * may be the only method of signalling some (optional) information. + * + * The struct and its contents are owned by the caller. + * + * - encoding: May be set by the caller before avcodec_open2(). Must remain + * valid until avcodec_free_context(). + * - decoding: May be set by the caller in the get_format() callback. + * Must remain valid until the next get_format() call, + * or avcodec_free_context() (whichever comes first). + */ + void *hwaccel_context; + + /** + * error + * - encoding: Set by libavcodec if flags & AV_CODEC_FLAG_PSNR. + * - decoding: unused + */ + uint64_t error[AV_NUM_DATA_POINTERS]; + + /** + * DCT algorithm, see FF_DCT_* below + * - encoding: Set by user. + * - decoding: unused + */ + int dct_algo; +#define FF_DCT_AUTO 0 +#define FF_DCT_FASTINT 1 +#define FF_DCT_INT 2 +#define FF_DCT_MMX 3 +#define FF_DCT_ALTIVEC 5 +#define FF_DCT_FAAN 6 + + /** + * IDCT algorithm, see FF_IDCT_* below. + * - encoding: Set by user. + * - decoding: Set by user. + */ + int idct_algo; +#define FF_IDCT_AUTO 0 +#define FF_IDCT_INT 1 +#define FF_IDCT_SIMPLE 2 +#define FF_IDCT_SIMPLEMMX 3 +#define FF_IDCT_ARM 7 +#define FF_IDCT_ALTIVEC 8 +#define FF_IDCT_SIMPLEARM 10 +#define FF_IDCT_XVID 14 +#define FF_IDCT_SIMPLEARMV5TE 16 +#define FF_IDCT_SIMPLEARMV6 17 +#define FF_IDCT_FAAN 20 +#define FF_IDCT_SIMPLENEON 22 +#if FF_API_IDCT_NONE +// formerly used by xvmc +#define FF_IDCT_NONE 24 +#endif +#define FF_IDCT_SIMPLEAUTO 128 + + /** + * bits per sample/pixel from the demuxer (needed for huffyuv). + * - encoding: Set by libavcodec. + * - decoding: Set by user. + */ + int bits_per_coded_sample; + + /** + * Bits per sample/pixel of internal libavcodec pixel/sample format. + * - encoding: set by user. + * - decoding: set by libavcodec. + */ + int bits_per_raw_sample; + + /** + * low resolution decoding, 1-> 1/2 size, 2->1/4 size + * - encoding: unused + * - decoding: Set by user. + */ + int lowres; + + /** + * thread count + * is used to decide how many independent tasks should be passed to execute() + * - encoding: Set by user. + * - decoding: Set by user. + */ + int thread_count; + + /** + * Which multithreading methods to use. + * Use of FF_THREAD_FRAME will increase decoding delay by one frame per thread, + * so clients which cannot provide future frames should not use it. + * + * - encoding: Set by user, otherwise the default is used. + * - decoding: Set by user, otherwise the default is used. + */ + int thread_type; +#define FF_THREAD_FRAME 1 ///< Decode more than one frame at once +#define FF_THREAD_SLICE 2 ///< Decode more than one part of a single frame at once + + /** + * Which multithreading methods are in use by the codec. + * - encoding: Set by libavcodec. + * - decoding: Set by libavcodec. + */ + int active_thread_type; + + /** + * The codec may call this to execute several independent things. + * It will return only after finishing all tasks. + * The user may replace this with some multithreaded implementation, + * the default implementation will execute the parts serially. + * @param count the number of things to execute + * - encoding: Set by libavcodec, user can override. + * - decoding: Set by libavcodec, user can override. + */ + int (*execute)(struct AVCodecContext *c, int (*func)(struct AVCodecContext *c2, void *arg), void *arg2, int *ret, int count, int size); + + /** + * The codec may call this to execute several independent things. + * It will return only after finishing all tasks. + * The user may replace this with some multithreaded implementation, + * the default implementation will execute the parts serially. + * @param c context passed also to func + * @param count the number of things to execute + * @param arg2 argument passed unchanged to func + * @param ret return values of executed functions, must have space for "count" values. May be NULL. + * @param func function that will be called count times, with jobnr from 0 to count-1. + * threadnr will be in the range 0 to c->thread_count-1 < MAX_THREADS and so that no + * two instances of func executing at the same time will have the same threadnr. + * @return always 0 currently, but code should handle a future improvement where when any call to func + * returns < 0 no further calls to func may be done and < 0 is returned. + * - encoding: Set by libavcodec, user can override. + * - decoding: Set by libavcodec, user can override. + */ + int (*execute2)(struct AVCodecContext *c, int (*func)(struct AVCodecContext *c2, void *arg, int jobnr, int threadnr), void *arg2, int *ret, int count); + + /** + * noise vs. sse weight for the nsse comparison function + * - encoding: Set by user. + * - decoding: unused + */ + int nsse_weight; + + /** + * profile + * - encoding: Set by user. + * - decoding: Set by libavcodec. + * See the AV_PROFILE_* defines in defs.h. + */ + int profile; +#if FF_API_FF_PROFILE_LEVEL + /** @deprecated The following defines are deprecated; use AV_PROFILE_* + * in defs.h instead. */ +#define FF_PROFILE_UNKNOWN -99 +#define FF_PROFILE_RESERVED -100 + +#define FF_PROFILE_AAC_MAIN 0 +#define FF_PROFILE_AAC_LOW 1 +#define FF_PROFILE_AAC_SSR 2 +#define FF_PROFILE_AAC_LTP 3 +#define FF_PROFILE_AAC_HE 4 +#define FF_PROFILE_AAC_HE_V2 28 +#define FF_PROFILE_AAC_LD 22 +#define FF_PROFILE_AAC_ELD 38 +#define FF_PROFILE_MPEG2_AAC_LOW 128 +#define FF_PROFILE_MPEG2_AAC_HE 131 + +#define FF_PROFILE_DNXHD 0 +#define FF_PROFILE_DNXHR_LB 1 +#define FF_PROFILE_DNXHR_SQ 2 +#define FF_PROFILE_DNXHR_HQ 3 +#define FF_PROFILE_DNXHR_HQX 4 +#define FF_PROFILE_DNXHR_444 5 + +#define FF_PROFILE_DTS 20 +#define FF_PROFILE_DTS_ES 30 +#define FF_PROFILE_DTS_96_24 40 +#define FF_PROFILE_DTS_HD_HRA 50 +#define FF_PROFILE_DTS_HD_MA 60 +#define FF_PROFILE_DTS_EXPRESS 70 +#define FF_PROFILE_DTS_HD_MA_X 61 +#define FF_PROFILE_DTS_HD_MA_X_IMAX 62 + + +#define FF_PROFILE_EAC3_DDP_ATMOS 30 + +#define FF_PROFILE_TRUEHD_ATMOS 30 + +#define FF_PROFILE_MPEG2_422 0 +#define FF_PROFILE_MPEG2_HIGH 1 +#define FF_PROFILE_MPEG2_SS 2 +#define FF_PROFILE_MPEG2_SNR_SCALABLE 3 +#define FF_PROFILE_MPEG2_MAIN 4 +#define FF_PROFILE_MPEG2_SIMPLE 5 + +#define FF_PROFILE_H264_CONSTRAINED (1<<9) // 8+1; constraint_set1_flag +#define FF_PROFILE_H264_INTRA (1<<11) // 8+3; constraint_set3_flag + +#define FF_PROFILE_H264_BASELINE 66 +#define FF_PROFILE_H264_CONSTRAINED_BASELINE (66|FF_PROFILE_H264_CONSTRAINED) +#define FF_PROFILE_H264_MAIN 77 +#define FF_PROFILE_H264_EXTENDED 88 +#define FF_PROFILE_H264_HIGH 100 +#define FF_PROFILE_H264_HIGH_10 110 +#define FF_PROFILE_H264_HIGH_10_INTRA (110|FF_PROFILE_H264_INTRA) +#define FF_PROFILE_H264_MULTIVIEW_HIGH 118 +#define FF_PROFILE_H264_HIGH_422 122 +#define FF_PROFILE_H264_HIGH_422_INTRA (122|FF_PROFILE_H264_INTRA) +#define FF_PROFILE_H264_STEREO_HIGH 128 +#define FF_PROFILE_H264_HIGH_444 144 +#define FF_PROFILE_H264_HIGH_444_PREDICTIVE 244 +#define FF_PROFILE_H264_HIGH_444_INTRA (244|FF_PROFILE_H264_INTRA) +#define FF_PROFILE_H264_CAVLC_444 44 + +#define FF_PROFILE_VC1_SIMPLE 0 +#define FF_PROFILE_VC1_MAIN 1 +#define FF_PROFILE_VC1_COMPLEX 2 +#define FF_PROFILE_VC1_ADVANCED 3 + +#define FF_PROFILE_MPEG4_SIMPLE 0 +#define FF_PROFILE_MPEG4_SIMPLE_SCALABLE 1 +#define FF_PROFILE_MPEG4_CORE 2 +#define FF_PROFILE_MPEG4_MAIN 3 +#define FF_PROFILE_MPEG4_N_BIT 4 +#define FF_PROFILE_MPEG4_SCALABLE_TEXTURE 5 +#define FF_PROFILE_MPEG4_SIMPLE_FACE_ANIMATION 6 +#define FF_PROFILE_MPEG4_BASIC_ANIMATED_TEXTURE 7 +#define FF_PROFILE_MPEG4_HYBRID 8 +#define FF_PROFILE_MPEG4_ADVANCED_REAL_TIME 9 +#define FF_PROFILE_MPEG4_CORE_SCALABLE 10 +#define FF_PROFILE_MPEG4_ADVANCED_CODING 11 +#define FF_PROFILE_MPEG4_ADVANCED_CORE 12 +#define FF_PROFILE_MPEG4_ADVANCED_SCALABLE_TEXTURE 13 +#define FF_PROFILE_MPEG4_SIMPLE_STUDIO 14 +#define FF_PROFILE_MPEG4_ADVANCED_SIMPLE 15 + +#define FF_PROFILE_JPEG2000_CSTREAM_RESTRICTION_0 1 +#define FF_PROFILE_JPEG2000_CSTREAM_RESTRICTION_1 2 +#define FF_PROFILE_JPEG2000_CSTREAM_NO_RESTRICTION 32768 +#define FF_PROFILE_JPEG2000_DCINEMA_2K 3 +#define FF_PROFILE_JPEG2000_DCINEMA_4K 4 + +#define FF_PROFILE_VP9_0 0 +#define FF_PROFILE_VP9_1 1 +#define FF_PROFILE_VP9_2 2 +#define FF_PROFILE_VP9_3 3 + +#define FF_PROFILE_HEVC_MAIN 1 +#define FF_PROFILE_HEVC_MAIN_10 2 +#define FF_PROFILE_HEVC_MAIN_STILL_PICTURE 3 +#define FF_PROFILE_HEVC_REXT 4 +#define FF_PROFILE_HEVC_SCC 9 + +#define FF_PROFILE_VVC_MAIN_10 1 +#define FF_PROFILE_VVC_MAIN_10_444 33 + +#define FF_PROFILE_AV1_MAIN 0 +#define FF_PROFILE_AV1_HIGH 1 +#define FF_PROFILE_AV1_PROFESSIONAL 2 + +#define FF_PROFILE_MJPEG_HUFFMAN_BASELINE_DCT 0xc0 +#define FF_PROFILE_MJPEG_HUFFMAN_EXTENDED_SEQUENTIAL_DCT 0xc1 +#define FF_PROFILE_MJPEG_HUFFMAN_PROGRESSIVE_DCT 0xc2 +#define FF_PROFILE_MJPEG_HUFFMAN_LOSSLESS 0xc3 +#define FF_PROFILE_MJPEG_JPEG_LS 0xf7 + +#define FF_PROFILE_SBC_MSBC 1 + +#define FF_PROFILE_PRORES_PROXY 0 +#define FF_PROFILE_PRORES_LT 1 +#define FF_PROFILE_PRORES_STANDARD 2 +#define FF_PROFILE_PRORES_HQ 3 +#define FF_PROFILE_PRORES_4444 4 +#define FF_PROFILE_PRORES_XQ 5 + +#define FF_PROFILE_ARIB_PROFILE_A 0 +#define FF_PROFILE_ARIB_PROFILE_C 1 + +#define FF_PROFILE_KLVA_SYNC 0 +#define FF_PROFILE_KLVA_ASYNC 1 + +#define FF_PROFILE_EVC_BASELINE 0 +#define FF_PROFILE_EVC_MAIN 1 +#endif + + /** + * Encoding level descriptor. + * - encoding: Set by user, corresponds to a specific level defined by the + * codec, usually corresponding to the profile level, if not specified it + * is set to FF_LEVEL_UNKNOWN. + * - decoding: Set by libavcodec. + * See AV_LEVEL_* in defs.h. + */ + int level; +#if FF_API_FF_PROFILE_LEVEL + /** @deprecated The following define is deprecated; use AV_LEVEL_UNKOWN + * in defs.h instead. */ +#define FF_LEVEL_UNKNOWN -99 +#endif + + /** + * Skip loop filtering for selected frames. + * - encoding: unused + * - decoding: Set by user. + */ + enum AVDiscard skip_loop_filter; + + /** + * Skip IDCT/dequantization for selected frames. + * - encoding: unused + * - decoding: Set by user. + */ + enum AVDiscard skip_idct; + + /** + * Skip decoding for selected frames. + * - encoding: unused + * - decoding: Set by user. + */ + enum AVDiscard skip_frame; + + /** + * Header containing style information for text subtitles. + * For SUBTITLE_ASS subtitle type, it should contain the whole ASS + * [Script Info] and [V4+ Styles] section, plus the [Events] line and + * the Format line following. It shouldn't include any Dialogue line. + * - encoding: Set/allocated/freed by user (before avcodec_open2()) + * - decoding: Set/allocated/freed by libavcodec (by avcodec_open2()) + */ + uint8_t *subtitle_header; + int subtitle_header_size; + + /** + * Audio only. The number of "priming" samples (padding) inserted by the + * encoder at the beginning of the audio. I.e. this number of leading + * decoded samples must be discarded by the caller to get the original audio + * without leading padding. + * + * - decoding: unused + * - encoding: Set by libavcodec. The timestamps on the output packets are + * adjusted by the encoder so that they always refer to the + * first sample of the data actually contained in the packet, + * including any added padding. E.g. if the timebase is + * 1/samplerate and the timestamp of the first input sample is + * 0, the timestamp of the first output packet will be + * -initial_padding. + */ + int initial_padding; + + /** + * - decoding: For codecs that store a framerate value in the compressed + * bitstream, the decoder may export it here. { 0, 1} when + * unknown. + * - encoding: May be used to signal the framerate of CFR content to an + * encoder. + */ + AVRational framerate; + + /** + * Nominal unaccelerated pixel format, see AV_PIX_FMT_xxx. + * - encoding: unused. + * - decoding: Set by libavcodec before calling get_format() + */ + enum AVPixelFormat sw_pix_fmt; + + /** + * Timebase in which pkt_dts/pts and AVPacket.dts/pts are expressed. + * - encoding: unused. + * - decoding: set by user. + */ + AVRational pkt_timebase; + + /** + * AVCodecDescriptor + * - encoding: unused. + * - decoding: set by libavcodec. + */ + const struct AVCodecDescriptor *codec_descriptor; + + /** + * Current statistics for PTS correction. + * - decoding: maintained and used by libavcodec, not intended to be used by user apps + * - encoding: unused + */ + int64_t pts_correction_num_faulty_pts; /// Number of incorrect PTS values so far + int64_t pts_correction_num_faulty_dts; /// Number of incorrect DTS values so far + int64_t pts_correction_last_pts; /// PTS of the last frame + int64_t pts_correction_last_dts; /// DTS of the last frame + + /** + * Character encoding of the input subtitles file. + * - decoding: set by user + * - encoding: unused + */ + char *sub_charenc; + + /** + * Subtitles character encoding mode. Formats or codecs might be adjusting + * this setting (if they are doing the conversion themselves for instance). + * - decoding: set by libavcodec + * - encoding: unused + */ + int sub_charenc_mode; +#define FF_SUB_CHARENC_MODE_DO_NOTHING -1 ///< do nothing (demuxer outputs a stream supposed to be already in UTF-8, or the codec is bitmap for instance) +#define FF_SUB_CHARENC_MODE_AUTOMATIC 0 ///< libavcodec will select the mode itself +#define FF_SUB_CHARENC_MODE_PRE_DECODER 1 ///< the AVPacket data needs to be recoded to UTF-8 before being fed to the decoder, requires iconv +#define FF_SUB_CHARENC_MODE_IGNORE 2 ///< neither convert the subtitles, nor check them for valid UTF-8 + + /** + * Skip processing alpha if supported by codec. + * Note that if the format uses pre-multiplied alpha (common with VP6, + * and recommended due to better video quality/compression) + * the image will look as if alpha-blended onto a black background. + * However for formats that do not use pre-multiplied alpha + * there might be serious artefacts (though e.g. libswscale currently + * assumes pre-multiplied alpha anyway). + * + * - decoding: set by user + * - encoding: unused + */ + int skip_alpha; + + /** + * Number of samples to skip after a discontinuity + * - decoding: unused + * - encoding: set by libavcodec + */ + int seek_preroll; + + /** + * custom intra quantization matrix + * - encoding: Set by user, can be NULL. + * - decoding: unused. + */ + uint16_t *chroma_intra_matrix; + + /** + * dump format separator. + * can be ", " or "\n " or anything else + * - encoding: Set by user. + * - decoding: Set by user. + */ + uint8_t *dump_separator; + + /** + * ',' separated list of allowed decoders. + * If NULL then all are allowed + * - encoding: unused + * - decoding: set by user + */ + char *codec_whitelist; + + /** + * Properties of the stream that gets decoded + * - encoding: unused + * - decoding: set by libavcodec + */ + unsigned properties; +#define FF_CODEC_PROPERTY_LOSSLESS 0x00000001 +#define FF_CODEC_PROPERTY_CLOSED_CAPTIONS 0x00000002 +#define FF_CODEC_PROPERTY_FILM_GRAIN 0x00000004 + + /** + * Additional data associated with the entire coded stream. + * + * - decoding: may be set by user before calling avcodec_open2(). + * - encoding: may be set by libavcodec after avcodec_open2(). + */ + AVPacketSideData *coded_side_data; + int nb_coded_side_data; + + /** + * A reference to the AVHWFramesContext describing the input (for encoding) + * or output (decoding) frames. The reference is set by the caller and + * afterwards owned (and freed) by libavcodec - it should never be read by + * the caller after being set. + * + * - decoding: This field should be set by the caller from the get_format() + * callback. The previous reference (if any) will always be + * unreffed by libavcodec before the get_format() call. + * + * If the default get_buffer2() is used with a hwaccel pixel + * format, then this AVHWFramesContext will be used for + * allocating the frame buffers. + * + * - encoding: For hardware encoders configured to use a hwaccel pixel + * format, this field should be set by the caller to a reference + * to the AVHWFramesContext describing input frames. + * AVHWFramesContext.format must be equal to + * AVCodecContext.pix_fmt. + * + * This field should be set before avcodec_open2() is called. + */ + AVBufferRef *hw_frames_ctx; + + /** + * Audio only. The amount of padding (in samples) appended by the encoder to + * the end of the audio. I.e. this number of decoded samples must be + * discarded by the caller from the end of the stream to get the original + * audio without any trailing padding. + * + * - decoding: unused + * - encoding: unused + */ + int trailing_padding; + + /** + * The number of pixels per image to maximally accept. + * + * - decoding: set by user + * - encoding: set by user + */ + int64_t max_pixels; + + /** + * A reference to the AVHWDeviceContext describing the device which will + * be used by a hardware encoder/decoder. The reference is set by the + * caller and afterwards owned (and freed) by libavcodec. + * + * This should be used if either the codec device does not require + * hardware frames or any that are used are to be allocated internally by + * libavcodec. If the user wishes to supply any of the frames used as + * encoder input or decoder output then hw_frames_ctx should be used + * instead. When hw_frames_ctx is set in get_format() for a decoder, this + * field will be ignored while decoding the associated stream segment, but + * may again be used on a following one after another get_format() call. + * + * For both encoders and decoders this field should be set before + * avcodec_open2() is called and must not be written to thereafter. + * + * Note that some decoders may require this field to be set initially in + * order to support hw_frames_ctx at all - in that case, all frames + * contexts used must be created on the same device. + */ + AVBufferRef *hw_device_ctx; + + /** + * Bit set of AV_HWACCEL_FLAG_* flags, which affect hardware accelerated + * decoding (if active). + * - encoding: unused + * - decoding: Set by user (either before avcodec_open2(), or in the + * AVCodecContext.get_format callback) + */ + int hwaccel_flags; + + /** + * Video decoding only. Certain video codecs support cropping, meaning that + * only a sub-rectangle of the decoded frame is intended for display. This + * option controls how cropping is handled by libavcodec. + * + * When set to 1 (the default), libavcodec will apply cropping internally. + * I.e. it will modify the output frame width/height fields and offset the + * data pointers (only by as much as possible while preserving alignment, or + * by the full amount if the AV_CODEC_FLAG_UNALIGNED flag is set) so that + * the frames output by the decoder refer only to the cropped area. The + * crop_* fields of the output frames will be zero. + * + * When set to 0, the width/height fields of the output frames will be set + * to the coded dimensions and the crop_* fields will describe the cropping + * rectangle. Applying the cropping is left to the caller. + * + * @warning When hardware acceleration with opaque output frames is used, + * libavcodec is unable to apply cropping from the top/left border. + * + * @note when this option is set to zero, the width/height fields of the + * AVCodecContext and output AVFrames have different meanings. The codec + * context fields store display dimensions (with the coded dimensions in + * coded_width/height), while the frame fields store the coded dimensions + * (with the display dimensions being determined by the crop_* fields). + */ + int apply_cropping; + + /* + * Video decoding only. Sets the number of extra hardware frames which + * the decoder will allocate for use by the caller. This must be set + * before avcodec_open2() is called. + * + * Some hardware decoders require all frames that they will use for + * output to be defined in advance before decoding starts. For such + * decoders, the hardware frame pool must therefore be of a fixed size. + * The extra frames set here are on top of any number that the decoder + * needs internally in order to operate normally (for example, frames + * used as reference pictures). + */ + int extra_hw_frames; + + /** + * The percentage of damaged samples to discard a frame. + * + * - decoding: set by user + * - encoding: unused + */ + int discard_damaged_percentage; + + /** + * The number of samples per frame to maximally accept. + * + * - decoding: set by user + * - encoding: set by user + */ + int64_t max_samples; + + /** + * Bit set of AV_CODEC_EXPORT_DATA_* flags, which affects the kind of + * metadata exported in frame, packet, or coded stream side data by + * decoders and encoders. + * + * - decoding: set by user + * - encoding: set by user + */ + int export_side_data; + + /** + * This callback is called at the beginning of each packet to get a data + * buffer for it. + * + * The following field will be set in the packet before this callback is + * called: + * - size + * This callback must use the above value to calculate the required buffer size, + * which must padded by at least AV_INPUT_BUFFER_PADDING_SIZE bytes. + * + * In some specific cases, the encoder may not use the entire buffer allocated by this + * callback. This will be reflected in the size value in the packet once returned by + * avcodec_receive_packet(). + * + * This callback must fill the following fields in the packet: + * - data: alignment requirements for AVPacket apply, if any. Some architectures and + * encoders may benefit from having aligned data. + * - buf: must contain a pointer to an AVBufferRef structure. The packet's + * data pointer must be contained in it. See: av_buffer_create(), av_buffer_alloc(), + * and av_buffer_ref(). + * + * If AV_CODEC_CAP_DR1 is not set then get_encode_buffer() must call + * avcodec_default_get_encode_buffer() instead of providing a buffer allocated by + * some other means. + * + * The flags field may contain a combination of AV_GET_ENCODE_BUFFER_FLAG_ flags. + * They may be used for example to hint what use the buffer may get after being + * created. + * Implementations of this callback may ignore flags they don't understand. + * If AV_GET_ENCODE_BUFFER_FLAG_REF is set in flags then the packet may be reused + * (read and/or written to if it is writable) later by libavcodec. + * + * This callback must be thread-safe, as when frame threading is used, it may + * be called from multiple threads simultaneously. + * + * @see avcodec_default_get_encode_buffer() + * + * - encoding: Set by libavcodec, user can override. + * - decoding: unused + */ + int (*get_encode_buffer)(struct AVCodecContext *s, AVPacket *pkt, int flags); + + /** + * Audio channel layout. + * - encoding: must be set by the caller, to one of AVCodec.ch_layouts. + * - decoding: may be set by the caller if known e.g. from the container. + * The decoder can then override during decoding as needed. + */ + AVChannelLayout ch_layout; + + /** + * Frame counter, set by libavcodec. + * + * - decoding: total number of frames returned from the decoder so far. + * - encoding: total number of frames passed to the encoder so far. + * + * @note the counter is not incremented if encoding/decoding resulted in + * an error. + */ + int64_t frame_num; +} AVCodecContext; + +/** + * @defgroup lavc_hwaccel AVHWAccel + * + * @note Nothing in this structure should be accessed by the user. At some + * point in future it will not be externally visible at all. + * + * @{ + */ +typedef struct AVHWAccel { + /** + * Name of the hardware accelerated codec. + * The name is globally unique among encoders and among decoders (but an + * encoder and a decoder can share the same name). + */ + const char *name; + + /** + * Type of codec implemented by the hardware accelerator. + * + * See AVMEDIA_TYPE_xxx + */ + enum AVMediaType type; + + /** + * Codec implemented by the hardware accelerator. + * + * See AV_CODEC_ID_xxx + */ + enum AVCodecID id; + + /** + * Supported pixel format. + * + * Only hardware accelerated formats are supported here. + */ + enum AVPixelFormat pix_fmt; + + /** + * Hardware accelerated codec capabilities. + * see AV_HWACCEL_CODEC_CAP_* + */ + int capabilities; +} AVHWAccel; + +/** + * HWAccel is experimental and is thus avoided in favor of non experimental + * codecs + */ +#define AV_HWACCEL_CODEC_CAP_EXPERIMENTAL 0x0200 + +/** + * Hardware acceleration should be used for decoding even if the codec level + * used is unknown or higher than the maximum supported level reported by the + * hardware driver. + * + * It's generally a good idea to pass this flag unless you have a specific + * reason not to, as hardware tends to under-report supported levels. + */ +#define AV_HWACCEL_FLAG_IGNORE_LEVEL (1 << 0) + +/** + * Hardware acceleration can output YUV pixel formats with a different chroma + * sampling than 4:2:0 and/or other than 8 bits per component. + */ +#define AV_HWACCEL_FLAG_ALLOW_HIGH_DEPTH (1 << 1) + +/** + * Hardware acceleration should still be attempted for decoding when the + * codec profile does not match the reported capabilities of the hardware. + * + * For example, this can be used to try to decode baseline profile H.264 + * streams in hardware - it will often succeed, because many streams marked + * as baseline profile actually conform to constrained baseline profile. + * + * @warning If the stream is actually not supported then the behaviour is + * undefined, and may include returning entirely incorrect output + * while indicating success. + */ +#define AV_HWACCEL_FLAG_ALLOW_PROFILE_MISMATCH (1 << 2) + +/** + * Some hardware decoders (namely nvdec) can either output direct decoder + * surfaces, or make an on-device copy and return said copy. + * There is a hard limit on how many decoder surfaces there can be, and it + * cannot be accurately guessed ahead of time. + * For some processing chains, this can be okay, but others will run into the + * limit and in turn produce very confusing errors that require fine tuning of + * more or less obscure options by the user, or in extreme cases cannot be + * resolved at all without inserting an avfilter that forces a copy. + * + * Thus, the hwaccel will by default make a copy for safety and resilience. + * If a users really wants to minimize the amount of copies, they can set this + * flag and ensure their processing chain does not exhaust the surface pool. + */ +#define AV_HWACCEL_FLAG_UNSAFE_OUTPUT (1 << 3) + +/** + * @} + */ + +enum AVSubtitleType { + SUBTITLE_NONE, + + SUBTITLE_BITMAP, ///< A bitmap, pict will be set + + /** + * Plain text, the text field must be set by the decoder and is + * authoritative. ass and pict fields may contain approximations. + */ + SUBTITLE_TEXT, + + /** + * Formatted text, the ass field must be set by the decoder and is + * authoritative. pict and text fields may contain approximations. + */ + SUBTITLE_ASS, +}; + +#define AV_SUBTITLE_FLAG_FORCED 0x00000001 + +typedef struct AVSubtitleRect { + int x; ///< top left corner of pict, undefined when pict is not set + int y; ///< top left corner of pict, undefined when pict is not set + int w; ///< width of pict, undefined when pict is not set + int h; ///< height of pict, undefined when pict is not set + int nb_colors; ///< number of colors in pict, undefined when pict is not set + + /** + * data+linesize for the bitmap of this subtitle. + * Can be set for text/ass as well once they are rendered. + */ + uint8_t *data[4]; + int linesize[4]; + + enum AVSubtitleType type; + + char *text; ///< 0 terminated plain UTF-8 text + + /** + * 0 terminated ASS/SSA compatible event line. + * The presentation of this is unaffected by the other values in this + * struct. + */ + char *ass; + + int flags; +} AVSubtitleRect; + +typedef struct AVSubtitle { + uint16_t format; /* 0 = graphics */ + uint32_t start_display_time; /* relative to packet pts, in ms */ + uint32_t end_display_time; /* relative to packet pts, in ms */ + unsigned num_rects; + AVSubtitleRect **rects; + int64_t pts; ///< Same as packet pts, in AV_TIME_BASE +} AVSubtitle; + +/** + * Return the LIBAVCODEC_VERSION_INT constant. + */ +unsigned avcodec_version(void); + +/** + * Return the libavcodec build-time configuration. + */ +const char *avcodec_configuration(void); + +/** + * Return the libavcodec license. + */ +const char *avcodec_license(void); + +/** + * Allocate an AVCodecContext and set its fields to default values. The + * resulting struct should be freed with avcodec_free_context(). + * + * @param codec if non-NULL, allocate private data and initialize defaults + * for the given codec. It is illegal to then call avcodec_open2() + * with a different codec. + * If NULL, then the codec-specific defaults won't be initialized, + * which may result in suboptimal default settings (this is + * important mainly for encoders, e.g. libx264). + * + * @return An AVCodecContext filled with default values or NULL on failure. + */ +AVCodecContext *avcodec_alloc_context3(const AVCodec *codec); + +/** + * Free the codec context and everything associated with it and write NULL to + * the provided pointer. + */ +void avcodec_free_context(AVCodecContext **avctx); + +/** + * Get the AVClass for AVCodecContext. It can be used in combination with + * AV_OPT_SEARCH_FAKE_OBJ for examining options. + * + * @see av_opt_find(). + */ +const AVClass *avcodec_get_class(void); + +/** + * Get the AVClass for AVSubtitleRect. It can be used in combination with + * AV_OPT_SEARCH_FAKE_OBJ for examining options. + * + * @see av_opt_find(). + */ +const AVClass *avcodec_get_subtitle_rect_class(void); + +/** + * Fill the parameters struct based on the values from the supplied codec + * context. Any allocated fields in par are freed and replaced with duplicates + * of the corresponding fields in codec. + * + * @return >= 0 on success, a negative AVERROR code on failure + */ +int avcodec_parameters_from_context(struct AVCodecParameters *par, + const AVCodecContext *codec); + +/** + * Fill the codec context based on the values from the supplied codec + * parameters. Any allocated fields in codec that have a corresponding field in + * par are freed and replaced with duplicates of the corresponding field in par. + * Fields in codec that do not have a counterpart in par are not touched. + * + * @return >= 0 on success, a negative AVERROR code on failure. + */ +int avcodec_parameters_to_context(AVCodecContext *codec, + const struct AVCodecParameters *par); + +/** + * Initialize the AVCodecContext to use the given AVCodec. Prior to using this + * function the context has to be allocated with avcodec_alloc_context3(). + * + * The functions avcodec_find_decoder_by_name(), avcodec_find_encoder_by_name(), + * avcodec_find_decoder() and avcodec_find_encoder() provide an easy way for + * retrieving a codec. + * + * Depending on the codec, you might need to set options in the codec context + * also for decoding (e.g. width, height, or the pixel or audio sample format in + * the case the information is not available in the bitstream, as when decoding + * raw audio or video). + * + * Options in the codec context can be set either by setting them in the options + * AVDictionary, or by setting the values in the context itself, directly or by + * using the av_opt_set() API before calling this function. + * + * Example: + * @code + * av_dict_set(&opts, "b", "2.5M", 0); + * codec = avcodec_find_decoder(AV_CODEC_ID_H264); + * if (!codec) + * exit(1); + * + * context = avcodec_alloc_context3(codec); + * + * if (avcodec_open2(context, codec, opts) < 0) + * exit(1); + * @endcode + * + * In the case AVCodecParameters are available (e.g. when demuxing a stream + * using libavformat, and accessing the AVStream contained in the demuxer), the + * codec parameters can be copied to the codec context using + * avcodec_parameters_to_context(), as in the following example: + * + * @code + * AVStream *stream = ...; + * context = avcodec_alloc_context3(codec); + * if (avcodec_parameters_to_context(context, stream->codecpar) < 0) + * exit(1); + * if (avcodec_open2(context, codec, NULL) < 0) + * exit(1); + * @endcode + * + * @note Always call this function before using decoding routines (such as + * @ref avcodec_receive_frame()). + * + * @param avctx The context to initialize. + * @param codec The codec to open this context for. If a non-NULL codec has been + * previously passed to avcodec_alloc_context3() or + * for this context, then this parameter MUST be either NULL or + * equal to the previously passed codec. + * @param options A dictionary filled with AVCodecContext and codec-private + * options, which are set on top of the options already set in + * avctx, can be NULL. On return this object will be filled with + * options that were not found in the avctx codec context. + * + * @return zero on success, a negative value on error + * @see avcodec_alloc_context3(), avcodec_find_decoder(), avcodec_find_encoder(), + * av_dict_set(), av_opt_set(), av_opt_find(), avcodec_parameters_to_context() + */ +int avcodec_open2(AVCodecContext *avctx, const AVCodec *codec, AVDictionary **options); + +/** + * Close a given AVCodecContext and free all the data associated with it + * (but not the AVCodecContext itself). + * + * Calling this function on an AVCodecContext that hasn't been opened will free + * the codec-specific data allocated in avcodec_alloc_context3() with a non-NULL + * codec. Subsequent calls will do nothing. + * + * @note Do not use this function. Use avcodec_free_context() to destroy a + * codec context (either open or closed). Opening and closing a codec context + * multiple times is not supported anymore -- use multiple codec contexts + * instead. + */ +int avcodec_close(AVCodecContext *avctx); + +/** + * Free all allocated data in the given subtitle struct. + * + * @param sub AVSubtitle to free. + */ +void avsubtitle_free(AVSubtitle *sub); + +/** + * @} + */ + +/** + * @addtogroup lavc_decoding + * @{ + */ + +/** + * The default callback for AVCodecContext.get_buffer2(). It is made public so + * it can be called by custom get_buffer2() implementations for decoders without + * AV_CODEC_CAP_DR1 set. + */ +int avcodec_default_get_buffer2(AVCodecContext *s, AVFrame *frame, int flags); + +/** + * The default callback for AVCodecContext.get_encode_buffer(). It is made public so + * it can be called by custom get_encode_buffer() implementations for encoders without + * AV_CODEC_CAP_DR1 set. + */ +int avcodec_default_get_encode_buffer(AVCodecContext *s, AVPacket *pkt, int flags); + +/** + * Modify width and height values so that they will result in a memory + * buffer that is acceptable for the codec if you do not use any horizontal + * padding. + * + * May only be used if a codec with AV_CODEC_CAP_DR1 has been opened. + */ +void avcodec_align_dimensions(AVCodecContext *s, int *width, int *height); + +/** + * Modify width and height values so that they will result in a memory + * buffer that is acceptable for the codec if you also ensure that all + * line sizes are a multiple of the respective linesize_align[i]. + * + * May only be used if a codec with AV_CODEC_CAP_DR1 has been opened. + */ +void avcodec_align_dimensions2(AVCodecContext *s, int *width, int *height, + int linesize_align[AV_NUM_DATA_POINTERS]); + +#ifdef FF_API_AVCODEC_CHROMA_POS +/** + * Converts AVChromaLocation to swscale x/y chroma position. + * + * The positions represent the chroma (0,0) position in a coordinates system + * with luma (0,0) representing the origin and luma(1,1) representing 256,256 + * + * @param xpos horizontal chroma sample position + * @param ypos vertical chroma sample position + * @deprecated Use av_chroma_location_enum_to_pos() instead. + */ + attribute_deprecated +int avcodec_enum_to_chroma_pos(int *xpos, int *ypos, enum AVChromaLocation pos); + +/** + * Converts swscale x/y chroma position to AVChromaLocation. + * + * The positions represent the chroma (0,0) position in a coordinates system + * with luma (0,0) representing the origin and luma(1,1) representing 256,256 + * + * @param xpos horizontal chroma sample position + * @param ypos vertical chroma sample position + * @deprecated Use av_chroma_location_pos_to_enum() instead. + */ + attribute_deprecated +enum AVChromaLocation avcodec_chroma_pos_to_enum(int xpos, int ypos); +#endif + +/** + * Decode a subtitle message. + * Return a negative value on error, otherwise return the number of bytes used. + * If no subtitle could be decompressed, got_sub_ptr is zero. + * Otherwise, the subtitle is stored in *sub. + * Note that AV_CODEC_CAP_DR1 is not available for subtitle codecs. This is for + * simplicity, because the performance difference is expected to be negligible + * and reusing a get_buffer written for video codecs would probably perform badly + * due to a potentially very different allocation pattern. + * + * Some decoders (those marked with AV_CODEC_CAP_DELAY) have a delay between input + * and output. This means that for some packets they will not immediately + * produce decoded output and need to be flushed at the end of decoding to get + * all the decoded data. Flushing is done by calling this function with packets + * with avpkt->data set to NULL and avpkt->size set to 0 until it stops + * returning subtitles. It is safe to flush even those decoders that are not + * marked with AV_CODEC_CAP_DELAY, then no subtitles will be returned. + * + * @note The AVCodecContext MUST have been opened with @ref avcodec_open2() + * before packets may be fed to the decoder. + * + * @param avctx the codec context + * @param[out] sub The preallocated AVSubtitle in which the decoded subtitle will be stored, + * must be freed with avsubtitle_free if *got_sub_ptr is set. + * @param[in,out] got_sub_ptr Zero if no subtitle could be decompressed, otherwise, it is nonzero. + * @param[in] avpkt The input AVPacket containing the input buffer. + */ +int avcodec_decode_subtitle2(AVCodecContext *avctx, AVSubtitle *sub, + int *got_sub_ptr, const AVPacket *avpkt); + +/** + * Supply raw packet data as input to a decoder. + * + * Internally, this call will copy relevant AVCodecContext fields, which can + * influence decoding per-packet, and apply them when the packet is actually + * decoded. (For example AVCodecContext.skip_frame, which might direct the + * decoder to drop the frame contained by the packet sent with this function.) + * + * @warning The input buffer, avpkt->data must be AV_INPUT_BUFFER_PADDING_SIZE + * larger than the actual read bytes because some optimized bitstream + * readers read 32 or 64 bits at once and could read over the end. + * + * @note The AVCodecContext MUST have been opened with @ref avcodec_open2() + * before packets may be fed to the decoder. + * + * @param avctx codec context + * @param[in] avpkt The input AVPacket. Usually, this will be a single video + * frame, or several complete audio frames. + * Ownership of the packet remains with the caller, and the + * decoder will not write to the packet. The decoder may create + * a reference to the packet data (or copy it if the packet is + * not reference-counted). + * Unlike with older APIs, the packet is always fully consumed, + * and if it contains multiple frames (e.g. some audio codecs), + * will require you to call avcodec_receive_frame() multiple + * times afterwards before you can send a new packet. + * It can be NULL (or an AVPacket with data set to NULL and + * size set to 0); in this case, it is considered a flush + * packet, which signals the end of the stream. Sending the + * first flush packet will return success. Subsequent ones are + * unnecessary and will return AVERROR_EOF. If the decoder + * still has frames buffered, it will return them after sending + * a flush packet. + * + * @retval 0 success + * @retval AVERROR(EAGAIN) input is not accepted in the current state - user + * must read output with avcodec_receive_frame() (once + * all output is read, the packet should be resent, + * and the call will not fail with EAGAIN). + * @retval AVERROR_EOF the decoder has been flushed, and no new packets can be + * sent to it (also returned if more than 1 flush + * packet is sent) + * @retval AVERROR(EINVAL) codec not opened, it is an encoder, or requires flush + * @retval AVERROR(ENOMEM) failed to add packet to internal queue, or similar + * @retval "another negative error code" legitimate decoding errors + */ +int avcodec_send_packet(AVCodecContext *avctx, const AVPacket *avpkt); + +/** + * Return decoded output data from a decoder or encoder (when the + * @ref AV_CODEC_FLAG_RECON_FRAME flag is used). + * + * @param avctx codec context + * @param frame This will be set to a reference-counted video or audio + * frame (depending on the decoder type) allocated by the + * codec. Note that the function will always call + * av_frame_unref(frame) before doing anything else. + * + * @retval 0 success, a frame was returned + * @retval AVERROR(EAGAIN) output is not available in this state - user must + * try to send new input + * @retval AVERROR_EOF the codec has been fully flushed, and there will be + * no more output frames + * @retval AVERROR(EINVAL) codec not opened, or it is an encoder without the + * @ref AV_CODEC_FLAG_RECON_FRAME flag enabled + * @retval "other negative error code" legitimate decoding errors + */ +int avcodec_receive_frame(AVCodecContext *avctx, AVFrame *frame); + +/** + * Supply a raw video or audio frame to the encoder. Use avcodec_receive_packet() + * to retrieve buffered output packets. + * + * @param avctx codec context + * @param[in] frame AVFrame containing the raw audio or video frame to be encoded. + * Ownership of the frame remains with the caller, and the + * encoder will not write to the frame. The encoder may create + * a reference to the frame data (or copy it if the frame is + * not reference-counted). + * It can be NULL, in which case it is considered a flush + * packet. This signals the end of the stream. If the encoder + * still has packets buffered, it will return them after this + * call. Once flushing mode has been entered, additional flush + * packets are ignored, and sending frames will return + * AVERROR_EOF. + * + * For audio: + * If AV_CODEC_CAP_VARIABLE_FRAME_SIZE is set, then each frame + * can have any number of samples. + * If it is not set, frame->nb_samples must be equal to + * avctx->frame_size for all frames except the last. + * The final frame may be smaller than avctx->frame_size. + * @retval 0 success + * @retval AVERROR(EAGAIN) input is not accepted in the current state - user must + * read output with avcodec_receive_packet() (once all + * output is read, the packet should be resent, and the + * call will not fail with EAGAIN). + * @retval AVERROR_EOF the encoder has been flushed, and no new frames can + * be sent to it + * @retval AVERROR(EINVAL) codec not opened, it is a decoder, or requires flush + * @retval AVERROR(ENOMEM) failed to add packet to internal queue, or similar + * @retval "another negative error code" legitimate encoding errors + */ +int avcodec_send_frame(AVCodecContext *avctx, const AVFrame *frame); + +/** + * Read encoded data from the encoder. + * + * @param avctx codec context + * @param avpkt This will be set to a reference-counted packet allocated by the + * encoder. Note that the function will always call + * av_packet_unref(avpkt) before doing anything else. + * @retval 0 success + * @retval AVERROR(EAGAIN) output is not available in the current state - user must + * try to send input + * @retval AVERROR_EOF the encoder has been fully flushed, and there will be no + * more output packets + * @retval AVERROR(EINVAL) codec not opened, or it is a decoder + * @retval "another negative error code" legitimate encoding errors + */ +int avcodec_receive_packet(AVCodecContext *avctx, AVPacket *avpkt); + +/** + * Create and return a AVHWFramesContext with values adequate for hardware + * decoding. This is meant to get called from the get_format callback, and is + * a helper for preparing a AVHWFramesContext for AVCodecContext.hw_frames_ctx. + * This API is for decoding with certain hardware acceleration modes/APIs only. + * + * The returned AVHWFramesContext is not initialized. The caller must do this + * with av_hwframe_ctx_init(). + * + * Calling this function is not a requirement, but makes it simpler to avoid + * codec or hardware API specific details when manually allocating frames. + * + * Alternatively to this, an API user can set AVCodecContext.hw_device_ctx, + * which sets up AVCodecContext.hw_frames_ctx fully automatically, and makes + * it unnecessary to call this function or having to care about + * AVHWFramesContext initialization at all. + * + * There are a number of requirements for calling this function: + * + * - It must be called from get_format with the same avctx parameter that was + * passed to get_format. Calling it outside of get_format is not allowed, and + * can trigger undefined behavior. + * - The function is not always supported (see description of return values). + * Even if this function returns successfully, hwaccel initialization could + * fail later. (The degree to which implementations check whether the stream + * is actually supported varies. Some do this check only after the user's + * get_format callback returns.) + * - The hw_pix_fmt must be one of the choices suggested by get_format. If the + * user decides to use a AVHWFramesContext prepared with this API function, + * the user must return the same hw_pix_fmt from get_format. + * - The device_ref passed to this function must support the given hw_pix_fmt. + * - After calling this API function, it is the user's responsibility to + * initialize the AVHWFramesContext (returned by the out_frames_ref parameter), + * and to set AVCodecContext.hw_frames_ctx to it. If done, this must be done + * before returning from get_format (this is implied by the normal + * AVCodecContext.hw_frames_ctx API rules). + * - The AVHWFramesContext parameters may change every time time get_format is + * called. Also, AVCodecContext.hw_frames_ctx is reset before get_format. So + * you are inherently required to go through this process again on every + * get_format call. + * - It is perfectly possible to call this function without actually using + * the resulting AVHWFramesContext. One use-case might be trying to reuse a + * previously initialized AVHWFramesContext, and calling this API function + * only to test whether the required frame parameters have changed. + * - Fields that use dynamically allocated values of any kind must not be set + * by the user unless setting them is explicitly allowed by the documentation. + * If the user sets AVHWFramesContext.free and AVHWFramesContext.user_opaque, + * the new free callback must call the potentially set previous free callback. + * This API call may set any dynamically allocated fields, including the free + * callback. + * + * The function will set at least the following fields on AVHWFramesContext + * (potentially more, depending on hwaccel API): + * + * - All fields set by av_hwframe_ctx_alloc(). + * - Set the format field to hw_pix_fmt. + * - Set the sw_format field to the most suited and most versatile format. (An + * implication is that this will prefer generic formats over opaque formats + * with arbitrary restrictions, if possible.) + * - Set the width/height fields to the coded frame size, rounded up to the + * API-specific minimum alignment. + * - Only _if_ the hwaccel requires a pre-allocated pool: set the initial_pool_size + * field to the number of maximum reference surfaces possible with the codec, + * plus 1 surface for the user to work (meaning the user can safely reference + * at most 1 decoded surface at a time), plus additional buffering introduced + * by frame threading. If the hwaccel does not require pre-allocation, the + * field is left to 0, and the decoder will allocate new surfaces on demand + * during decoding. + * - Possibly AVHWFramesContext.hwctx fields, depending on the underlying + * hardware API. + * + * Essentially, out_frames_ref returns the same as av_hwframe_ctx_alloc(), but + * with basic frame parameters set. + * + * The function is stateless, and does not change the AVCodecContext or the + * device_ref AVHWDeviceContext. + * + * @param avctx The context which is currently calling get_format, and which + * implicitly contains all state needed for filling the returned + * AVHWFramesContext properly. + * @param device_ref A reference to the AVHWDeviceContext describing the device + * which will be used by the hardware decoder. + * @param hw_pix_fmt The hwaccel format you are going to return from get_format. + * @param out_frames_ref On success, set to a reference to an _uninitialized_ + * AVHWFramesContext, created from the given device_ref. + * Fields will be set to values required for decoding. + * Not changed if an error is returned. + * @return zero on success, a negative value on error. The following error codes + * have special semantics: + * AVERROR(ENOENT): the decoder does not support this functionality. Setup + * is always manual, or it is a decoder which does not + * support setting AVCodecContext.hw_frames_ctx at all, + * or it is a software format. + * AVERROR(EINVAL): it is known that hardware decoding is not supported for + * this configuration, or the device_ref is not supported + * for the hwaccel referenced by hw_pix_fmt. + */ +int avcodec_get_hw_frames_parameters(AVCodecContext *avctx, + AVBufferRef *device_ref, + enum AVPixelFormat hw_pix_fmt, + AVBufferRef **out_frames_ref); + + + +/** + * @defgroup lavc_parsing Frame parsing + * @{ + */ + +enum AVPictureStructure { + AV_PICTURE_STRUCTURE_UNKNOWN, ///< unknown + AV_PICTURE_STRUCTURE_TOP_FIELD, ///< coded as top field + AV_PICTURE_STRUCTURE_BOTTOM_FIELD, ///< coded as bottom field + AV_PICTURE_STRUCTURE_FRAME, ///< coded as frame +}; + +typedef struct AVCodecParserContext { + void *priv_data; + const struct AVCodecParser *parser; + int64_t frame_offset; /* offset of the current frame */ + int64_t cur_offset; /* current offset + (incremented by each av_parser_parse()) */ + int64_t next_frame_offset; /* offset of the next frame */ + /* video info */ + int pict_type; /* XXX: Put it back in AVCodecContext. */ + /** + * This field is used for proper frame duration computation in lavf. + * It signals, how much longer the frame duration of the current frame + * is compared to normal frame duration. + * + * frame_duration = (1 + repeat_pict) * time_base + * + * It is used by codecs like H.264 to display telecined material. + */ + int repeat_pict; /* XXX: Put it back in AVCodecContext. */ + int64_t pts; /* pts of the current frame */ + int64_t dts; /* dts of the current frame */ + + /* private data */ + int64_t last_pts; + int64_t last_dts; + int fetch_timestamp; + +#define AV_PARSER_PTS_NB 4 + int cur_frame_start_index; + int64_t cur_frame_offset[AV_PARSER_PTS_NB]; + int64_t cur_frame_pts[AV_PARSER_PTS_NB]; + int64_t cur_frame_dts[AV_PARSER_PTS_NB]; + + int flags; +#define PARSER_FLAG_COMPLETE_FRAMES 0x0001 +#define PARSER_FLAG_ONCE 0x0002 +/// Set if the parser has a valid file offset +#define PARSER_FLAG_FETCHED_OFFSET 0x0004 +#define PARSER_FLAG_USE_CODEC_TS 0x1000 + + int64_t offset; ///< byte offset from starting packet start + int64_t cur_frame_end[AV_PARSER_PTS_NB]; + + /** + * Set by parser to 1 for key frames and 0 for non-key frames. + * It is initialized to -1, so if the parser doesn't set this flag, + * old-style fallback using AV_PICTURE_TYPE_I picture type as key frames + * will be used. + */ + int key_frame; + + // Timestamp generation support: + /** + * Synchronization point for start of timestamp generation. + * + * Set to >0 for sync point, 0 for no sync point and <0 for undefined + * (default). + * + * For example, this corresponds to presence of H.264 buffering period + * SEI message. + */ + int dts_sync_point; + + /** + * Offset of the current timestamp against last timestamp sync point in + * units of AVCodecContext.time_base. + * + * Set to INT_MIN when dts_sync_point unused. Otherwise, it must + * contain a valid timestamp offset. + * + * Note that the timestamp of sync point has usually a nonzero + * dts_ref_dts_delta, which refers to the previous sync point. Offset of + * the next frame after timestamp sync point will be usually 1. + * + * For example, this corresponds to H.264 cpb_removal_delay. + */ + int dts_ref_dts_delta; + + /** + * Presentation delay of current frame in units of AVCodecContext.time_base. + * + * Set to INT_MIN when dts_sync_point unused. Otherwise, it must + * contain valid non-negative timestamp delta (presentation time of a frame + * must not lie in the past). + * + * This delay represents the difference between decoding and presentation + * time of the frame. + * + * For example, this corresponds to H.264 dpb_output_delay. + */ + int pts_dts_delta; + + /** + * Position of the packet in file. + * + * Analogous to cur_frame_pts/dts + */ + int64_t cur_frame_pos[AV_PARSER_PTS_NB]; + + /** + * Byte position of currently parsed frame in stream. + */ + int64_t pos; + + /** + * Previous frame byte position. + */ + int64_t last_pos; + + /** + * Duration of the current frame. + * For audio, this is in units of 1 / AVCodecContext.sample_rate. + * For all other types, this is in units of AVCodecContext.time_base. + */ + int duration; + + enum AVFieldOrder field_order; + + /** + * Indicate whether a picture is coded as a frame, top field or bottom field. + * + * For example, H.264 field_pic_flag equal to 0 corresponds to + * AV_PICTURE_STRUCTURE_FRAME. An H.264 picture with field_pic_flag + * equal to 1 and bottom_field_flag equal to 0 corresponds to + * AV_PICTURE_STRUCTURE_TOP_FIELD. + */ + enum AVPictureStructure picture_structure; + + /** + * Picture number incremented in presentation or output order. + * This field may be reinitialized at the first picture of a new sequence. + * + * For example, this corresponds to H.264 PicOrderCnt. + */ + int output_picture_number; + + /** + * Dimensions of the decoded video intended for presentation. + */ + int width; + int height; + + /** + * Dimensions of the coded video. + */ + int coded_width; + int coded_height; + + /** + * The format of the coded data, corresponds to enum AVPixelFormat for video + * and for enum AVSampleFormat for audio. + * + * Note that a decoder can have considerable freedom in how exactly it + * decodes the data, so the format reported here might be different from the + * one returned by a decoder. + */ + int format; +} AVCodecParserContext; + +typedef struct AVCodecParser { + int codec_ids[7]; /* several codec IDs are permitted */ + int priv_data_size; + int (*parser_init)(AVCodecParserContext *s); + /* This callback never returns an error, a negative value means that + * the frame start was in a previous packet. */ + int (*parser_parse)(AVCodecParserContext *s, + AVCodecContext *avctx, + const uint8_t **poutbuf, int *poutbuf_size, + const uint8_t *buf, int buf_size); + void (*parser_close)(AVCodecParserContext *s); + int (*split)(AVCodecContext *avctx, const uint8_t *buf, int buf_size); +} AVCodecParser; + +/** + * Iterate over all registered codec parsers. + * + * @param opaque a pointer where libavcodec will store the iteration state. Must + * point to NULL to start the iteration. + * + * @return the next registered codec parser or NULL when the iteration is + * finished + */ +const AVCodecParser *av_parser_iterate(void **opaque); + +AVCodecParserContext *av_parser_init(int codec_id); + +/** + * Parse a packet. + * + * @param s parser context. + * @param avctx codec context. + * @param poutbuf set to pointer to parsed buffer or NULL if not yet finished. + * @param poutbuf_size set to size of parsed buffer or zero if not yet finished. + * @param buf input buffer. + * @param buf_size buffer size in bytes without the padding. I.e. the full buffer + size is assumed to be buf_size + AV_INPUT_BUFFER_PADDING_SIZE. + To signal EOF, this should be 0 (so that the last frame + can be output). + * @param pts input presentation timestamp. + * @param dts input decoding timestamp. + * @param pos input byte position in stream. + * @return the number of bytes of the input bitstream used. + * + * Example: + * @code + * while(in_len){ + * len = av_parser_parse2(myparser, AVCodecContext, &data, &size, + * in_data, in_len, + * pts, dts, pos); + * in_data += len; + * in_len -= len; + * + * if(size) + * decode_frame(data, size); + * } + * @endcode + */ +int av_parser_parse2(AVCodecParserContext *s, + AVCodecContext *avctx, + uint8_t **poutbuf, int *poutbuf_size, + const uint8_t *buf, int buf_size, + int64_t pts, int64_t dts, + int64_t pos); + +void av_parser_close(AVCodecParserContext *s); + +/** + * @} + * @} + */ + +/** + * @addtogroup lavc_encoding + * @{ + */ + +int avcodec_encode_subtitle(AVCodecContext *avctx, uint8_t *buf, int buf_size, + const AVSubtitle *sub); + + +/** + * @} + */ + +/** + * @defgroup lavc_misc Utility functions + * @ingroup libavc + * + * Miscellaneous utility functions related to both encoding and decoding + * (or neither). + * @{ + */ + +/** + * @defgroup lavc_misc_pixfmt Pixel formats + * + * Functions for working with pixel formats. + * @{ + */ + +/** + * Return a value representing the fourCC code associated to the + * pixel format pix_fmt, or 0 if no associated fourCC code can be + * found. + */ +unsigned int avcodec_pix_fmt_to_codec_tag(enum AVPixelFormat pix_fmt); + +/** + * Find the best pixel format to convert to given a certain source pixel + * format. When converting from one pixel format to another, information loss + * may occur. For example, when converting from RGB24 to GRAY, the color + * information will be lost. Similarly, other losses occur when converting from + * some formats to other formats. avcodec_find_best_pix_fmt_of_2() searches which of + * the given pixel formats should be used to suffer the least amount of loss. + * The pixel formats from which it chooses one, are determined by the + * pix_fmt_list parameter. + * + * + * @param[in] pix_fmt_list AV_PIX_FMT_NONE terminated array of pixel formats to choose from + * @param[in] src_pix_fmt source pixel format + * @param[in] has_alpha Whether the source pixel format alpha channel is used. + * @param[out] loss_ptr Combination of flags informing you what kind of losses will occur. + * @return The best pixel format to convert to or -1 if none was found. + */ +enum AVPixelFormat avcodec_find_best_pix_fmt_of_list(const enum AVPixelFormat *pix_fmt_list, + enum AVPixelFormat src_pix_fmt, + int has_alpha, int *loss_ptr); + +enum AVPixelFormat avcodec_default_get_format(struct AVCodecContext *s, const enum AVPixelFormat * fmt); + +/** + * @} + */ + +void avcodec_string(char *buf, int buf_size, AVCodecContext *enc, int encode); + +int avcodec_default_execute(AVCodecContext *c, int (*func)(AVCodecContext *c2, void *arg2),void *arg, int *ret, int count, int size); +int avcodec_default_execute2(AVCodecContext *c, int (*func)(AVCodecContext *c2, void *arg2, int, int),void *arg, int *ret, int count); +//FIXME func typedef + +/** + * Fill AVFrame audio data and linesize pointers. + * + * The buffer buf must be a preallocated buffer with a size big enough + * to contain the specified samples amount. The filled AVFrame data + * pointers will point to this buffer. + * + * AVFrame extended_data channel pointers are allocated if necessary for + * planar audio. + * + * @param frame the AVFrame + * frame->nb_samples must be set prior to calling the + * function. This function fills in frame->data, + * frame->extended_data, frame->linesize[0]. + * @param nb_channels channel count + * @param sample_fmt sample format + * @param buf buffer to use for frame data + * @param buf_size size of buffer + * @param align plane size sample alignment (0 = default) + * @return >=0 on success, negative error code on failure + * @todo return the size in bytes required to store the samples in + * case of success, at the next libavutil bump + */ +int avcodec_fill_audio_frame(AVFrame *frame, int nb_channels, + enum AVSampleFormat sample_fmt, const uint8_t *buf, + int buf_size, int align); + +/** + * Reset the internal codec state / flush internal buffers. Should be called + * e.g. when seeking or when switching to a different stream. + * + * @note for decoders, this function just releases any references the decoder + * might keep internally, but the caller's references remain valid. + * + * @note for encoders, this function will only do something if the encoder + * declares support for AV_CODEC_CAP_ENCODER_FLUSH. When called, the encoder + * will drain any remaining packets, and can then be re-used for a different + * stream (as opposed to sending a null frame which will leave the encoder + * in a permanent EOF state after draining). This can be desirable if the + * cost of tearing down and replacing the encoder instance is high. + */ +void avcodec_flush_buffers(AVCodecContext *avctx); + +/** + * Return audio frame duration. + * + * @param avctx codec context + * @param frame_bytes size of the frame, or 0 if unknown + * @return frame duration, in samples, if known. 0 if not able to + * determine. + */ +int av_get_audio_frame_duration(AVCodecContext *avctx, int frame_bytes); + +/* memory */ + +/** + * Same behaviour av_fast_malloc but the buffer has additional + * AV_INPUT_BUFFER_PADDING_SIZE at the end which will always be 0. + * + * In addition the whole buffer will initially and after resizes + * be 0-initialized so that no uninitialized data will ever appear. + */ +void av_fast_padded_malloc(void *ptr, unsigned int *size, size_t min_size); + +/** + * Same behaviour av_fast_padded_malloc except that buffer will always + * be 0-initialized after call. + */ +void av_fast_padded_mallocz(void *ptr, unsigned int *size, size_t min_size); + +/** + * @return a positive value if s is open (i.e. avcodec_open2() was called on it + * with no corresponding avcodec_close()), 0 otherwise. + */ +int avcodec_is_open(AVCodecContext *s); + +/** + * @} + */ + +#endif /* AVCODEC_AVCODEC_H */ diff --git a/libs/FFmpeg/include/libavcodec/avdct.h b/libs/FFmpeg/include/libavcodec/avdct.h new file mode 100644 index 0000000..6411fab --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/avdct.h @@ -0,0 +1,88 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_AVDCT_H +#define AVCODEC_AVDCT_H + +#include "libavutil/opt.h" + +/** + * AVDCT context. + * @note function pointers can be NULL if the specific features have been + * disabled at build time. + */ +typedef struct AVDCT { + const AVClass *av_class; + + void (*idct)(int16_t *block /* align 16 */); + + /** + * IDCT input permutation. + * Several optimized IDCTs need a permutated input (relative to the + * normal order of the reference IDCT). + * This permutation must be performed before the idct_put/add. + * Note, normally this can be merged with the zigzag/alternate scan
+ * An example to avoid confusion: + * - (->decode coeffs -> zigzag reorder -> dequant -> reference IDCT -> ...) + * - (x -> reference DCT -> reference IDCT -> x) + * - (x -> reference DCT -> simple_mmx_perm = idct_permutation + * -> simple_idct_mmx -> x) + * - (-> decode coeffs -> zigzag reorder -> simple_mmx_perm -> dequant + * -> simple_idct_mmx -> ...) + */ + uint8_t idct_permutation[64]; + + void (*fdct)(int16_t *block /* align 16 */); + + + /** + * DCT algorithm. + * must use AVOptions to set this field. + */ + int dct_algo; + + /** + * IDCT algorithm. + * must use AVOptions to set this field. + */ + int idct_algo; + + void (*get_pixels)(int16_t *block /* align 16 */, + const uint8_t *pixels /* align 8 */, + ptrdiff_t line_size); + + int bits_per_sample; + + void (*get_pixels_unaligned)(int16_t *block /* align 16 */, + const uint8_t *pixels, + ptrdiff_t line_size); +} AVDCT; + +/** + * Allocates a AVDCT context. + * This needs to be initialized with avcodec_dct_init() after optionally + * configuring it with AVOptions. + * + * To free it use av_free() + */ +AVDCT *avcodec_dct_alloc(void); +int avcodec_dct_init(AVDCT *); + +const AVClass *avcodec_dct_get_class(void); + +#endif /* AVCODEC_AVDCT_H */ diff --git a/libs/FFmpeg/include/libavcodec/avfft.h b/libs/FFmpeg/include/libavcodec/avfft.h new file mode 100644 index 0000000..e3a0da1 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/avfft.h @@ -0,0 +1,149 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_AVFFT_H +#define AVCODEC_AVFFT_H + +#include "libavutil/attributes.h" +#include "version_major.h" +#if FF_API_AVFFT + +/** + * @file + * @ingroup lavc_fft + * FFT functions + */ + +/** + * @defgroup lavc_fft FFT functions + * @ingroup lavc_misc + * + * @{ + */ + +typedef float FFTSample; + +typedef struct FFTComplex { + FFTSample re, im; +} FFTComplex; + +typedef struct FFTContext FFTContext; + +/** + * Set up a complex FFT. + * @param nbits log2 of the length of the input array + * @param inverse if 0 perform the forward transform, if 1 perform the inverse + * @deprecated use av_tx_init from libavutil/tx.h with a type of AV_TX_FLOAT_FFT + */ +attribute_deprecated +FFTContext *av_fft_init(int nbits, int inverse); + +/** + * Do the permutation needed BEFORE calling ff_fft_calc(). + * @deprecated without replacement + */ +attribute_deprecated +void av_fft_permute(FFTContext *s, FFTComplex *z); + +/** + * Do a complex FFT with the parameters defined in av_fft_init(). The + * input data must be permuted before. No 1.0/sqrt(n) normalization is done. + * @deprecated use the av_tx_fn value returned by av_tx_init, which also does permutation + */ +attribute_deprecated +void av_fft_calc(FFTContext *s, FFTComplex *z); + +attribute_deprecated +void av_fft_end(FFTContext *s); + +/** + * @deprecated use av_tx_init from libavutil/tx.h with a type of AV_TX_FLOAT_MDCT, + * with a flag of AV_TX_FULL_IMDCT for a replacement to av_imdct_calc. + */ +attribute_deprecated +FFTContext *av_mdct_init(int nbits, int inverse, double scale); +attribute_deprecated +void av_imdct_calc(FFTContext *s, FFTSample *output, const FFTSample *input); +attribute_deprecated +void av_imdct_half(FFTContext *s, FFTSample *output, const FFTSample *input); +attribute_deprecated +void av_mdct_calc(FFTContext *s, FFTSample *output, const FFTSample *input); +attribute_deprecated +void av_mdct_end(FFTContext *s); + +/* Real Discrete Fourier Transform */ + +enum RDFTransformType { + DFT_R2C, + IDFT_C2R, + IDFT_R2C, + DFT_C2R, +}; + +typedef struct RDFTContext RDFTContext; + +/** + * Set up a real FFT. + * @param nbits log2 of the length of the input array + * @param trans the type of transform + * + * @deprecated use av_tx_init from libavutil/tx.h with a type of AV_TX_FLOAT_RDFT + */ +attribute_deprecated +RDFTContext *av_rdft_init(int nbits, enum RDFTransformType trans); +attribute_deprecated +void av_rdft_calc(RDFTContext *s, FFTSample *data); +attribute_deprecated +void av_rdft_end(RDFTContext *s); + +/* Discrete Cosine Transform */ + +typedef struct DCTContext DCTContext; + +enum DCTTransformType { + DCT_II = 0, + DCT_III, + DCT_I, + DST_I, +}; + +/** + * Set up DCT. + * + * @param nbits size of the input array: + * (1 << nbits) for DCT-II, DCT-III and DST-I + * (1 << nbits) + 1 for DCT-I + * @param type the type of transform + * + * @note the first element of the input of DST-I is ignored + * + * @deprecated use av_tx_init from libavutil/tx.h with an appropriate type of AV_TX_FLOAT_DCT + */ +attribute_deprecated +DCTContext *av_dct_init(int nbits, enum DCTTransformType type); +attribute_deprecated +void av_dct_calc(DCTContext *s, FFTSample *data); +attribute_deprecated +void av_dct_end (DCTContext *s); + +/** + * @} + */ + +#endif /* FF_API_AVFFT */ +#endif /* AVCODEC_AVFFT_H */ diff --git a/libs/FFmpeg/include/libavcodec/bsf.h b/libs/FFmpeg/include/libavcodec/bsf.h new file mode 100644 index 0000000..a09c69f --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/bsf.h @@ -0,0 +1,332 @@ +/* + * Bitstream filters public API + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_BSF_H +#define AVCODEC_BSF_H + +#include "libavutil/dict.h" +#include "libavutil/log.h" +#include "libavutil/rational.h" + +#include "codec_id.h" +#include "codec_par.h" +#include "packet.h" + +/** + * @defgroup lavc_bsf Bitstream filters + * @ingroup libavc + * + * Bitstream filters transform encoded media data without decoding it. This + * allows e.g. manipulating various header values. Bitstream filters operate on + * @ref AVPacket "AVPackets". + * + * The bitstream filtering API is centered around two structures: + * AVBitStreamFilter and AVBSFContext. The former represents a bitstream filter + * in abstract, the latter a specific filtering process. Obtain an + * AVBitStreamFilter using av_bsf_get_by_name() or av_bsf_iterate(), then pass + * it to av_bsf_alloc() to create an AVBSFContext. Fill in the user-settable + * AVBSFContext fields, as described in its documentation, then call + * av_bsf_init() to prepare the filter context for use. + * + * Submit packets for filtering using av_bsf_send_packet(), obtain filtered + * results with av_bsf_receive_packet(). When no more input packets will be + * sent, submit a NULL AVPacket to signal the end of the stream to the filter. + * av_bsf_receive_packet() will then return trailing packets, if any are + * produced by the filter. + * + * Finally, free the filter context with av_bsf_free(). + * @{ + */ + +/** + * The bitstream filter state. + * + * This struct must be allocated with av_bsf_alloc() and freed with + * av_bsf_free(). + * + * The fields in the struct will only be changed (by the caller or by the + * filter) as described in their documentation, and are to be considered + * immutable otherwise. + */ +typedef struct AVBSFContext { + /** + * A class for logging and AVOptions + */ + const AVClass *av_class; + + /** + * The bitstream filter this context is an instance of. + */ + const struct AVBitStreamFilter *filter; + + /** + * Opaque filter-specific private data. If filter->priv_class is non-NULL, + * this is an AVOptions-enabled struct. + */ + void *priv_data; + + /** + * Parameters of the input stream. This field is allocated in + * av_bsf_alloc(), it needs to be filled by the caller before + * av_bsf_init(). + */ + AVCodecParameters *par_in; + + /** + * Parameters of the output stream. This field is allocated in + * av_bsf_alloc(), it is set by the filter in av_bsf_init(). + */ + AVCodecParameters *par_out; + + /** + * The timebase used for the timestamps of the input packets. Set by the + * caller before av_bsf_init(). + */ + AVRational time_base_in; + + /** + * The timebase used for the timestamps of the output packets. Set by the + * filter in av_bsf_init(). + */ + AVRational time_base_out; +} AVBSFContext; + +typedef struct AVBitStreamFilter { + const char *name; + + /** + * A list of codec ids supported by the filter, terminated by + * AV_CODEC_ID_NONE. + * May be NULL, in that case the bitstream filter works with any codec id. + */ + const enum AVCodecID *codec_ids; + + /** + * A class for the private data, used to declare bitstream filter private + * AVOptions. This field is NULL for bitstream filters that do not declare + * any options. + * + * If this field is non-NULL, the first member of the filter private data + * must be a pointer to AVClass, which will be set by libavcodec generic + * code to this class. + */ + const AVClass *priv_class; +} AVBitStreamFilter; + +/** + * @return a bitstream filter with the specified name or NULL if no such + * bitstream filter exists. + */ +const AVBitStreamFilter *av_bsf_get_by_name(const char *name); + +/** + * Iterate over all registered bitstream filters. + * + * @param opaque a pointer where libavcodec will store the iteration state. Must + * point to NULL to start the iteration. + * + * @return the next registered bitstream filter or NULL when the iteration is + * finished + */ +const AVBitStreamFilter *av_bsf_iterate(void **opaque); + +/** + * Allocate a context for a given bitstream filter. The caller must fill in the + * context parameters as described in the documentation and then call + * av_bsf_init() before sending any data to the filter. + * + * @param filter the filter for which to allocate an instance. + * @param[out] ctx a pointer into which the pointer to the newly-allocated context + * will be written. It must be freed with av_bsf_free() after the + * filtering is done. + * + * @return 0 on success, a negative AVERROR code on failure + */ +int av_bsf_alloc(const AVBitStreamFilter *filter, AVBSFContext **ctx); + +/** + * Prepare the filter for use, after all the parameters and options have been + * set. + * + * @param ctx a AVBSFContext previously allocated with av_bsf_alloc() + */ +int av_bsf_init(AVBSFContext *ctx); + +/** + * Submit a packet for filtering. + * + * After sending each packet, the filter must be completely drained by calling + * av_bsf_receive_packet() repeatedly until it returns AVERROR(EAGAIN) or + * AVERROR_EOF. + * + * @param ctx an initialized AVBSFContext + * @param pkt the packet to filter. The bitstream filter will take ownership of + * the packet and reset the contents of pkt. pkt is not touched if an error occurs. + * If pkt is empty (i.e. NULL, or pkt->data is NULL and pkt->side_data_elems zero), + * it signals the end of the stream (i.e. no more non-empty packets will be sent; + * sending more empty packets does nothing) and will cause the filter to output + * any packets it may have buffered internally. + * + * @return + * - 0 on success. + * - AVERROR(EAGAIN) if packets need to be retrieved from the filter (using + * av_bsf_receive_packet()) before new input can be consumed. + * - Another negative AVERROR value if an error occurs. + */ +int av_bsf_send_packet(AVBSFContext *ctx, AVPacket *pkt); + +/** + * Retrieve a filtered packet. + * + * @param ctx an initialized AVBSFContext + * @param[out] pkt this struct will be filled with the contents of the filtered + * packet. It is owned by the caller and must be freed using + * av_packet_unref() when it is no longer needed. + * This parameter should be "clean" (i.e. freshly allocated + * with av_packet_alloc() or unreffed with av_packet_unref()) + * when this function is called. If this function returns + * successfully, the contents of pkt will be completely + * overwritten by the returned data. On failure, pkt is not + * touched. + * + * @return + * - 0 on success. + * - AVERROR(EAGAIN) if more packets need to be sent to the filter (using + * av_bsf_send_packet()) to get more output. + * - AVERROR_EOF if there will be no further output from the filter. + * - Another negative AVERROR value if an error occurs. + * + * @note one input packet may result in several output packets, so after sending + * a packet with av_bsf_send_packet(), this function needs to be called + * repeatedly until it stops returning 0. It is also possible for a filter to + * output fewer packets than were sent to it, so this function may return + * AVERROR(EAGAIN) immediately after a successful av_bsf_send_packet() call. + */ +int av_bsf_receive_packet(AVBSFContext *ctx, AVPacket *pkt); + +/** + * Reset the internal bitstream filter state. Should be called e.g. when seeking. + */ +void av_bsf_flush(AVBSFContext *ctx); + +/** + * Free a bitstream filter context and everything associated with it; write NULL + * into the supplied pointer. + */ +void av_bsf_free(AVBSFContext **ctx); + +/** + * Get the AVClass for AVBSFContext. It can be used in combination with + * AV_OPT_SEARCH_FAKE_OBJ for examining options. + * + * @see av_opt_find(). + */ +const AVClass *av_bsf_get_class(void); + +/** + * Structure for chain/list of bitstream filters. + * Empty list can be allocated by av_bsf_list_alloc(). + */ +typedef struct AVBSFList AVBSFList; + +/** + * Allocate empty list of bitstream filters. + * The list must be later freed by av_bsf_list_free() + * or finalized by av_bsf_list_finalize(). + * + * @return Pointer to @ref AVBSFList on success, NULL in case of failure + */ +AVBSFList *av_bsf_list_alloc(void); + +/** + * Free list of bitstream filters. + * + * @param lst Pointer to pointer returned by av_bsf_list_alloc() + */ +void av_bsf_list_free(AVBSFList **lst); + +/** + * Append bitstream filter to the list of bitstream filters. + * + * @param lst List to append to + * @param bsf Filter context to be appended + * + * @return >=0 on success, negative AVERROR in case of failure + */ +int av_bsf_list_append(AVBSFList *lst, AVBSFContext *bsf); + +/** + * Construct new bitstream filter context given it's name and options + * and append it to the list of bitstream filters. + * + * @param lst List to append to + * @param bsf_name Name of the bitstream filter + * @param options Options for the bitstream filter, can be set to NULL + * + * @return >=0 on success, negative AVERROR in case of failure + */ +int av_bsf_list_append2(AVBSFList *lst, const char * bsf_name, AVDictionary **options); +/** + * Finalize list of bitstream filters. + * + * This function will transform @ref AVBSFList to single @ref AVBSFContext, + * so the whole chain of bitstream filters can be treated as single filter + * freshly allocated by av_bsf_alloc(). + * If the call is successful, @ref AVBSFList structure is freed and lst + * will be set to NULL. In case of failure, caller is responsible for + * freeing the structure by av_bsf_list_free() + * + * @param lst Filter list structure to be transformed + * @param[out] bsf Pointer to be set to newly created @ref AVBSFContext structure + * representing the chain of bitstream filters + * + * @return >=0 on success, negative AVERROR in case of failure + */ +int av_bsf_list_finalize(AVBSFList **lst, AVBSFContext **bsf); + +/** + * Parse string describing list of bitstream filters and create single + * @ref AVBSFContext describing the whole chain of bitstream filters. + * Resulting @ref AVBSFContext can be treated as any other @ref AVBSFContext freshly + * allocated by av_bsf_alloc(). + * + * @param str String describing chain of bitstream filters in format + * `bsf1[=opt1=val1:opt2=val2][,bsf2]` + * @param[out] bsf Pointer to be set to newly created @ref AVBSFContext structure + * representing the chain of bitstream filters + * + * @return >=0 on success, negative AVERROR in case of failure + */ +int av_bsf_list_parse_str(const char *str, AVBSFContext **bsf); + +/** + * Get null/pass-through bitstream filter. + * + * @param[out] bsf Pointer to be set to new instance of pass-through bitstream filter + * + * @return + */ +int av_bsf_get_null_filter(AVBSFContext **bsf); + +/** + * @} + */ + +#endif // AVCODEC_BSF_H diff --git a/libs/FFmpeg/include/libavcodec/codec.h b/libs/FFmpeg/include/libavcodec/codec.h new file mode 100644 index 0000000..8034f1a --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/codec.h @@ -0,0 +1,378 @@ +/* + * AVCodec public API + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_CODEC_H +#define AVCODEC_CODEC_H + +#include + +#include "libavutil/avutil.h" +#include "libavutil/hwcontext.h" +#include "libavutil/log.h" +#include "libavutil/pixfmt.h" +#include "libavutil/rational.h" +#include "libavutil/samplefmt.h" + +#include "libavcodec/codec_id.h" +#include "libavcodec/version_major.h" + +/** + * @addtogroup lavc_core + * @{ + */ + +/** + * Decoder can use draw_horiz_band callback. + */ +#define AV_CODEC_CAP_DRAW_HORIZ_BAND (1 << 0) +/** + * Codec uses get_buffer() or get_encode_buffer() for allocating buffers and + * supports custom allocators. + * If not set, it might not use get_buffer() or get_encode_buffer() at all, or + * use operations that assume the buffer was allocated by + * avcodec_default_get_buffer2 or avcodec_default_get_encode_buffer. + */ +#define AV_CODEC_CAP_DR1 (1 << 1) +/** + * Encoder or decoder requires flushing with NULL input at the end in order to + * give the complete and correct output. + * + * NOTE: If this flag is not set, the codec is guaranteed to never be fed with + * with NULL data. The user can still send NULL data to the public encode + * or decode function, but libavcodec will not pass it along to the codec + * unless this flag is set. + * + * Decoders: + * The decoder has a non-zero delay and needs to be fed with avpkt->data=NULL, + * avpkt->size=0 at the end to get the delayed data until the decoder no longer + * returns frames. + * + * Encoders: + * The encoder needs to be fed with NULL data at the end of encoding until the + * encoder no longer returns data. + * + * NOTE: For encoders implementing the AVCodec.encode2() function, setting this + * flag also means that the encoder must set the pts and duration for + * each output packet. If this flag is not set, the pts and duration will + * be determined by libavcodec from the input frame. + */ +#define AV_CODEC_CAP_DELAY (1 << 5) +/** + * Codec can be fed a final frame with a smaller size. + * This can be used to prevent truncation of the last audio samples. + */ +#define AV_CODEC_CAP_SMALL_LAST_FRAME (1 << 6) + +#if FF_API_SUBFRAMES +/** + * Codec can output multiple frames per AVPacket + * Normally demuxers return one frame at a time, demuxers which do not do + * are connected to a parser to split what they return into proper frames. + * This flag is reserved to the very rare category of codecs which have a + * bitstream that cannot be split into frames without timeconsuming + * operations like full decoding. Demuxers carrying such bitstreams thus + * may return multiple frames in a packet. This has many disadvantages like + * prohibiting stream copy in many cases thus it should only be considered + * as a last resort. + */ +#define AV_CODEC_CAP_SUBFRAMES (1 << 8) +#endif + +/** + * Codec is experimental and is thus avoided in favor of non experimental + * encoders + */ +#define AV_CODEC_CAP_EXPERIMENTAL (1 << 9) +/** + * Codec should fill in channel configuration and samplerate instead of container + */ +#define AV_CODEC_CAP_CHANNEL_CONF (1 << 10) +/** + * Codec supports frame-level multithreading. + */ +#define AV_CODEC_CAP_FRAME_THREADS (1 << 12) +/** + * Codec supports slice-based (or partition-based) multithreading. + */ +#define AV_CODEC_CAP_SLICE_THREADS (1 << 13) +/** + * Codec supports changed parameters at any point. + */ +#define AV_CODEC_CAP_PARAM_CHANGE (1 << 14) +/** + * Codec supports multithreading through a method other than slice- or + * frame-level multithreading. Typically this marks wrappers around + * multithreading-capable external libraries. + */ +#define AV_CODEC_CAP_OTHER_THREADS (1 << 15) +/** + * Audio encoder supports receiving a different number of samples in each call. + */ +#define AV_CODEC_CAP_VARIABLE_FRAME_SIZE (1 << 16) +/** + * Decoder is not a preferred choice for probing. + * This indicates that the decoder is not a good choice for probing. + * It could for example be an expensive to spin up hardware decoder, + * or it could simply not provide a lot of useful information about + * the stream. + * A decoder marked with this flag should only be used as last resort + * choice for probing. + */ +#define AV_CODEC_CAP_AVOID_PROBING (1 << 17) + +/** + * Codec is backed by a hardware implementation. Typically used to + * identify a non-hwaccel hardware decoder. For information about hwaccels, use + * avcodec_get_hw_config() instead. + */ +#define AV_CODEC_CAP_HARDWARE (1 << 18) + +/** + * Codec is potentially backed by a hardware implementation, but not + * necessarily. This is used instead of AV_CODEC_CAP_HARDWARE, if the + * implementation provides some sort of internal fallback. + */ +#define AV_CODEC_CAP_HYBRID (1 << 19) + +/** + * This encoder can reorder user opaque values from input AVFrames and return + * them with corresponding output packets. + * @see AV_CODEC_FLAG_COPY_OPAQUE + */ +#define AV_CODEC_CAP_ENCODER_REORDERED_OPAQUE (1 << 20) + +/** + * This encoder can be flushed using avcodec_flush_buffers(). If this flag is + * not set, the encoder must be closed and reopened to ensure that no frames + * remain pending. + */ +#define AV_CODEC_CAP_ENCODER_FLUSH (1 << 21) + +/** + * The encoder is able to output reconstructed frame data, i.e. raw frames that + * would be produced by decoding the encoded bitstream. + * + * Reconstructed frame output is enabled by the AV_CODEC_FLAG_RECON_FRAME flag. + */ +#define AV_CODEC_CAP_ENCODER_RECON_FRAME (1 << 22) + +/** + * AVProfile. + */ +typedef struct AVProfile { + int profile; + const char *name; ///< short name for the profile +} AVProfile; + +/** + * AVCodec. + */ +typedef struct AVCodec { + /** + * Name of the codec implementation. + * The name is globally unique among encoders and among decoders (but an + * encoder and a decoder can share the same name). + * This is the primary way to find a codec from the user perspective. + */ + const char *name; + /** + * Descriptive name for the codec, meant to be more human readable than name. + * You should use the NULL_IF_CONFIG_SMALL() macro to define it. + */ + const char *long_name; + enum AVMediaType type; + enum AVCodecID id; + /** + * Codec capabilities. + * see AV_CODEC_CAP_* + */ + int capabilities; + uint8_t max_lowres; ///< maximum value for lowres supported by the decoder + const AVRational *supported_framerates; ///< array of supported framerates, or NULL if any, array is terminated by {0,0} + const enum AVPixelFormat *pix_fmts; ///< array of supported pixel formats, or NULL if unknown, array is terminated by -1 + const int *supported_samplerates; ///< array of supported audio samplerates, or NULL if unknown, array is terminated by 0 + const enum AVSampleFormat *sample_fmts; ///< array of supported sample formats, or NULL if unknown, array is terminated by -1 +#if FF_API_OLD_CHANNEL_LAYOUT + /** + * @deprecated use ch_layouts instead + */ + attribute_deprecated + const uint64_t *channel_layouts; ///< array of support channel layouts, or NULL if unknown. array is terminated by 0 +#endif + const AVClass *priv_class; ///< AVClass for the private context + const AVProfile *profiles; ///< array of recognized profiles, or NULL if unknown, array is terminated by {AV_PROFILE_UNKNOWN} + + /** + * Group name of the codec implementation. + * This is a short symbolic name of the wrapper backing this codec. A + * wrapper uses some kind of external implementation for the codec, such + * as an external library, or a codec implementation provided by the OS or + * the hardware. + * If this field is NULL, this is a builtin, libavcodec native codec. + * If non-NULL, this will be the suffix in AVCodec.name in most cases + * (usually AVCodec.name will be of the form "_"). + */ + const char *wrapper_name; + + /** + * Array of supported channel layouts, terminated with a zeroed layout. + */ + const AVChannelLayout *ch_layouts; +} AVCodec; + +/** + * Iterate over all registered codecs. + * + * @param opaque a pointer where libavcodec will store the iteration state. Must + * point to NULL to start the iteration. + * + * @return the next registered codec or NULL when the iteration is + * finished + */ +const AVCodec *av_codec_iterate(void **opaque); + +/** + * Find a registered decoder with a matching codec ID. + * + * @param id AVCodecID of the requested decoder + * @return A decoder if one was found, NULL otherwise. + */ +const AVCodec *avcodec_find_decoder(enum AVCodecID id); + +/** + * Find a registered decoder with the specified name. + * + * @param name name of the requested decoder + * @return A decoder if one was found, NULL otherwise. + */ +const AVCodec *avcodec_find_decoder_by_name(const char *name); + +/** + * Find a registered encoder with a matching codec ID. + * + * @param id AVCodecID of the requested encoder + * @return An encoder if one was found, NULL otherwise. + */ +const AVCodec *avcodec_find_encoder(enum AVCodecID id); + +/** + * Find a registered encoder with the specified name. + * + * @param name name of the requested encoder + * @return An encoder if one was found, NULL otherwise. + */ +const AVCodec *avcodec_find_encoder_by_name(const char *name); +/** + * @return a non-zero number if codec is an encoder, zero otherwise + */ +int av_codec_is_encoder(const AVCodec *codec); + +/** + * @return a non-zero number if codec is a decoder, zero otherwise + */ +int av_codec_is_decoder(const AVCodec *codec); + +/** + * Return a name for the specified profile, if available. + * + * @param codec the codec that is searched for the given profile + * @param profile the profile value for which a name is requested + * @return A name for the profile if found, NULL otherwise. + */ +const char *av_get_profile_name(const AVCodec *codec, int profile); + +enum { + /** + * The codec supports this format via the hw_device_ctx interface. + * + * When selecting this format, AVCodecContext.hw_device_ctx should + * have been set to a device of the specified type before calling + * avcodec_open2(). + */ + AV_CODEC_HW_CONFIG_METHOD_HW_DEVICE_CTX = 0x01, + /** + * The codec supports this format via the hw_frames_ctx interface. + * + * When selecting this format for a decoder, + * AVCodecContext.hw_frames_ctx should be set to a suitable frames + * context inside the get_format() callback. The frames context + * must have been created on a device of the specified type. + * + * When selecting this format for an encoder, + * AVCodecContext.hw_frames_ctx should be set to the context which + * will be used for the input frames before calling avcodec_open2(). + */ + AV_CODEC_HW_CONFIG_METHOD_HW_FRAMES_CTX = 0x02, + /** + * The codec supports this format by some internal method. + * + * This format can be selected without any additional configuration - + * no device or frames context is required. + */ + AV_CODEC_HW_CONFIG_METHOD_INTERNAL = 0x04, + /** + * The codec supports this format by some ad-hoc method. + * + * Additional settings and/or function calls are required. See the + * codec-specific documentation for details. (Methods requiring + * this sort of configuration are deprecated and others should be + * used in preference.) + */ + AV_CODEC_HW_CONFIG_METHOD_AD_HOC = 0x08, +}; + +typedef struct AVCodecHWConfig { + /** + * For decoders, a hardware pixel format which that decoder may be + * able to decode to if suitable hardware is available. + * + * For encoders, a pixel format which the encoder may be able to + * accept. If set to AV_PIX_FMT_NONE, this applies to all pixel + * formats supported by the codec. + */ + enum AVPixelFormat pix_fmt; + /** + * Bit set of AV_CODEC_HW_CONFIG_METHOD_* flags, describing the possible + * setup methods which can be used with this configuration. + */ + int methods; + /** + * The device type associated with the configuration. + * + * Must be set for AV_CODEC_HW_CONFIG_METHOD_HW_DEVICE_CTX and + * AV_CODEC_HW_CONFIG_METHOD_HW_FRAMES_CTX, otherwise unused. + */ + enum AVHWDeviceType device_type; +} AVCodecHWConfig; + +/** + * Retrieve supported hardware configurations for a codec. + * + * Values of index from zero to some maximum return the indexed configuration + * descriptor; all other values return NULL. If the codec does not support + * any hardware configurations then it will always return NULL. + */ +const AVCodecHWConfig *avcodec_get_hw_config(const AVCodec *codec, int index); + +/** + * @} + */ + +#endif /* AVCODEC_CODEC_H */ diff --git a/libs/FFmpeg/include/libavcodec/codec_desc.h b/libs/FFmpeg/include/libavcodec/codec_desc.h new file mode 100644 index 0000000..96afd20 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/codec_desc.h @@ -0,0 +1,134 @@ +/* + * Codec descriptors public API + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_CODEC_DESC_H +#define AVCODEC_CODEC_DESC_H + +#include "libavutil/avutil.h" + +#include "codec_id.h" + +/** + * @addtogroup lavc_core + * @{ + */ + +/** + * This struct describes the properties of a single codec described by an + * AVCodecID. + * @see avcodec_descriptor_get() + */ +typedef struct AVCodecDescriptor { + enum AVCodecID id; + enum AVMediaType type; + /** + * Name of the codec described by this descriptor. It is non-empty and + * unique for each codec descriptor. It should contain alphanumeric + * characters and '_' only. + */ + const char *name; + /** + * A more descriptive name for this codec. May be NULL. + */ + const char *long_name; + /** + * Codec properties, a combination of AV_CODEC_PROP_* flags. + */ + int props; + /** + * MIME type(s) associated with the codec. + * May be NULL; if not, a NULL-terminated array of MIME types. + * The first item is always non-NULL and is the preferred MIME type. + */ + const char *const *mime_types; + /** + * If non-NULL, an array of profiles recognized for this codec. + * Terminated with AV_PROFILE_UNKNOWN. + */ + const struct AVProfile *profiles; +} AVCodecDescriptor; + +/** + * Codec uses only intra compression. + * Video and audio codecs only. + */ +#define AV_CODEC_PROP_INTRA_ONLY (1 << 0) +/** + * Codec supports lossy compression. Audio and video codecs only. + * @note a codec may support both lossy and lossless + * compression modes + */ +#define AV_CODEC_PROP_LOSSY (1 << 1) +/** + * Codec supports lossless compression. Audio and video codecs only. + */ +#define AV_CODEC_PROP_LOSSLESS (1 << 2) +/** + * Codec supports frame reordering. That is, the coded order (the order in which + * the encoded packets are output by the encoders / stored / input to the + * decoders) may be different from the presentation order of the corresponding + * frames. + * + * For codecs that do not have this property set, PTS and DTS should always be + * equal. + */ +#define AV_CODEC_PROP_REORDER (1 << 3) + +/** + * Video codec supports separate coding of fields in interlaced frames. + */ +#define AV_CODEC_PROP_FIELDS (1 << 4) + +/** + * Subtitle codec is bitmap based + * Decoded AVSubtitle data can be read from the AVSubtitleRect->pict field. + */ +#define AV_CODEC_PROP_BITMAP_SUB (1 << 16) +/** + * Subtitle codec is text based. + * Decoded AVSubtitle data can be read from the AVSubtitleRect->ass field. + */ +#define AV_CODEC_PROP_TEXT_SUB (1 << 17) + +/** + * @return descriptor for given codec ID or NULL if no descriptor exists. + */ +const AVCodecDescriptor *avcodec_descriptor_get(enum AVCodecID id); + +/** + * Iterate over all codec descriptors known to libavcodec. + * + * @param prev previous descriptor. NULL to get the first descriptor. + * + * @return next descriptor or NULL after the last descriptor + */ +const AVCodecDescriptor *avcodec_descriptor_next(const AVCodecDescriptor *prev); + +/** + * @return codec descriptor with the given name or NULL if no such descriptor + * exists. + */ +const AVCodecDescriptor *avcodec_descriptor_get_by_name(const char *name); + +/** + * @} + */ + +#endif // AVCODEC_CODEC_DESC_H diff --git a/libs/FFmpeg/include/libavcodec/codec_id.h b/libs/FFmpeg/include/libavcodec/codec_id.h new file mode 100644 index 0000000..29b410b --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/codec_id.h @@ -0,0 +1,668 @@ +/* + * Codec IDs + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_CODEC_ID_H +#define AVCODEC_CODEC_ID_H + +#include "libavutil/avutil.h" +#include "libavutil/samplefmt.h" + +#include "version_major.h" + +/** + * @addtogroup lavc_core + * @{ + */ + +/** + * Identify the syntax and semantics of the bitstream. + * The principle is roughly: + * Two decoders with the same ID can decode the same streams. + * Two encoders with the same ID can encode compatible streams. + * There may be slight deviations from the principle due to implementation + * details. + * + * If you add a codec ID to this list, add it so that + * 1. no value of an existing codec ID changes (that would break ABI), + * 2. it is as close as possible to similar codecs + * + * After adding new codec IDs, do not forget to add an entry to the codec + * descriptor list and bump libavcodec minor version. + */ +enum AVCodecID { + AV_CODEC_ID_NONE, + + /* video codecs */ + AV_CODEC_ID_MPEG1VIDEO, + AV_CODEC_ID_MPEG2VIDEO, ///< preferred ID for MPEG-1/2 video decoding + AV_CODEC_ID_H261, + AV_CODEC_ID_H263, + AV_CODEC_ID_RV10, + AV_CODEC_ID_RV20, + AV_CODEC_ID_MJPEG, + AV_CODEC_ID_MJPEGB, + AV_CODEC_ID_LJPEG, + AV_CODEC_ID_SP5X, + AV_CODEC_ID_JPEGLS, + AV_CODEC_ID_MPEG4, + AV_CODEC_ID_RAWVIDEO, + AV_CODEC_ID_MSMPEG4V1, + AV_CODEC_ID_MSMPEG4V2, + AV_CODEC_ID_MSMPEG4V3, + AV_CODEC_ID_WMV1, + AV_CODEC_ID_WMV2, + AV_CODEC_ID_H263P, + AV_CODEC_ID_H263I, + AV_CODEC_ID_FLV1, + AV_CODEC_ID_SVQ1, + AV_CODEC_ID_SVQ3, + AV_CODEC_ID_DVVIDEO, + AV_CODEC_ID_HUFFYUV, + AV_CODEC_ID_CYUV, + AV_CODEC_ID_H264, + AV_CODEC_ID_INDEO3, + AV_CODEC_ID_VP3, + AV_CODEC_ID_THEORA, + AV_CODEC_ID_ASV1, + AV_CODEC_ID_ASV2, + AV_CODEC_ID_FFV1, + AV_CODEC_ID_4XM, + AV_CODEC_ID_VCR1, + AV_CODEC_ID_CLJR, + AV_CODEC_ID_MDEC, + AV_CODEC_ID_ROQ, + AV_CODEC_ID_INTERPLAY_VIDEO, + AV_CODEC_ID_XAN_WC3, + AV_CODEC_ID_XAN_WC4, + AV_CODEC_ID_RPZA, + AV_CODEC_ID_CINEPAK, + AV_CODEC_ID_WS_VQA, + AV_CODEC_ID_MSRLE, + AV_CODEC_ID_MSVIDEO1, + AV_CODEC_ID_IDCIN, + AV_CODEC_ID_8BPS, + AV_CODEC_ID_SMC, + AV_CODEC_ID_FLIC, + AV_CODEC_ID_TRUEMOTION1, + AV_CODEC_ID_VMDVIDEO, + AV_CODEC_ID_MSZH, + AV_CODEC_ID_ZLIB, + AV_CODEC_ID_QTRLE, + AV_CODEC_ID_TSCC, + AV_CODEC_ID_ULTI, + AV_CODEC_ID_QDRAW, + AV_CODEC_ID_VIXL, + AV_CODEC_ID_QPEG, + AV_CODEC_ID_PNG, + AV_CODEC_ID_PPM, + AV_CODEC_ID_PBM, + AV_CODEC_ID_PGM, + AV_CODEC_ID_PGMYUV, + AV_CODEC_ID_PAM, + AV_CODEC_ID_FFVHUFF, + AV_CODEC_ID_RV30, + AV_CODEC_ID_RV40, + AV_CODEC_ID_VC1, + AV_CODEC_ID_WMV3, + AV_CODEC_ID_LOCO, + AV_CODEC_ID_WNV1, + AV_CODEC_ID_AASC, + AV_CODEC_ID_INDEO2, + AV_CODEC_ID_FRAPS, + AV_CODEC_ID_TRUEMOTION2, + AV_CODEC_ID_BMP, + AV_CODEC_ID_CSCD, + AV_CODEC_ID_MMVIDEO, + AV_CODEC_ID_ZMBV, + AV_CODEC_ID_AVS, + AV_CODEC_ID_SMACKVIDEO, + AV_CODEC_ID_NUV, + AV_CODEC_ID_KMVC, + AV_CODEC_ID_FLASHSV, + AV_CODEC_ID_CAVS, + AV_CODEC_ID_JPEG2000, + AV_CODEC_ID_VMNC, + AV_CODEC_ID_VP5, + AV_CODEC_ID_VP6, + AV_CODEC_ID_VP6F, + AV_CODEC_ID_TARGA, + AV_CODEC_ID_DSICINVIDEO, + AV_CODEC_ID_TIERTEXSEQVIDEO, + AV_CODEC_ID_TIFF, + AV_CODEC_ID_GIF, + AV_CODEC_ID_DXA, + AV_CODEC_ID_DNXHD, + AV_CODEC_ID_THP, + AV_CODEC_ID_SGI, + AV_CODEC_ID_C93, + AV_CODEC_ID_BETHSOFTVID, + AV_CODEC_ID_PTX, + AV_CODEC_ID_TXD, + AV_CODEC_ID_VP6A, + AV_CODEC_ID_AMV, + AV_CODEC_ID_VB, + AV_CODEC_ID_PCX, + AV_CODEC_ID_SUNRAST, + AV_CODEC_ID_INDEO4, + AV_CODEC_ID_INDEO5, + AV_CODEC_ID_MIMIC, + AV_CODEC_ID_RL2, + AV_CODEC_ID_ESCAPE124, + AV_CODEC_ID_DIRAC, + AV_CODEC_ID_BFI, + AV_CODEC_ID_CMV, + AV_CODEC_ID_MOTIONPIXELS, + AV_CODEC_ID_TGV, + AV_CODEC_ID_TGQ, + AV_CODEC_ID_TQI, + AV_CODEC_ID_AURA, + AV_CODEC_ID_AURA2, + AV_CODEC_ID_V210X, + AV_CODEC_ID_TMV, + AV_CODEC_ID_V210, + AV_CODEC_ID_DPX, + AV_CODEC_ID_MAD, + AV_CODEC_ID_FRWU, + AV_CODEC_ID_FLASHSV2, + AV_CODEC_ID_CDGRAPHICS, + AV_CODEC_ID_R210, + AV_CODEC_ID_ANM, + AV_CODEC_ID_BINKVIDEO, + AV_CODEC_ID_IFF_ILBM, +#define AV_CODEC_ID_IFF_BYTERUN1 AV_CODEC_ID_IFF_ILBM + AV_CODEC_ID_KGV1, + AV_CODEC_ID_YOP, + AV_CODEC_ID_VP8, + AV_CODEC_ID_PICTOR, + AV_CODEC_ID_ANSI, + AV_CODEC_ID_A64_MULTI, + AV_CODEC_ID_A64_MULTI5, + AV_CODEC_ID_R10K, + AV_CODEC_ID_MXPEG, + AV_CODEC_ID_LAGARITH, + AV_CODEC_ID_PRORES, + AV_CODEC_ID_JV, + AV_CODEC_ID_DFA, + AV_CODEC_ID_WMV3IMAGE, + AV_CODEC_ID_VC1IMAGE, + AV_CODEC_ID_UTVIDEO, + AV_CODEC_ID_BMV_VIDEO, + AV_CODEC_ID_VBLE, + AV_CODEC_ID_DXTORY, + AV_CODEC_ID_V410, + AV_CODEC_ID_XWD, + AV_CODEC_ID_CDXL, + AV_CODEC_ID_XBM, + AV_CODEC_ID_ZEROCODEC, + AV_CODEC_ID_MSS1, + AV_CODEC_ID_MSA1, + AV_CODEC_ID_TSCC2, + AV_CODEC_ID_MTS2, + AV_CODEC_ID_CLLC, + AV_CODEC_ID_MSS2, + AV_CODEC_ID_VP9, + AV_CODEC_ID_AIC, + AV_CODEC_ID_ESCAPE130, + AV_CODEC_ID_G2M, + AV_CODEC_ID_WEBP, + AV_CODEC_ID_HNM4_VIDEO, + AV_CODEC_ID_HEVC, +#define AV_CODEC_ID_H265 AV_CODEC_ID_HEVC + AV_CODEC_ID_FIC, + AV_CODEC_ID_ALIAS_PIX, + AV_CODEC_ID_BRENDER_PIX, + AV_CODEC_ID_PAF_VIDEO, + AV_CODEC_ID_EXR, + AV_CODEC_ID_VP7, + AV_CODEC_ID_SANM, + AV_CODEC_ID_SGIRLE, + AV_CODEC_ID_MVC1, + AV_CODEC_ID_MVC2, + AV_CODEC_ID_HQX, + AV_CODEC_ID_TDSC, + AV_CODEC_ID_HQ_HQA, + AV_CODEC_ID_HAP, + AV_CODEC_ID_DDS, + AV_CODEC_ID_DXV, + AV_CODEC_ID_SCREENPRESSO, + AV_CODEC_ID_RSCC, + AV_CODEC_ID_AVS2, + AV_CODEC_ID_PGX, + AV_CODEC_ID_AVS3, + AV_CODEC_ID_MSP2, + AV_CODEC_ID_VVC, +#define AV_CODEC_ID_H266 AV_CODEC_ID_VVC + AV_CODEC_ID_Y41P, + AV_CODEC_ID_AVRP, + AV_CODEC_ID_012V, + AV_CODEC_ID_AVUI, +#if FF_API_AYUV_CODECID + AV_CODEC_ID_AYUV, +#endif + AV_CODEC_ID_TARGA_Y216, + AV_CODEC_ID_V308, + AV_CODEC_ID_V408, + AV_CODEC_ID_YUV4, + AV_CODEC_ID_AVRN, + AV_CODEC_ID_CPIA, + AV_CODEC_ID_XFACE, + AV_CODEC_ID_SNOW, + AV_CODEC_ID_SMVJPEG, + AV_CODEC_ID_APNG, + AV_CODEC_ID_DAALA, + AV_CODEC_ID_CFHD, + AV_CODEC_ID_TRUEMOTION2RT, + AV_CODEC_ID_M101, + AV_CODEC_ID_MAGICYUV, + AV_CODEC_ID_SHEERVIDEO, + AV_CODEC_ID_YLC, + AV_CODEC_ID_PSD, + AV_CODEC_ID_PIXLET, + AV_CODEC_ID_SPEEDHQ, + AV_CODEC_ID_FMVC, + AV_CODEC_ID_SCPR, + AV_CODEC_ID_CLEARVIDEO, + AV_CODEC_ID_XPM, + AV_CODEC_ID_AV1, + AV_CODEC_ID_BITPACKED, + AV_CODEC_ID_MSCC, + AV_CODEC_ID_SRGC, + AV_CODEC_ID_SVG, + AV_CODEC_ID_GDV, + AV_CODEC_ID_FITS, + AV_CODEC_ID_IMM4, + AV_CODEC_ID_PROSUMER, + AV_CODEC_ID_MWSC, + AV_CODEC_ID_WCMV, + AV_CODEC_ID_RASC, + AV_CODEC_ID_HYMT, + AV_CODEC_ID_ARBC, + AV_CODEC_ID_AGM, + AV_CODEC_ID_LSCR, + AV_CODEC_ID_VP4, + AV_CODEC_ID_IMM5, + AV_CODEC_ID_MVDV, + AV_CODEC_ID_MVHA, + AV_CODEC_ID_CDTOONS, + AV_CODEC_ID_MV30, + AV_CODEC_ID_NOTCHLC, + AV_CODEC_ID_PFM, + AV_CODEC_ID_MOBICLIP, + AV_CODEC_ID_PHOTOCD, + AV_CODEC_ID_IPU, + AV_CODEC_ID_ARGO, + AV_CODEC_ID_CRI, + AV_CODEC_ID_SIMBIOSIS_IMX, + AV_CODEC_ID_SGA_VIDEO, + AV_CODEC_ID_GEM, + AV_CODEC_ID_VBN, + AV_CODEC_ID_JPEGXL, + AV_CODEC_ID_QOI, + AV_CODEC_ID_PHM, + AV_CODEC_ID_RADIANCE_HDR, + AV_CODEC_ID_WBMP, + AV_CODEC_ID_MEDIA100, + AV_CODEC_ID_VQC, + AV_CODEC_ID_PDV, + AV_CODEC_ID_EVC, + AV_CODEC_ID_RTV1, + AV_CODEC_ID_VMIX, + + /* various PCM "codecs" */ + AV_CODEC_ID_FIRST_AUDIO = 0x10000, ///< A dummy id pointing at the start of audio codecs + AV_CODEC_ID_PCM_S16LE = 0x10000, + AV_CODEC_ID_PCM_S16BE, + AV_CODEC_ID_PCM_U16LE, + AV_CODEC_ID_PCM_U16BE, + AV_CODEC_ID_PCM_S8, + AV_CODEC_ID_PCM_U8, + AV_CODEC_ID_PCM_MULAW, + AV_CODEC_ID_PCM_ALAW, + AV_CODEC_ID_PCM_S32LE, + AV_CODEC_ID_PCM_S32BE, + AV_CODEC_ID_PCM_U32LE, + AV_CODEC_ID_PCM_U32BE, + AV_CODEC_ID_PCM_S24LE, + AV_CODEC_ID_PCM_S24BE, + AV_CODEC_ID_PCM_U24LE, + AV_CODEC_ID_PCM_U24BE, + AV_CODEC_ID_PCM_S24DAUD, + AV_CODEC_ID_PCM_ZORK, + AV_CODEC_ID_PCM_S16LE_PLANAR, + AV_CODEC_ID_PCM_DVD, + AV_CODEC_ID_PCM_F32BE, + AV_CODEC_ID_PCM_F32LE, + AV_CODEC_ID_PCM_F64BE, + AV_CODEC_ID_PCM_F64LE, + AV_CODEC_ID_PCM_BLURAY, + AV_CODEC_ID_PCM_LXF, + AV_CODEC_ID_S302M, + AV_CODEC_ID_PCM_S8_PLANAR, + AV_CODEC_ID_PCM_S24LE_PLANAR, + AV_CODEC_ID_PCM_S32LE_PLANAR, + AV_CODEC_ID_PCM_S16BE_PLANAR, + AV_CODEC_ID_PCM_S64LE, + AV_CODEC_ID_PCM_S64BE, + AV_CODEC_ID_PCM_F16LE, + AV_CODEC_ID_PCM_F24LE, + AV_CODEC_ID_PCM_VIDC, + AV_CODEC_ID_PCM_SGA, + + /* various ADPCM codecs */ + AV_CODEC_ID_ADPCM_IMA_QT = 0x11000, + AV_CODEC_ID_ADPCM_IMA_WAV, + AV_CODEC_ID_ADPCM_IMA_DK3, + AV_CODEC_ID_ADPCM_IMA_DK4, + AV_CODEC_ID_ADPCM_IMA_WS, + AV_CODEC_ID_ADPCM_IMA_SMJPEG, + AV_CODEC_ID_ADPCM_MS, + AV_CODEC_ID_ADPCM_4XM, + AV_CODEC_ID_ADPCM_XA, + AV_CODEC_ID_ADPCM_ADX, + AV_CODEC_ID_ADPCM_EA, + AV_CODEC_ID_ADPCM_G726, + AV_CODEC_ID_ADPCM_CT, + AV_CODEC_ID_ADPCM_SWF, + AV_CODEC_ID_ADPCM_YAMAHA, + AV_CODEC_ID_ADPCM_SBPRO_4, + AV_CODEC_ID_ADPCM_SBPRO_3, + AV_CODEC_ID_ADPCM_SBPRO_2, + AV_CODEC_ID_ADPCM_THP, + AV_CODEC_ID_ADPCM_IMA_AMV, + AV_CODEC_ID_ADPCM_EA_R1, + AV_CODEC_ID_ADPCM_EA_R3, + AV_CODEC_ID_ADPCM_EA_R2, + AV_CODEC_ID_ADPCM_IMA_EA_SEAD, + AV_CODEC_ID_ADPCM_IMA_EA_EACS, + AV_CODEC_ID_ADPCM_EA_XAS, + AV_CODEC_ID_ADPCM_EA_MAXIS_XA, + AV_CODEC_ID_ADPCM_IMA_ISS, + AV_CODEC_ID_ADPCM_G722, + AV_CODEC_ID_ADPCM_IMA_APC, + AV_CODEC_ID_ADPCM_VIMA, + AV_CODEC_ID_ADPCM_AFC, + AV_CODEC_ID_ADPCM_IMA_OKI, + AV_CODEC_ID_ADPCM_DTK, + AV_CODEC_ID_ADPCM_IMA_RAD, + AV_CODEC_ID_ADPCM_G726LE, + AV_CODEC_ID_ADPCM_THP_LE, + AV_CODEC_ID_ADPCM_PSX, + AV_CODEC_ID_ADPCM_AICA, + AV_CODEC_ID_ADPCM_IMA_DAT4, + AV_CODEC_ID_ADPCM_MTAF, + AV_CODEC_ID_ADPCM_AGM, + AV_CODEC_ID_ADPCM_ARGO, + AV_CODEC_ID_ADPCM_IMA_SSI, + AV_CODEC_ID_ADPCM_ZORK, + AV_CODEC_ID_ADPCM_IMA_APM, + AV_CODEC_ID_ADPCM_IMA_ALP, + AV_CODEC_ID_ADPCM_IMA_MTF, + AV_CODEC_ID_ADPCM_IMA_CUNNING, + AV_CODEC_ID_ADPCM_IMA_MOFLEX, + AV_CODEC_ID_ADPCM_IMA_ACORN, + AV_CODEC_ID_ADPCM_XMD, + + /* AMR */ + AV_CODEC_ID_AMR_NB = 0x12000, + AV_CODEC_ID_AMR_WB, + + /* RealAudio codecs*/ + AV_CODEC_ID_RA_144 = 0x13000, + AV_CODEC_ID_RA_288, + + /* various DPCM codecs */ + AV_CODEC_ID_ROQ_DPCM = 0x14000, + AV_CODEC_ID_INTERPLAY_DPCM, + AV_CODEC_ID_XAN_DPCM, + AV_CODEC_ID_SOL_DPCM, + AV_CODEC_ID_SDX2_DPCM, + AV_CODEC_ID_GREMLIN_DPCM, + AV_CODEC_ID_DERF_DPCM, + AV_CODEC_ID_WADY_DPCM, + AV_CODEC_ID_CBD2_DPCM, + + /* audio codecs */ + AV_CODEC_ID_MP2 = 0x15000, + AV_CODEC_ID_MP3, ///< preferred ID for decoding MPEG audio layer 1, 2 or 3 + AV_CODEC_ID_AAC, + AV_CODEC_ID_AC3, + AV_CODEC_ID_DTS, + AV_CODEC_ID_VORBIS, + AV_CODEC_ID_DVAUDIO, + AV_CODEC_ID_WMAV1, + AV_CODEC_ID_WMAV2, + AV_CODEC_ID_MACE3, + AV_CODEC_ID_MACE6, + AV_CODEC_ID_VMDAUDIO, + AV_CODEC_ID_FLAC, + AV_CODEC_ID_MP3ADU, + AV_CODEC_ID_MP3ON4, + AV_CODEC_ID_SHORTEN, + AV_CODEC_ID_ALAC, + AV_CODEC_ID_WESTWOOD_SND1, + AV_CODEC_ID_GSM, ///< as in Berlin toast format + AV_CODEC_ID_QDM2, + AV_CODEC_ID_COOK, + AV_CODEC_ID_TRUESPEECH, + AV_CODEC_ID_TTA, + AV_CODEC_ID_SMACKAUDIO, + AV_CODEC_ID_QCELP, + AV_CODEC_ID_WAVPACK, + AV_CODEC_ID_DSICINAUDIO, + AV_CODEC_ID_IMC, + AV_CODEC_ID_MUSEPACK7, + AV_CODEC_ID_MLP, + AV_CODEC_ID_GSM_MS, /* as found in WAV */ + AV_CODEC_ID_ATRAC3, + AV_CODEC_ID_APE, + AV_CODEC_ID_NELLYMOSER, + AV_CODEC_ID_MUSEPACK8, + AV_CODEC_ID_SPEEX, + AV_CODEC_ID_WMAVOICE, + AV_CODEC_ID_WMAPRO, + AV_CODEC_ID_WMALOSSLESS, + AV_CODEC_ID_ATRAC3P, + AV_CODEC_ID_EAC3, + AV_CODEC_ID_SIPR, + AV_CODEC_ID_MP1, + AV_CODEC_ID_TWINVQ, + AV_CODEC_ID_TRUEHD, + AV_CODEC_ID_MP4ALS, + AV_CODEC_ID_ATRAC1, + AV_CODEC_ID_BINKAUDIO_RDFT, + AV_CODEC_ID_BINKAUDIO_DCT, + AV_CODEC_ID_AAC_LATM, + AV_CODEC_ID_QDMC, + AV_CODEC_ID_CELT, + AV_CODEC_ID_G723_1, + AV_CODEC_ID_G729, + AV_CODEC_ID_8SVX_EXP, + AV_CODEC_ID_8SVX_FIB, + AV_CODEC_ID_BMV_AUDIO, + AV_CODEC_ID_RALF, + AV_CODEC_ID_IAC, + AV_CODEC_ID_ILBC, + AV_CODEC_ID_OPUS, + AV_CODEC_ID_COMFORT_NOISE, + AV_CODEC_ID_TAK, + AV_CODEC_ID_METASOUND, + AV_CODEC_ID_PAF_AUDIO, + AV_CODEC_ID_ON2AVC, + AV_CODEC_ID_DSS_SP, + AV_CODEC_ID_CODEC2, + AV_CODEC_ID_FFWAVESYNTH, + AV_CODEC_ID_SONIC, + AV_CODEC_ID_SONIC_LS, + AV_CODEC_ID_EVRC, + AV_CODEC_ID_SMV, + AV_CODEC_ID_DSD_LSBF, + AV_CODEC_ID_DSD_MSBF, + AV_CODEC_ID_DSD_LSBF_PLANAR, + AV_CODEC_ID_DSD_MSBF_PLANAR, + AV_CODEC_ID_4GV, + AV_CODEC_ID_INTERPLAY_ACM, + AV_CODEC_ID_XMA1, + AV_CODEC_ID_XMA2, + AV_CODEC_ID_DST, + AV_CODEC_ID_ATRAC3AL, + AV_CODEC_ID_ATRAC3PAL, + AV_CODEC_ID_DOLBY_E, + AV_CODEC_ID_APTX, + AV_CODEC_ID_APTX_HD, + AV_CODEC_ID_SBC, + AV_CODEC_ID_ATRAC9, + AV_CODEC_ID_HCOM, + AV_CODEC_ID_ACELP_KELVIN, + AV_CODEC_ID_MPEGH_3D_AUDIO, + AV_CODEC_ID_SIREN, + AV_CODEC_ID_HCA, + AV_CODEC_ID_FASTAUDIO, + AV_CODEC_ID_MSNSIREN, + AV_CODEC_ID_DFPWM, + AV_CODEC_ID_BONK, + AV_CODEC_ID_MISC4, + AV_CODEC_ID_APAC, + AV_CODEC_ID_FTR, + AV_CODEC_ID_WAVARC, + AV_CODEC_ID_RKA, + AV_CODEC_ID_AC4, + AV_CODEC_ID_OSQ, + + /* subtitle codecs */ + AV_CODEC_ID_FIRST_SUBTITLE = 0x17000, ///< A dummy ID pointing at the start of subtitle codecs. + AV_CODEC_ID_DVD_SUBTITLE = 0x17000, + AV_CODEC_ID_DVB_SUBTITLE, + AV_CODEC_ID_TEXT, ///< raw UTF-8 text + AV_CODEC_ID_XSUB, + AV_CODEC_ID_SSA, + AV_CODEC_ID_MOV_TEXT, + AV_CODEC_ID_HDMV_PGS_SUBTITLE, + AV_CODEC_ID_DVB_TELETEXT, + AV_CODEC_ID_SRT, + AV_CODEC_ID_MICRODVD, + AV_CODEC_ID_EIA_608, + AV_CODEC_ID_JACOSUB, + AV_CODEC_ID_SAMI, + AV_CODEC_ID_REALTEXT, + AV_CODEC_ID_STL, + AV_CODEC_ID_SUBVIEWER1, + AV_CODEC_ID_SUBVIEWER, + AV_CODEC_ID_SUBRIP, + AV_CODEC_ID_WEBVTT, + AV_CODEC_ID_MPL2, + AV_CODEC_ID_VPLAYER, + AV_CODEC_ID_PJS, + AV_CODEC_ID_ASS, + AV_CODEC_ID_HDMV_TEXT_SUBTITLE, + AV_CODEC_ID_TTML, + AV_CODEC_ID_ARIB_CAPTION, + + /* other specific kind of codecs (generally used for attachments) */ + AV_CODEC_ID_FIRST_UNKNOWN = 0x18000, ///< A dummy ID pointing at the start of various fake codecs. + AV_CODEC_ID_TTF = 0x18000, + + AV_CODEC_ID_SCTE_35, ///< Contain timestamp estimated through PCR of program stream. + AV_CODEC_ID_EPG, + AV_CODEC_ID_BINTEXT, + AV_CODEC_ID_XBIN, + AV_CODEC_ID_IDF, + AV_CODEC_ID_OTF, + AV_CODEC_ID_SMPTE_KLV, + AV_CODEC_ID_DVD_NAV, + AV_CODEC_ID_TIMED_ID3, + AV_CODEC_ID_BIN_DATA, + AV_CODEC_ID_SMPTE_2038, + + + AV_CODEC_ID_PROBE = 0x19000, ///< codec_id is not known (like AV_CODEC_ID_NONE) but lavf should attempt to identify it + + AV_CODEC_ID_MPEG2TS = 0x20000, /**< _FAKE_ codec to indicate a raw MPEG-2 TS + * stream (only used by libavformat) */ + AV_CODEC_ID_MPEG4SYSTEMS = 0x20001, /**< _FAKE_ codec to indicate a MPEG-4 Systems + * stream (only used by libavformat) */ + AV_CODEC_ID_FFMETADATA = 0x21000, ///< Dummy codec for streams containing only metadata information. + AV_CODEC_ID_WRAPPED_AVFRAME = 0x21001, ///< Passthrough codec, AVFrames wrapped in AVPacket + /** + * Dummy null video codec, useful mainly for development and debugging. + * Null encoder/decoder discard all input and never return any output. + */ + AV_CODEC_ID_VNULL, + /** + * Dummy null audio codec, useful mainly for development and debugging. + * Null encoder/decoder discard all input and never return any output. + */ + AV_CODEC_ID_ANULL, +}; + +/** + * Get the type of the given codec. + */ +enum AVMediaType avcodec_get_type(enum AVCodecID codec_id); + +/** + * Get the name of a codec. + * @return a static string identifying the codec; never NULL + */ +const char *avcodec_get_name(enum AVCodecID id); + +/** + * Return codec bits per sample. + * + * @param[in] codec_id the codec + * @return Number of bits per sample or zero if unknown for the given codec. + */ +int av_get_bits_per_sample(enum AVCodecID codec_id); + +/** + * Return codec bits per sample. + * Only return non-zero if the bits per sample is exactly correct, not an + * approximation. + * + * @param[in] codec_id the codec + * @return Number of bits per sample or zero if unknown for the given codec. + */ +int av_get_exact_bits_per_sample(enum AVCodecID codec_id); + +/** + * Return a name for the specified profile, if available. + * + * @param codec_id the ID of the codec to which the requested profile belongs + * @param profile the profile value for which a name is requested + * @return A name for the profile if found, NULL otherwise. + * + * @note unlike av_get_profile_name(), which searches a list of profiles + * supported by a specific decoder or encoder implementation, this + * function searches the list of profiles from the AVCodecDescriptor + */ +const char *avcodec_profile_name(enum AVCodecID codec_id, int profile); + +/** + * Return the PCM codec associated with a sample format. + * @param be endianness, 0 for little, 1 for big, + * -1 (or anything else) for native + * @return AV_CODEC_ID_PCM_* or AV_CODEC_ID_NONE + */ +enum AVCodecID av_get_pcm_codec(enum AVSampleFormat fmt, int be); + +/** + * @} + */ + +#endif // AVCODEC_CODEC_ID_H diff --git a/libs/FFmpeg/include/libavcodec/codec_par.h b/libs/FFmpeg/include/libavcodec/codec_par.h new file mode 100644 index 0000000..64882a9 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/codec_par.h @@ -0,0 +1,262 @@ +/* + * Codec parameters public API + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_CODEC_PAR_H +#define AVCODEC_CODEC_PAR_H + +#include + +#include "libavutil/avutil.h" +#include "libavutil/channel_layout.h" +#include "libavutil/rational.h" +#include "libavutil/pixfmt.h" + +#include "codec_id.h" +#include "defs.h" +#include "packet.h" + +/** + * @addtogroup lavc_core + * @{ + */ + +/** + * This struct describes the properties of an encoded stream. + * + * sizeof(AVCodecParameters) is not a part of the public ABI, this struct must + * be allocated with avcodec_parameters_alloc() and freed with + * avcodec_parameters_free(). + */ +typedef struct AVCodecParameters { + /** + * General type of the encoded data. + */ + enum AVMediaType codec_type; + /** + * Specific type of the encoded data (the codec used). + */ + enum AVCodecID codec_id; + /** + * Additional information about the codec (corresponds to the AVI FOURCC). + */ + uint32_t codec_tag; + + /** + * Extra binary data needed for initializing the decoder, codec-dependent. + * + * Must be allocated with av_malloc() and will be freed by + * avcodec_parameters_free(). The allocated size of extradata must be at + * least extradata_size + AV_INPUT_BUFFER_PADDING_SIZE, with the padding + * bytes zeroed. + */ + uint8_t *extradata; + /** + * Size of the extradata content in bytes. + */ + int extradata_size; + + /** + * - video: the pixel format, the value corresponds to enum AVPixelFormat. + * - audio: the sample format, the value corresponds to enum AVSampleFormat. + */ + int format; + + /** + * The average bitrate of the encoded data (in bits per second). + */ + int64_t bit_rate; + + /** + * The number of bits per sample in the codedwords. + * + * This is basically the bitrate per sample. It is mandatory for a bunch of + * formats to actually decode them. It's the number of bits for one sample in + * the actual coded bitstream. + * + * This could be for example 4 for ADPCM + * For PCM formats this matches bits_per_raw_sample + * Can be 0 + */ + int bits_per_coded_sample; + + /** + * This is the number of valid bits in each output sample. If the + * sample format has more bits, the least significant bits are additional + * padding bits, which are always 0. Use right shifts to reduce the sample + * to its actual size. For example, audio formats with 24 bit samples will + * have bits_per_raw_sample set to 24, and format set to AV_SAMPLE_FMT_S32. + * To get the original sample use "(int32_t)sample >> 8"." + * + * For ADPCM this might be 12 or 16 or similar + * Can be 0 + */ + int bits_per_raw_sample; + + /** + * Codec-specific bitstream restrictions that the stream conforms to. + */ + int profile; + int level; + + /** + * Video only. The dimensions of the video frame in pixels. + */ + int width; + int height; + + /** + * Video only. The aspect ratio (width / height) which a single pixel + * should have when displayed. + * + * When the aspect ratio is unknown / undefined, the numerator should be + * set to 0 (the denominator may have any value). + */ + AVRational sample_aspect_ratio; + + /** + * Video only. The order of the fields in interlaced video. + */ + enum AVFieldOrder field_order; + + /** + * Video only. Additional colorspace characteristics. + */ + enum AVColorRange color_range; + enum AVColorPrimaries color_primaries; + enum AVColorTransferCharacteristic color_trc; + enum AVColorSpace color_space; + enum AVChromaLocation chroma_location; + + /** + * Video only. Number of delayed frames. + */ + int video_delay; + +#if FF_API_OLD_CHANNEL_LAYOUT + /** + * Audio only. The channel layout bitmask. May be 0 if the channel layout is + * unknown or unspecified, otherwise the number of bits set must be equal to + * the channels field. + * @deprecated use ch_layout + */ + attribute_deprecated + uint64_t channel_layout; + /** + * Audio only. The number of audio channels. + * @deprecated use ch_layout.nb_channels + */ + attribute_deprecated + int channels; +#endif + /** + * Audio only. The number of audio samples per second. + */ + int sample_rate; + /** + * Audio only. The number of bytes per coded audio frame, required by some + * formats. + * + * Corresponds to nBlockAlign in WAVEFORMATEX. + */ + int block_align; + /** + * Audio only. Audio frame size, if known. Required by some formats to be static. + */ + int frame_size; + + /** + * Audio only. The amount of padding (in samples) inserted by the encoder at + * the beginning of the audio. I.e. this number of leading decoded samples + * must be discarded by the caller to get the original audio without leading + * padding. + */ + int initial_padding; + /** + * Audio only. The amount of padding (in samples) appended by the encoder to + * the end of the audio. I.e. this number of decoded samples must be + * discarded by the caller from the end of the stream to get the original + * audio without any trailing padding. + */ + int trailing_padding; + /** + * Audio only. Number of samples to skip after a discontinuity. + */ + int seek_preroll; + + /** + * Audio only. The channel layout and number of channels. + */ + AVChannelLayout ch_layout; + + /** + * Video only. Number of frames per second, for streams with constant frame + * durations. Should be set to { 0, 1 } when some frames have differing + * durations or if the value is not known. + * + * @note This field correponds to values that are stored in codec-level + * headers and is typically overridden by container/transport-layer + * timestamps, when available. It should thus be used only as a last resort, + * when no higher-level timing information is available. + */ + AVRational framerate; + + /** + * Additional data associated with the entire stream. + */ + AVPacketSideData *coded_side_data; + + /** + * Amount of entries in @ref coded_side_data. + */ + int nb_coded_side_data; +} AVCodecParameters; + +/** + * Allocate a new AVCodecParameters and set its fields to default values + * (unknown/invalid/0). The returned struct must be freed with + * avcodec_parameters_free(). + */ +AVCodecParameters *avcodec_parameters_alloc(void); + +/** + * Free an AVCodecParameters instance and everything associated with it and + * write NULL to the supplied pointer. + */ +void avcodec_parameters_free(AVCodecParameters **par); + +/** + * Copy the contents of src to dst. Any allocated fields in dst are freed and + * replaced with newly allocated duplicates of the corresponding fields in src. + * + * @return >= 0 on success, a negative AVERROR code on failure. + */ +int avcodec_parameters_copy(AVCodecParameters *dst, const AVCodecParameters *src); + +/** + * This function is the same as av_get_audio_frame_duration(), except it works + * with AVCodecParameters instead of an AVCodecContext. + */ +int av_get_audio_frame_duration2(AVCodecParameters *par, int frame_bytes); + +/** + * @} + */ + +#endif // AVCODEC_CODEC_PAR_H diff --git a/libs/FFmpeg/include/libavcodec/d3d11va.h b/libs/FFmpeg/include/libavcodec/d3d11va.h new file mode 100644 index 0000000..6816b6c --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/d3d11va.h @@ -0,0 +1,112 @@ +/* + * Direct3D11 HW acceleration + * + * copyright (c) 2009 Laurent Aimar + * copyright (c) 2015 Steve Lhomme + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_D3D11VA_H +#define AVCODEC_D3D11VA_H + +/** + * @file + * @ingroup lavc_codec_hwaccel_d3d11va + * Public libavcodec D3D11VA header. + */ + +#if !defined(_WIN32_WINNT) || _WIN32_WINNT < 0x0602 +#undef _WIN32_WINNT +#define _WIN32_WINNT 0x0602 +#endif + +#include +#include + +/** + * @defgroup lavc_codec_hwaccel_d3d11va Direct3D11 + * @ingroup lavc_codec_hwaccel + * + * @{ + */ + +#define FF_DXVA2_WORKAROUND_SCALING_LIST_ZIGZAG 1 ///< Work around for Direct3D11 and old UVD/UVD+ ATI video cards +#define FF_DXVA2_WORKAROUND_INTEL_CLEARVIDEO 2 ///< Work around for Direct3D11 and old Intel GPUs with ClearVideo interface + +/** + * This structure is used to provides the necessary configurations and data + * to the Direct3D11 FFmpeg HWAccel implementation. + * + * The application must make it available as AVCodecContext.hwaccel_context. + * + * Use av_d3d11va_alloc_context() exclusively to allocate an AVD3D11VAContext. + */ +typedef struct AVD3D11VAContext { + /** + * D3D11 decoder object + */ + ID3D11VideoDecoder *decoder; + + /** + * D3D11 VideoContext + */ + ID3D11VideoContext *video_context; + + /** + * D3D11 configuration used to create the decoder + */ + D3D11_VIDEO_DECODER_CONFIG *cfg; + + /** + * The number of surface in the surface array + */ + unsigned surface_count; + + /** + * The array of Direct3D surfaces used to create the decoder + */ + ID3D11VideoDecoderOutputView **surface; + + /** + * A bit field configuring the workarounds needed for using the decoder + */ + uint64_t workaround; + + /** + * Private to the FFmpeg AVHWAccel implementation + */ + unsigned report_id; + + /** + * Mutex to access video_context + */ + HANDLE context_mutex; +} AVD3D11VAContext; + +/** + * Allocate an AVD3D11VAContext. + * + * @return Newly-allocated AVD3D11VAContext or NULL on failure. + */ +AVD3D11VAContext *av_d3d11va_alloc_context(void); + +/** + * @} + */ + +#endif /* AVCODEC_D3D11VA_H */ diff --git a/libs/FFmpeg/include/libavcodec/defs.h b/libs/FFmpeg/include/libavcodec/defs.h new file mode 100644 index 0000000..00d840e --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/defs.h @@ -0,0 +1,335 @@ +/* + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_DEFS_H +#define AVCODEC_DEFS_H + +/** + * @file + * @ingroup libavc + * Misc types and constants that do not belong anywhere else. + */ + +#include +#include + +/** + * @ingroup lavc_decoding + * Required number of additionally allocated bytes at the end of the input bitstream for decoding. + * This is mainly needed because some optimized bitstream readers read + * 32 or 64 bit at once and could read over the end.
+ * Note: If the first 23 bits of the additional bytes are not 0, then damaged + * MPEG bitstreams could cause overread and segfault. + */ +#define AV_INPUT_BUFFER_PADDING_SIZE 64 + +/** + * Verify checksums embedded in the bitstream (could be of either encoded or + * decoded data, depending on the format) and print an error message on mismatch. + * If AV_EF_EXPLODE is also set, a mismatching checksum will result in the + * decoder/demuxer returning an error. + */ +#define AV_EF_CRCCHECK (1<<0) +#define AV_EF_BITSTREAM (1<<1) ///< detect bitstream specification deviations +#define AV_EF_BUFFER (1<<2) ///< detect improper bitstream length +#define AV_EF_EXPLODE (1<<3) ///< abort decoding on minor error detection + +#define AV_EF_IGNORE_ERR (1<<15) ///< ignore errors and continue +#define AV_EF_CAREFUL (1<<16) ///< consider things that violate the spec, are fast to calculate and have not been seen in the wild as errors +#define AV_EF_COMPLIANT (1<<17) ///< consider all spec non compliances as errors +#define AV_EF_AGGRESSIVE (1<<18) ///< consider things that a sane encoder/muxer should not do as an error + +#define FF_COMPLIANCE_VERY_STRICT 2 ///< Strictly conform to an older more strict version of the spec or reference software. +#define FF_COMPLIANCE_STRICT 1 ///< Strictly conform to all the things in the spec no matter what consequences. +#define FF_COMPLIANCE_NORMAL 0 +#define FF_COMPLIANCE_UNOFFICIAL -1 ///< Allow unofficial extensions +#define FF_COMPLIANCE_EXPERIMENTAL -2 ///< Allow nonstandardized experimental things. + + +#define AV_PROFILE_UNKNOWN -99 +#define AV_PROFILE_RESERVED -100 + +#define AV_PROFILE_AAC_MAIN 0 +#define AV_PROFILE_AAC_LOW 1 +#define AV_PROFILE_AAC_SSR 2 +#define AV_PROFILE_AAC_LTP 3 +#define AV_PROFILE_AAC_HE 4 +#define AV_PROFILE_AAC_HE_V2 28 +#define AV_PROFILE_AAC_LD 22 +#define AV_PROFILE_AAC_ELD 38 +#define AV_PROFILE_MPEG2_AAC_LOW 128 +#define AV_PROFILE_MPEG2_AAC_HE 131 + +#define AV_PROFILE_DNXHD 0 +#define AV_PROFILE_DNXHR_LB 1 +#define AV_PROFILE_DNXHR_SQ 2 +#define AV_PROFILE_DNXHR_HQ 3 +#define AV_PROFILE_DNXHR_HQX 4 +#define AV_PROFILE_DNXHR_444 5 + +#define AV_PROFILE_DTS 20 +#define AV_PROFILE_DTS_ES 30 +#define AV_PROFILE_DTS_96_24 40 +#define AV_PROFILE_DTS_HD_HRA 50 +#define AV_PROFILE_DTS_HD_MA 60 +#define AV_PROFILE_DTS_EXPRESS 70 +#define AV_PROFILE_DTS_HD_MA_X 61 +#define AV_PROFILE_DTS_HD_MA_X_IMAX 62 + +#define AV_PROFILE_EAC3_DDP_ATMOS 30 + +#define AV_PROFILE_TRUEHD_ATMOS 30 + +#define AV_PROFILE_MPEG2_422 0 +#define AV_PROFILE_MPEG2_HIGH 1 +#define AV_PROFILE_MPEG2_SS 2 +#define AV_PROFILE_MPEG2_SNR_SCALABLE 3 +#define AV_PROFILE_MPEG2_MAIN 4 +#define AV_PROFILE_MPEG2_SIMPLE 5 + +#define AV_PROFILE_H264_CONSTRAINED (1<<9) // 8+1; constraint_set1_flag +#define AV_PROFILE_H264_INTRA (1<<11) // 8+3; constraint_set3_flag + +#define AV_PROFILE_H264_BASELINE 66 +#define AV_PROFILE_H264_CONSTRAINED_BASELINE (66|AV_PROFILE_H264_CONSTRAINED) +#define AV_PROFILE_H264_MAIN 77 +#define AV_PROFILE_H264_EXTENDED 88 +#define AV_PROFILE_H264_HIGH 100 +#define AV_PROFILE_H264_HIGH_10 110 +#define AV_PROFILE_H264_HIGH_10_INTRA (110|AV_PROFILE_H264_INTRA) +#define AV_PROFILE_H264_MULTIVIEW_HIGH 118 +#define AV_PROFILE_H264_HIGH_422 122 +#define AV_PROFILE_H264_HIGH_422_INTRA (122|AV_PROFILE_H264_INTRA) +#define AV_PROFILE_H264_STEREO_HIGH 128 +#define AV_PROFILE_H264_HIGH_444 144 +#define AV_PROFILE_H264_HIGH_444_PREDICTIVE 244 +#define AV_PROFILE_H264_HIGH_444_INTRA (244|AV_PROFILE_H264_INTRA) +#define AV_PROFILE_H264_CAVLC_444 44 + +#define AV_PROFILE_VC1_SIMPLE 0 +#define AV_PROFILE_VC1_MAIN 1 +#define AV_PROFILE_VC1_COMPLEX 2 +#define AV_PROFILE_VC1_ADVANCED 3 + +#define AV_PROFILE_MPEG4_SIMPLE 0 +#define AV_PROFILE_MPEG4_SIMPLE_SCALABLE 1 +#define AV_PROFILE_MPEG4_CORE 2 +#define AV_PROFILE_MPEG4_MAIN 3 +#define AV_PROFILE_MPEG4_N_BIT 4 +#define AV_PROFILE_MPEG4_SCALABLE_TEXTURE 5 +#define AV_PROFILE_MPEG4_SIMPLE_FACE_ANIMATION 6 +#define AV_PROFILE_MPEG4_BASIC_ANIMATED_TEXTURE 7 +#define AV_PROFILE_MPEG4_HYBRID 8 +#define AV_PROFILE_MPEG4_ADVANCED_REAL_TIME 9 +#define AV_PROFILE_MPEG4_CORE_SCALABLE 10 +#define AV_PROFILE_MPEG4_ADVANCED_CODING 11 +#define AV_PROFILE_MPEG4_ADVANCED_CORE 12 +#define AV_PROFILE_MPEG4_ADVANCED_SCALABLE_TEXTURE 13 +#define AV_PROFILE_MPEG4_SIMPLE_STUDIO 14 +#define AV_PROFILE_MPEG4_ADVANCED_SIMPLE 15 + +#define AV_PROFILE_JPEG2000_CSTREAM_RESTRICTION_0 1 +#define AV_PROFILE_JPEG2000_CSTREAM_RESTRICTION_1 2 +#define AV_PROFILE_JPEG2000_CSTREAM_NO_RESTRICTION 32768 +#define AV_PROFILE_JPEG2000_DCINEMA_2K 3 +#define AV_PROFILE_JPEG2000_DCINEMA_4K 4 + +#define AV_PROFILE_VP9_0 0 +#define AV_PROFILE_VP9_1 1 +#define AV_PROFILE_VP9_2 2 +#define AV_PROFILE_VP9_3 3 + +#define AV_PROFILE_HEVC_MAIN 1 +#define AV_PROFILE_HEVC_MAIN_10 2 +#define AV_PROFILE_HEVC_MAIN_STILL_PICTURE 3 +#define AV_PROFILE_HEVC_REXT 4 +#define AV_PROFILE_HEVC_SCC 9 + +#define AV_PROFILE_VVC_MAIN_10 1 +#define AV_PROFILE_VVC_MAIN_10_444 33 + +#define AV_PROFILE_AV1_MAIN 0 +#define AV_PROFILE_AV1_HIGH 1 +#define AV_PROFILE_AV1_PROFESSIONAL 2 + +#define AV_PROFILE_MJPEG_HUFFMAN_BASELINE_DCT 0xc0 +#define AV_PROFILE_MJPEG_HUFFMAN_EXTENDED_SEQUENTIAL_DCT 0xc1 +#define AV_PROFILE_MJPEG_HUFFMAN_PROGRESSIVE_DCT 0xc2 +#define AV_PROFILE_MJPEG_HUFFMAN_LOSSLESS 0xc3 +#define AV_PROFILE_MJPEG_JPEG_LS 0xf7 + +#define AV_PROFILE_SBC_MSBC 1 + +#define AV_PROFILE_PRORES_PROXY 0 +#define AV_PROFILE_PRORES_LT 1 +#define AV_PROFILE_PRORES_STANDARD 2 +#define AV_PROFILE_PRORES_HQ 3 +#define AV_PROFILE_PRORES_4444 4 +#define AV_PROFILE_PRORES_XQ 5 + +#define AV_PROFILE_ARIB_PROFILE_A 0 +#define AV_PROFILE_ARIB_PROFILE_C 1 + +#define AV_PROFILE_KLVA_SYNC 0 +#define AV_PROFILE_KLVA_ASYNC 1 + +#define AV_PROFILE_EVC_BASELINE 0 +#define AV_PROFILE_EVC_MAIN 1 + + +#define AV_LEVEL_UNKNOWN -99 + +enum AVFieldOrder { + AV_FIELD_UNKNOWN, + AV_FIELD_PROGRESSIVE, + AV_FIELD_TT, ///< Top coded_first, top displayed first + AV_FIELD_BB, ///< Bottom coded first, bottom displayed first + AV_FIELD_TB, ///< Top coded first, bottom displayed first + AV_FIELD_BT, ///< Bottom coded first, top displayed first +}; + +/** + * @ingroup lavc_decoding + */ +enum AVDiscard{ + /* We leave some space between them for extensions (drop some + * keyframes for intra-only or drop just some bidir frames). */ + AVDISCARD_NONE =-16, ///< discard nothing + AVDISCARD_DEFAULT = 0, ///< discard useless packets like 0 size packets in avi + AVDISCARD_NONREF = 8, ///< discard all non reference + AVDISCARD_BIDIR = 16, ///< discard all bidirectional frames + AVDISCARD_NONINTRA= 24, ///< discard all non intra frames + AVDISCARD_NONKEY = 32, ///< discard all frames except keyframes + AVDISCARD_ALL = 48, ///< discard all +}; + +enum AVAudioServiceType { + AV_AUDIO_SERVICE_TYPE_MAIN = 0, + AV_AUDIO_SERVICE_TYPE_EFFECTS = 1, + AV_AUDIO_SERVICE_TYPE_VISUALLY_IMPAIRED = 2, + AV_AUDIO_SERVICE_TYPE_HEARING_IMPAIRED = 3, + AV_AUDIO_SERVICE_TYPE_DIALOGUE = 4, + AV_AUDIO_SERVICE_TYPE_COMMENTARY = 5, + AV_AUDIO_SERVICE_TYPE_EMERGENCY = 6, + AV_AUDIO_SERVICE_TYPE_VOICE_OVER = 7, + AV_AUDIO_SERVICE_TYPE_KARAOKE = 8, + AV_AUDIO_SERVICE_TYPE_NB , ///< Not part of ABI +}; + +/** + * Pan Scan area. + * This specifies the area which should be displayed. + * Note there may be multiple such areas for one frame. + */ +typedef struct AVPanScan { + /** + * id + * - encoding: Set by user. + * - decoding: Set by libavcodec. + */ + int id; + + /** + * width and height in 1/16 pel + * - encoding: Set by user. + * - decoding: Set by libavcodec. + */ + int width; + int height; + + /** + * position of the top left corner in 1/16 pel for up to 3 fields/frames + * - encoding: Set by user. + * - decoding: Set by libavcodec. + */ + int16_t position[3][2]; +} AVPanScan; + +/** + * This structure describes the bitrate properties of an encoded bitstream. It + * roughly corresponds to a subset the VBV parameters for MPEG-2 or HRD + * parameters for H.264/HEVC. + */ +typedef struct AVCPBProperties { + /** + * Maximum bitrate of the stream, in bits per second. + * Zero if unknown or unspecified. + */ + int64_t max_bitrate; + /** + * Minimum bitrate of the stream, in bits per second. + * Zero if unknown or unspecified. + */ + int64_t min_bitrate; + /** + * Average bitrate of the stream, in bits per second. + * Zero if unknown or unspecified. + */ + int64_t avg_bitrate; + + /** + * The size of the buffer to which the ratecontrol is applied, in bits. + * Zero if unknown or unspecified. + */ + int64_t buffer_size; + + /** + * The delay between the time the packet this structure is associated with + * is received and the time when it should be decoded, in periods of a 27MHz + * clock. + * + * UINT64_MAX when unknown or unspecified. + */ + uint64_t vbv_delay; +} AVCPBProperties; + +/** + * Allocate a CPB properties structure and initialize its fields to default + * values. + * + * @param size if non-NULL, the size of the allocated struct will be written + * here. This is useful for embedding it in side data. + * + * @return the newly allocated struct or NULL on failure + */ +AVCPBProperties *av_cpb_properties_alloc(size_t *size); + +/** + * This structure supplies correlation between a packet timestamp and a wall clock + * production time. The definition follows the Producer Reference Time ('prft') + * as defined in ISO/IEC 14496-12 + */ +typedef struct AVProducerReferenceTime { + /** + * A UTC timestamp, in microseconds, since Unix epoch (e.g, av_gettime()). + */ + int64_t wallclock; + int flags; +} AVProducerReferenceTime; + +/** + * Encode extradata length to a buffer. Used by xiph codecs. + * + * @param s buffer to write to; must be at least (v/255+1) bytes long + * @param v size of extradata in bytes + * @return number of bytes written to the buffer. + */ +unsigned int av_xiphlacing(unsigned char *s, unsigned int v); + +#endif // AVCODEC_DEFS_H diff --git a/libs/FFmpeg/include/libavcodec/dirac.h b/libs/FFmpeg/include/libavcodec/dirac.h new file mode 100644 index 0000000..8c348cd --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/dirac.h @@ -0,0 +1,135 @@ +/* + * Copyright (C) 2007 Marco Gerards + * Copyright (C) 2009 David Conrad + * Copyright (C) 2011 Jordi Ortiz + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_DIRAC_H +#define AVCODEC_DIRAC_H + +/** + * @file + * Interface to Dirac Decoder/Encoder + * @author Marco Gerards + * @author David Conrad + * @author Jordi Ortiz + */ + +#include +#include + +#include "libavutil/pixfmt.h" +#include "libavutil/rational.h" + +/** + * The spec limits the number of wavelet decompositions to 4 for both + * level 1 (VC-2) and 128 (long-gop default). + * 5 decompositions is the maximum before >16-bit buffers are needed. + * Schroedinger allows this for DD 9,7 and 13,7 wavelets only, limiting + * the others to 4 decompositions (or 3 for the fidelity filter). + * + * We use this instead of MAX_DECOMPOSITIONS to save some memory. + */ +#define MAX_DWT_LEVELS 5 + +/** + * Parse code values: + * + * Dirac Specification -> + * 9.6.1 Table 9.1 + * + * VC-2 Specification -> + * 10.4.1 Table 10.1 + */ + +enum DiracParseCodes { + DIRAC_PCODE_SEQ_HEADER = 0x00, + DIRAC_PCODE_END_SEQ = 0x10, + DIRAC_PCODE_AUX = 0x20, + DIRAC_PCODE_PAD = 0x30, + DIRAC_PCODE_PICTURE_CODED = 0x08, + DIRAC_PCODE_PICTURE_RAW = 0x48, + DIRAC_PCODE_PICTURE_LOW_DEL = 0xC8, + DIRAC_PCODE_PICTURE_HQ = 0xE8, + DIRAC_PCODE_INTER_NOREF_CO1 = 0x0A, + DIRAC_PCODE_INTER_NOREF_CO2 = 0x09, + DIRAC_PCODE_INTER_REF_CO1 = 0x0D, + DIRAC_PCODE_INTER_REF_CO2 = 0x0E, + DIRAC_PCODE_INTRA_REF_CO = 0x0C, + DIRAC_PCODE_INTRA_REF_RAW = 0x4C, + DIRAC_PCODE_INTRA_REF_PICT = 0xCC, + DIRAC_PCODE_MAGIC = 0x42424344, +}; + +typedef struct DiracVersionInfo { + int major; + int minor; +} DiracVersionInfo; + +typedef struct AVDiracSeqHeader { + unsigned width; + unsigned height; + uint8_t chroma_format; ///< 0: 444 1: 422 2: 420 + + uint8_t interlaced; + uint8_t top_field_first; + + uint8_t frame_rate_index; ///< index into dirac_frame_rate[] + uint8_t aspect_ratio_index; ///< index into dirac_aspect_ratio[] + + uint16_t clean_width; + uint16_t clean_height; + uint16_t clean_left_offset; + uint16_t clean_right_offset; + + uint8_t pixel_range_index; ///< index into dirac_pixel_range_presets[] + uint8_t color_spec_index; ///< index into dirac_color_spec_presets[] + + int profile; + int level; + + AVRational framerate; + AVRational sample_aspect_ratio; + + enum AVPixelFormat pix_fmt; + enum AVColorRange color_range; + enum AVColorPrimaries color_primaries; + enum AVColorTransferCharacteristic color_trc; + enum AVColorSpace colorspace; + + DiracVersionInfo version; + int bit_depth; +} AVDiracSeqHeader; + +/** + * Parse a Dirac sequence header. + * + * @param dsh this function will allocate and fill an AVDiracSeqHeader struct + * and write it into this pointer. The caller must free it with + * av_free(). + * @param buf the data buffer + * @param buf_size the size of the data buffer in bytes + * @param log_ctx if non-NULL, this function will log errors here + * @return 0 on success, a negative AVERROR code on failure + */ +int av_dirac_parse_sequence_header(AVDiracSeqHeader **dsh, + const uint8_t *buf, size_t buf_size, + void *log_ctx); + +#endif /* AVCODEC_DIRAC_H */ diff --git a/libs/FFmpeg/include/libavcodec/dv_profile.h b/libs/FFmpeg/include/libavcodec/dv_profile.h new file mode 100644 index 0000000..4365f1b --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/dv_profile.h @@ -0,0 +1,82 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_DV_PROFILE_H +#define AVCODEC_DV_PROFILE_H + +#include + +#include "libavutil/pixfmt.h" +#include "libavutil/rational.h" + +/* minimum number of bytes to read from a DV stream in order to + * determine the profile */ +#define DV_PROFILE_BYTES (6 * 80) /* 6 DIF blocks */ + + +/* + * AVDVProfile is used to express the differences between various + * DV flavors. For now it's primarily used for differentiating + * 525/60 and 625/50, but the plans are to use it for various + * DV specs as well (e.g. SMPTE314M vs. IEC 61834). + */ +typedef struct AVDVProfile { + int dsf; /* value of the dsf in the DV header */ + int video_stype; /* stype for VAUX source pack */ + int frame_size; /* total size of one frame in bytes */ + int difseg_size; /* number of DIF segments per DIF channel */ + int n_difchan; /* number of DIF channels per frame */ + AVRational time_base; /* 1/framerate */ + int ltc_divisor; /* FPS from the LTS standpoint */ + int height; /* picture height in pixels */ + int width; /* picture width in pixels */ + AVRational sar[2]; /* sample aspect ratios for 4:3 and 16:9 */ + enum AVPixelFormat pix_fmt; /* picture pixel format */ + int bpm; /* blocks per macroblock */ + const uint8_t *block_sizes; /* AC block sizes, in bits */ + int audio_stride; /* size of audio_shuffle table */ + int audio_min_samples[3]; /* min amount of audio samples */ + /* for 48kHz, 44.1kHz and 32kHz */ + int audio_samples_dist[5]; /* how many samples are supposed to be */ + /* in each frame in a 5 frames window */ + const uint8_t (*audio_shuffle)[9]; /* PCM shuffling table */ +} AVDVProfile; + +/** + * Get a DV profile for the provided compressed frame. + * + * @param sys the profile used for the previous frame, may be NULL + * @param frame the compressed data buffer + * @param buf_size size of the buffer in bytes + * @return the DV profile for the supplied data or NULL on failure + */ +const AVDVProfile *av_dv_frame_profile(const AVDVProfile *sys, + const uint8_t *frame, unsigned buf_size); + +/** + * Get a DV profile for the provided stream parameters. + */ +const AVDVProfile *av_dv_codec_profile(int width, int height, enum AVPixelFormat pix_fmt); + +/** + * Get a DV profile for the provided stream parameters. + * The frame rate is used as a best-effort parameter. + */ +const AVDVProfile *av_dv_codec_profile2(int width, int height, enum AVPixelFormat pix_fmt, AVRational frame_rate); + +#endif /* AVCODEC_DV_PROFILE_H */ diff --git a/libs/FFmpeg/include/libavcodec/dxva2.h b/libs/FFmpeg/include/libavcodec/dxva2.h new file mode 100644 index 0000000..22c9399 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/dxva2.h @@ -0,0 +1,93 @@ +/* + * DXVA2 HW acceleration + * + * copyright (c) 2009 Laurent Aimar + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_DXVA2_H +#define AVCODEC_DXVA2_H + +/** + * @file + * @ingroup lavc_codec_hwaccel_dxva2 + * Public libavcodec DXVA2 header. + */ + +#if !defined(_WIN32_WINNT) || _WIN32_WINNT < 0x0602 +#undef _WIN32_WINNT +#define _WIN32_WINNT 0x0602 +#endif + +#include +#include +#include + +/** + * @defgroup lavc_codec_hwaccel_dxva2 DXVA2 + * @ingroup lavc_codec_hwaccel + * + * @{ + */ + +#define FF_DXVA2_WORKAROUND_SCALING_LIST_ZIGZAG 1 ///< Work around for DXVA2 and old UVD/UVD+ ATI video cards +#define FF_DXVA2_WORKAROUND_INTEL_CLEARVIDEO 2 ///< Work around for DXVA2 and old Intel GPUs with ClearVideo interface + +/** + * This structure is used to provides the necessary configurations and data + * to the DXVA2 FFmpeg HWAccel implementation. + * + * The application must make it available as AVCodecContext.hwaccel_context. + */ +struct dxva_context { + /** + * DXVA2 decoder object + */ + IDirectXVideoDecoder *decoder; + + /** + * DXVA2 configuration used to create the decoder + */ + const DXVA2_ConfigPictureDecode *cfg; + + /** + * The number of surface in the surface array + */ + unsigned surface_count; + + /** + * The array of Direct3D surfaces used to create the decoder + */ + LPDIRECT3DSURFACE9 *surface; + + /** + * A bit field configuring the workarounds needed for using the decoder + */ + uint64_t workaround; + + /** + * Private to the FFmpeg AVHWAccel implementation + */ + unsigned report_id; +}; + +/** + * @} + */ + +#endif /* AVCODEC_DXVA2_H */ diff --git a/libs/FFmpeg/include/libavcodec/jni.h b/libs/FFmpeg/include/libavcodec/jni.h new file mode 100644 index 0000000..dd99e92 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/jni.h @@ -0,0 +1,46 @@ +/* + * JNI public API functions + * + * Copyright (c) 2015-2016 Matthieu Bouron + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_JNI_H +#define AVCODEC_JNI_H + +/* + * Manually set a Java virtual machine which will be used to retrieve the JNI + * environment. Once a Java VM is set it cannot be changed afterwards, meaning + * you can call multiple times av_jni_set_java_vm with the same Java VM pointer + * however it will error out if you try to set a different Java VM. + * + * @param vm Java virtual machine + * @param log_ctx context used for logging, can be NULL + * @return 0 on success, < 0 otherwise + */ +int av_jni_set_java_vm(void *vm, void *log_ctx); + +/* + * Get the Java virtual machine which has been set with av_jni_set_java_vm. + * + * @param vm Java virtual machine + * @return a pointer to the Java virtual machine + */ +void *av_jni_get_java_vm(void *log_ctx); + +#endif /* AVCODEC_JNI_H */ diff --git a/libs/FFmpeg/include/libavcodec/mediacodec.h b/libs/FFmpeg/include/libavcodec/mediacodec.h new file mode 100644 index 0000000..4e9b56a --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/mediacodec.h @@ -0,0 +1,103 @@ +/* + * Android MediaCodec public API + * + * Copyright (c) 2016 Matthieu Bouron + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_MEDIACODEC_H +#define AVCODEC_MEDIACODEC_H + +#include "libavcodec/avcodec.h" + +/** + * This structure holds a reference to a android/view/Surface object that will + * be used as output by the decoder. + * + */ +typedef struct AVMediaCodecContext { + + /** + * android/view/Surface object reference. + */ + void *surface; + +} AVMediaCodecContext; + +/** + * Allocate and initialize a MediaCodec context. + * + * When decoding with MediaCodec is finished, the caller must free the + * MediaCodec context with av_mediacodec_default_free. + * + * @return a pointer to a newly allocated AVMediaCodecContext on success, NULL otherwise + */ +AVMediaCodecContext *av_mediacodec_alloc_context(void); + +/** + * Convenience function that sets up the MediaCodec context. + * + * @param avctx codec context + * @param ctx MediaCodec context to initialize + * @param surface reference to an android/view/Surface + * @return 0 on success, < 0 otherwise + */ +int av_mediacodec_default_init(AVCodecContext *avctx, AVMediaCodecContext *ctx, void *surface); + +/** + * This function must be called to free the MediaCodec context initialized with + * av_mediacodec_default_init(). + * + * @param avctx codec context + */ +void av_mediacodec_default_free(AVCodecContext *avctx); + +/** + * Opaque structure representing a MediaCodec buffer to render. + */ +typedef struct MediaCodecBuffer AVMediaCodecBuffer; + +/** + * Release a MediaCodec buffer and render it to the surface that is associated + * with the decoder. This function should only be called once on a given + * buffer, once released the underlying buffer returns to the codec, thus + * subsequent calls to this function will have no effect. + * + * @param buffer the buffer to render + * @param render 1 to release and render the buffer to the surface or 0 to + * discard the buffer + * @return 0 on success, < 0 otherwise + */ +int av_mediacodec_release_buffer(AVMediaCodecBuffer *buffer, int render); + +/** + * Release a MediaCodec buffer and render it at the given time to the surface + * that is associated with the decoder. The timestamp must be within one second + * of the current `java/lang/System#nanoTime()` (which is implemented using + * `CLOCK_MONOTONIC` on Android). See the Android MediaCodec documentation + * of [`android/media/MediaCodec#releaseOutputBuffer(int,long)`][0] for more details. + * + * @param buffer the buffer to render + * @param time timestamp in nanoseconds of when to render the buffer + * @return 0 on success, < 0 otherwise + * + * [0]: https://developer.android.com/reference/android/media/MediaCodec#releaseOutputBuffer(int,%20long) + */ +int av_mediacodec_render_buffer_at_time(AVMediaCodecBuffer *buffer, int64_t time); + +#endif /* AVCODEC_MEDIACODEC_H */ diff --git a/libs/FFmpeg/include/libavcodec/packet.h b/libs/FFmpeg/include/libavcodec/packet.h new file mode 100644 index 0000000..b19409b --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/packet.h @@ -0,0 +1,846 @@ +/* + * AVPacket public API + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_PACKET_H +#define AVCODEC_PACKET_H + +#include +#include + +#include "libavutil/attributes.h" +#include "libavutil/buffer.h" +#include "libavutil/dict.h" +#include "libavutil/rational.h" +#include "libavutil/version.h" + +#include "libavcodec/version_major.h" + +/** + * @defgroup lavc_packet_side_data AVPacketSideData + * + * Types and functions for working with AVPacketSideData. + * @{ + */ +enum AVPacketSideDataType { + /** + * An AV_PKT_DATA_PALETTE side data packet contains exactly AVPALETTE_SIZE + * bytes worth of palette. This side data signals that a new palette is + * present. + */ + AV_PKT_DATA_PALETTE, + + /** + * The AV_PKT_DATA_NEW_EXTRADATA is used to notify the codec or the format + * that the extradata buffer was changed and the receiving side should + * act upon it appropriately. The new extradata is embedded in the side + * data buffer and should be immediately used for processing the current + * frame or packet. + */ + AV_PKT_DATA_NEW_EXTRADATA, + + /** + * An AV_PKT_DATA_PARAM_CHANGE side data packet is laid out as follows: + * @code + * u32le param_flags + * if (param_flags & AV_SIDE_DATA_PARAM_CHANGE_CHANNEL_COUNT) + * s32le channel_count + * if (param_flags & AV_SIDE_DATA_PARAM_CHANGE_CHANNEL_LAYOUT) + * u64le channel_layout + * if (param_flags & AV_SIDE_DATA_PARAM_CHANGE_SAMPLE_RATE) + * s32le sample_rate + * if (param_flags & AV_SIDE_DATA_PARAM_CHANGE_DIMENSIONS) + * s32le width + * s32le height + * @endcode + */ + AV_PKT_DATA_PARAM_CHANGE, + + /** + * An AV_PKT_DATA_H263_MB_INFO side data packet contains a number of + * structures with info about macroblocks relevant to splitting the + * packet into smaller packets on macroblock edges (e.g. as for RFC 2190). + * That is, it does not necessarily contain info about all macroblocks, + * as long as the distance between macroblocks in the info is smaller + * than the target payload size. + * Each MB info structure is 12 bytes, and is laid out as follows: + * @code + * u32le bit offset from the start of the packet + * u8 current quantizer at the start of the macroblock + * u8 GOB number + * u16le macroblock address within the GOB + * u8 horizontal MV predictor + * u8 vertical MV predictor + * u8 horizontal MV predictor for block number 3 + * u8 vertical MV predictor for block number 3 + * @endcode + */ + AV_PKT_DATA_H263_MB_INFO, + + /** + * This side data should be associated with an audio stream and contains + * ReplayGain information in form of the AVReplayGain struct. + */ + AV_PKT_DATA_REPLAYGAIN, + + /** + * This side data contains a 3x3 transformation matrix describing an affine + * transformation that needs to be applied to the decoded video frames for + * correct presentation. + * + * See libavutil/display.h for a detailed description of the data. + */ + AV_PKT_DATA_DISPLAYMATRIX, + + /** + * This side data should be associated with a video stream and contains + * Stereoscopic 3D information in form of the AVStereo3D struct. + */ + AV_PKT_DATA_STEREO3D, + + /** + * This side data should be associated with an audio stream and corresponds + * to enum AVAudioServiceType. + */ + AV_PKT_DATA_AUDIO_SERVICE_TYPE, + + /** + * This side data contains quality related information from the encoder. + * @code + * u32le quality factor of the compressed frame. Allowed range is between 1 (good) and FF_LAMBDA_MAX (bad). + * u8 picture type + * u8 error count + * u16 reserved + * u64le[error count] sum of squared differences between encoder in and output + * @endcode + */ + AV_PKT_DATA_QUALITY_STATS, + + /** + * This side data contains an integer value representing the stream index + * of a "fallback" track. A fallback track indicates an alternate + * track to use when the current track can not be decoded for some reason. + * e.g. no decoder available for codec. + */ + AV_PKT_DATA_FALLBACK_TRACK, + + /** + * This side data corresponds to the AVCPBProperties struct. + */ + AV_PKT_DATA_CPB_PROPERTIES, + + /** + * Recommmends skipping the specified number of samples + * @code + * u32le number of samples to skip from start of this packet + * u32le number of samples to skip from end of this packet + * u8 reason for start skip + * u8 reason for end skip (0=padding silence, 1=convergence) + * @endcode + */ + AV_PKT_DATA_SKIP_SAMPLES, + + /** + * An AV_PKT_DATA_JP_DUALMONO side data packet indicates that + * the packet may contain "dual mono" audio specific to Japanese DTV + * and if it is true, recommends only the selected channel to be used. + * @code + * u8 selected channels (0=main/left, 1=sub/right, 2=both) + * @endcode + */ + AV_PKT_DATA_JP_DUALMONO, + + /** + * A list of zero terminated key/value strings. There is no end marker for + * the list, so it is required to rely on the side data size to stop. + */ + AV_PKT_DATA_STRINGS_METADATA, + + /** + * Subtitle event position + * @code + * u32le x1 + * u32le y1 + * u32le x2 + * u32le y2 + * @endcode + */ + AV_PKT_DATA_SUBTITLE_POSITION, + + /** + * Data found in BlockAdditional element of matroska container. There is + * no end marker for the data, so it is required to rely on the side data + * size to recognize the end. 8 byte id (as found in BlockAddId) followed + * by data. + */ + AV_PKT_DATA_MATROSKA_BLOCKADDITIONAL, + + /** + * The optional first identifier line of a WebVTT cue. + */ + AV_PKT_DATA_WEBVTT_IDENTIFIER, + + /** + * The optional settings (rendering instructions) that immediately + * follow the timestamp specifier of a WebVTT cue. + */ + AV_PKT_DATA_WEBVTT_SETTINGS, + + /** + * A list of zero terminated key/value strings. There is no end marker for + * the list, so it is required to rely on the side data size to stop. This + * side data includes updated metadata which appeared in the stream. + */ + AV_PKT_DATA_METADATA_UPDATE, + + /** + * MPEGTS stream ID as uint8_t, this is required to pass the stream ID + * information from the demuxer to the corresponding muxer. + */ + AV_PKT_DATA_MPEGTS_STREAM_ID, + + /** + * Mastering display metadata (based on SMPTE-2086:2014). This metadata + * should be associated with a video stream and contains data in the form + * of the AVMasteringDisplayMetadata struct. + */ + AV_PKT_DATA_MASTERING_DISPLAY_METADATA, + + /** + * This side data should be associated with a video stream and corresponds + * to the AVSphericalMapping structure. + */ + AV_PKT_DATA_SPHERICAL, + + /** + * Content light level (based on CTA-861.3). This metadata should be + * associated with a video stream and contains data in the form of the + * AVContentLightMetadata struct. + */ + AV_PKT_DATA_CONTENT_LIGHT_LEVEL, + + /** + * ATSC A53 Part 4 Closed Captions. This metadata should be associated with + * a video stream. A53 CC bitstream is stored as uint8_t in AVPacketSideData.data. + * The number of bytes of CC data is AVPacketSideData.size. + */ + AV_PKT_DATA_A53_CC, + + /** + * This side data is encryption initialization data. + * The format is not part of ABI, use av_encryption_init_info_* methods to + * access. + */ + AV_PKT_DATA_ENCRYPTION_INIT_INFO, + + /** + * This side data contains encryption info for how to decrypt the packet. + * The format is not part of ABI, use av_encryption_info_* methods to access. + */ + AV_PKT_DATA_ENCRYPTION_INFO, + + /** + * Active Format Description data consisting of a single byte as specified + * in ETSI TS 101 154 using AVActiveFormatDescription enum. + */ + AV_PKT_DATA_AFD, + + /** + * Producer Reference Time data corresponding to the AVProducerReferenceTime struct, + * usually exported by some encoders (on demand through the prft flag set in the + * AVCodecContext export_side_data field). + */ + AV_PKT_DATA_PRFT, + + /** + * ICC profile data consisting of an opaque octet buffer following the + * format described by ISO 15076-1. + */ + AV_PKT_DATA_ICC_PROFILE, + + /** + * DOVI configuration + * ref: + * dolby-vision-bitstreams-within-the-iso-base-media-file-format-v2.1.2, section 2.2 + * dolby-vision-bitstreams-in-mpeg-2-transport-stream-multiplex-v1.2, section 3.3 + * Tags are stored in struct AVDOVIDecoderConfigurationRecord. + */ + AV_PKT_DATA_DOVI_CONF, + + /** + * Timecode which conforms to SMPTE ST 12-1:2014. The data is an array of 4 uint32_t + * where the first uint32_t describes how many (1-3) of the other timecodes are used. + * The timecode format is described in the documentation of av_timecode_get_smpte_from_framenum() + * function in libavutil/timecode.h. + */ + AV_PKT_DATA_S12M_TIMECODE, + + /** + * HDR10+ dynamic metadata associated with a video frame. The metadata is in + * the form of the AVDynamicHDRPlus struct and contains + * information for color volume transform - application 4 of + * SMPTE 2094-40:2016 standard. + */ + AV_PKT_DATA_DYNAMIC_HDR10_PLUS, + + /** + * The number of side data types. + * This is not part of the public API/ABI in the sense that it may + * change when new side data types are added. + * This must stay the last enum value. + * If its value becomes huge, some code using it + * needs to be updated as it assumes it to be smaller than other limits. + */ + AV_PKT_DATA_NB +}; + +#define AV_PKT_DATA_QUALITY_FACTOR AV_PKT_DATA_QUALITY_STATS //DEPRECATED + +/** + * This structure stores auxiliary information for decoding, presenting, or + * otherwise processing the coded stream. It is typically exported by demuxers + * and encoders and can be fed to decoders and muxers either in a per packet + * basis, or as global side data (applying to the entire coded stream). + * + * Global side data is handled as follows: + * - During demuxing, it may be exported through + * @ref AVStream.codecpar.side_data "AVStream's codec parameters", which can + * then be passed as input to decoders through the + * @ref AVCodecContext.coded_side_data "decoder context's side data", for + * initialization. + * - For muxing, it can be fed through @ref AVStream.codecpar.side_data + * "AVStream's codec parameters", typically the output of encoders through + * the @ref AVCodecContext.coded_side_data "encoder context's side data", for + * initialization. + * + * Packet specific side data is handled as follows: + * - During demuxing, it may be exported through @ref AVPacket.side_data + * "AVPacket's side data", which can then be passed as input to decoders. + * - For muxing, it can be fed through @ref AVPacket.side_data "AVPacket's + * side data", typically the output of encoders. + * + * Different modules may accept or export different types of side data + * depending on media type and codec. Refer to @ref AVPacketSideDataType for a + * list of defined types and where they may be found or used. + */ +typedef struct AVPacketSideData { + uint8_t *data; + size_t size; + enum AVPacketSideDataType type; +} AVPacketSideData; + +/** + * Allocate a new packet side data. + * + * @param sd pointer to an array of side data to which the side data should + * be added. *sd may be NULL, in which case the array will be + * initialized. + * @param nb_sd pointer to an integer containing the number of entries in + * the array. The integer value will be increased by 1 on success. + * @param type side data type + * @param size desired side data size + * @param flags currently unused. Must be zero + * + * @return pointer to freshly allocated side data on success, or NULL otherwise. + */ +AVPacketSideData *av_packet_side_data_new(AVPacketSideData **psd, int *pnb_sd, + enum AVPacketSideDataType type, + size_t size, int flags); + +/** + * Wrap existing data as packet side data. + * + * @param sd pointer to an array of side data to which the side data should + * be added. *sd may be NULL, in which case the array will be + * initialized + * @param nb_sd pointer to an integer containing the number of entries in + * the array. The integer value will be increased by 1 on success. + * @param type side data type + * @param data a data array. It must be allocated with the av_malloc() family + * of functions. The ownership of the data is transferred to the + * side data array on success + * @param size size of the data array + * @param flags currently unused. Must be zero + * + * @return pointer to freshly allocated side data on success, or NULL otherwise + * On failure, the side data array is unchanged and the data remains + * owned by the caller. + */ +AVPacketSideData *av_packet_side_data_add(AVPacketSideData **sd, int *nb_sd, + enum AVPacketSideDataType type, + void *data, size_t size, int flags); + +/** + * Get side information from a side data array. + * + * @param sd the array from which the side data should be fetched + * @param nb_sd value containing the number of entries in the array. + * @param type desired side information type + * + * @return pointer to side data if present or NULL otherwise + */ +const AVPacketSideData *av_packet_side_data_get(const AVPacketSideData *sd, + int nb_sd, + enum AVPacketSideDataType type); + +/** + * Remove side data of the given type from a side data array. + * + * @param sd the array from which the side data should be removed + * @param nb_sd pointer to an integer containing the number of entries in + * the array. Will be reduced by the amount of entries removed + * upon return + * @param type side information type + */ +void av_packet_side_data_remove(AVPacketSideData *sd, int *nb_sd, + enum AVPacketSideDataType type); + +/** + * Convenience function to free all the side data stored in an array, and + * the array itself. + * + * @param sd pointer to array of side data to free. Will be set to NULL + * upon return. + * @param nb_sd pointer to an integer containing the number of entries in + * the array. Will be set to 0 upon return. + */ +void av_packet_side_data_free(AVPacketSideData **sd, int *nb_sd); + +const char *av_packet_side_data_name(enum AVPacketSideDataType type); + +/** + * @} + */ + +/** + * @defgroup lavc_packet AVPacket + * + * Types and functions for working with AVPacket. + * @{ + */ + +/** + * This structure stores compressed data. It is typically exported by demuxers + * and then passed as input to decoders, or received as output from encoders and + * then passed to muxers. + * + * For video, it should typically contain one compressed frame. For audio it may + * contain several compressed frames. Encoders are allowed to output empty + * packets, with no compressed data, containing only side data + * (e.g. to update some stream parameters at the end of encoding). + * + * The semantics of data ownership depends on the buf field. + * If it is set, the packet data is dynamically allocated and is + * valid indefinitely until a call to av_packet_unref() reduces the + * reference count to 0. + * + * If the buf field is not set av_packet_ref() would make a copy instead + * of increasing the reference count. + * + * The side data is always allocated with av_malloc(), copied by + * av_packet_ref() and freed by av_packet_unref(). + * + * sizeof(AVPacket) being a part of the public ABI is deprecated. once + * av_init_packet() is removed, new packets will only be able to be allocated + * with av_packet_alloc(), and new fields may be added to the end of the struct + * with a minor bump. + * + * @see av_packet_alloc + * @see av_packet_ref + * @see av_packet_unref + */ +typedef struct AVPacket { + /** + * A reference to the reference-counted buffer where the packet data is + * stored. + * May be NULL, then the packet data is not reference-counted. + */ + AVBufferRef *buf; + /** + * Presentation timestamp in AVStream->time_base units; the time at which + * the decompressed packet will be presented to the user. + * Can be AV_NOPTS_VALUE if it is not stored in the file. + * pts MUST be larger or equal to dts as presentation cannot happen before + * decompression, unless one wants to view hex dumps. Some formats misuse + * the terms dts and pts/cts to mean something different. Such timestamps + * must be converted to true pts/dts before they are stored in AVPacket. + */ + int64_t pts; + /** + * Decompression timestamp in AVStream->time_base units; the time at which + * the packet is decompressed. + * Can be AV_NOPTS_VALUE if it is not stored in the file. + */ + int64_t dts; + uint8_t *data; + int size; + int stream_index; + /** + * A combination of AV_PKT_FLAG values + */ + int flags; + /** + * Additional packet data that can be provided by the container. + * Packet can contain several types of side information. + */ + AVPacketSideData *side_data; + int side_data_elems; + + /** + * Duration of this packet in AVStream->time_base units, 0 if unknown. + * Equals next_pts - this_pts in presentation order. + */ + int64_t duration; + + int64_t pos; ///< byte position in stream, -1 if unknown + + /** + * for some private data of the user + */ + void *opaque; + + /** + * AVBufferRef for free use by the API user. FFmpeg will never check the + * contents of the buffer ref. FFmpeg calls av_buffer_unref() on it when + * the packet is unreferenced. av_packet_copy_props() calls create a new + * reference with av_buffer_ref() for the target packet's opaque_ref field. + * + * This is unrelated to the opaque field, although it serves a similar + * purpose. + */ + AVBufferRef *opaque_ref; + + /** + * Time base of the packet's timestamps. + * In the future, this field may be set on packets output by encoders or + * demuxers, but its value will be by default ignored on input to decoders + * or muxers. + */ + AVRational time_base; +} AVPacket; + +#if FF_API_INIT_PACKET +attribute_deprecated +typedef struct AVPacketList { + AVPacket pkt; + struct AVPacketList *next; +} AVPacketList; +#endif + +#define AV_PKT_FLAG_KEY 0x0001 ///< The packet contains a keyframe +#define AV_PKT_FLAG_CORRUPT 0x0002 ///< The packet content is corrupted +/** + * Flag is used to discard packets which are required to maintain valid + * decoder state but are not required for output and should be dropped + * after decoding. + **/ +#define AV_PKT_FLAG_DISCARD 0x0004 +/** + * The packet comes from a trusted source. + * + * Otherwise-unsafe constructs such as arbitrary pointers to data + * outside the packet may be followed. + */ +#define AV_PKT_FLAG_TRUSTED 0x0008 +/** + * Flag is used to indicate packets that contain frames that can + * be discarded by the decoder. I.e. Non-reference frames. + */ +#define AV_PKT_FLAG_DISPOSABLE 0x0010 + +enum AVSideDataParamChangeFlags { +#if FF_API_OLD_CHANNEL_LAYOUT + /** + * @deprecated those are not used by any decoder + */ + AV_SIDE_DATA_PARAM_CHANGE_CHANNEL_COUNT = 0x0001, + AV_SIDE_DATA_PARAM_CHANGE_CHANNEL_LAYOUT = 0x0002, +#endif + AV_SIDE_DATA_PARAM_CHANGE_SAMPLE_RATE = 0x0004, + AV_SIDE_DATA_PARAM_CHANGE_DIMENSIONS = 0x0008, +}; + +/** + * Allocate an AVPacket and set its fields to default values. The resulting + * struct must be freed using av_packet_free(). + * + * @return An AVPacket filled with default values or NULL on failure. + * + * @note this only allocates the AVPacket itself, not the data buffers. Those + * must be allocated through other means such as av_new_packet. + * + * @see av_new_packet + */ +AVPacket *av_packet_alloc(void); + +/** + * Create a new packet that references the same data as src. + * + * This is a shortcut for av_packet_alloc()+av_packet_ref(). + * + * @return newly created AVPacket on success, NULL on error. + * + * @see av_packet_alloc + * @see av_packet_ref + */ +AVPacket *av_packet_clone(const AVPacket *src); + +/** + * Free the packet, if the packet is reference counted, it will be + * unreferenced first. + * + * @param pkt packet to be freed. The pointer will be set to NULL. + * @note passing NULL is a no-op. + */ +void av_packet_free(AVPacket **pkt); + +#if FF_API_INIT_PACKET +/** + * Initialize optional fields of a packet with default values. + * + * Note, this does not touch the data and size members, which have to be + * initialized separately. + * + * @param pkt packet + * + * @see av_packet_alloc + * @see av_packet_unref + * + * @deprecated This function is deprecated. Once it's removed, + sizeof(AVPacket) will not be a part of the ABI anymore. + */ +attribute_deprecated +void av_init_packet(AVPacket *pkt); +#endif + +/** + * Allocate the payload of a packet and initialize its fields with + * default values. + * + * @param pkt packet + * @param size wanted payload size + * @return 0 if OK, AVERROR_xxx otherwise + */ +int av_new_packet(AVPacket *pkt, int size); + +/** + * Reduce packet size, correctly zeroing padding + * + * @param pkt packet + * @param size new size + */ +void av_shrink_packet(AVPacket *pkt, int size); + +/** + * Increase packet size, correctly zeroing padding + * + * @param pkt packet + * @param grow_by number of bytes by which to increase the size of the packet + */ +int av_grow_packet(AVPacket *pkt, int grow_by); + +/** + * Initialize a reference-counted packet from av_malloc()ed data. + * + * @param pkt packet to be initialized. This function will set the data, size, + * and buf fields, all others are left untouched. + * @param data Data allocated by av_malloc() to be used as packet data. If this + * function returns successfully, the data is owned by the underlying AVBuffer. + * The caller may not access the data through other means. + * @param size size of data in bytes, without the padding. I.e. the full buffer + * size is assumed to be size + AV_INPUT_BUFFER_PADDING_SIZE. + * + * @return 0 on success, a negative AVERROR on error + */ +int av_packet_from_data(AVPacket *pkt, uint8_t *data, int size); + +/** + * Allocate new information of a packet. + * + * @param pkt packet + * @param type side information type + * @param size side information size + * @return pointer to fresh allocated data or NULL otherwise + */ +uint8_t* av_packet_new_side_data(AVPacket *pkt, enum AVPacketSideDataType type, + size_t size); + +/** + * Wrap an existing array as a packet side data. + * + * @param pkt packet + * @param type side information type + * @param data the side data array. It must be allocated with the av_malloc() + * family of functions. The ownership of the data is transferred to + * pkt. + * @param size side information size + * @return a non-negative number on success, a negative AVERROR code on + * failure. On failure, the packet is unchanged and the data remains + * owned by the caller. + */ +int av_packet_add_side_data(AVPacket *pkt, enum AVPacketSideDataType type, + uint8_t *data, size_t size); + +/** + * Shrink the already allocated side data buffer + * + * @param pkt packet + * @param type side information type + * @param size new side information size + * @return 0 on success, < 0 on failure + */ +int av_packet_shrink_side_data(AVPacket *pkt, enum AVPacketSideDataType type, + size_t size); + +/** + * Get side information from packet. + * + * @param pkt packet + * @param type desired side information type + * @param size If supplied, *size will be set to the size of the side data + * or to zero if the desired side data is not present. + * @return pointer to data if present or NULL otherwise + */ +uint8_t* av_packet_get_side_data(const AVPacket *pkt, enum AVPacketSideDataType type, + size_t *size); + +/** + * Pack a dictionary for use in side_data. + * + * @param dict The dictionary to pack. + * @param size pointer to store the size of the returned data + * @return pointer to data if successful, NULL otherwise + */ +uint8_t *av_packet_pack_dictionary(AVDictionary *dict, size_t *size); +/** + * Unpack a dictionary from side_data. + * + * @param data data from side_data + * @param size size of the data + * @param dict the metadata storage dictionary + * @return 0 on success, < 0 on failure + */ +int av_packet_unpack_dictionary(const uint8_t *data, size_t size, + AVDictionary **dict); + +/** + * Convenience function to free all the side data stored. + * All the other fields stay untouched. + * + * @param pkt packet + */ +void av_packet_free_side_data(AVPacket *pkt); + +/** + * Setup a new reference to the data described by a given packet + * + * If src is reference-counted, setup dst as a new reference to the + * buffer in src. Otherwise allocate a new buffer in dst and copy the + * data from src into it. + * + * All the other fields are copied from src. + * + * @see av_packet_unref + * + * @param dst Destination packet. Will be completely overwritten. + * @param src Source packet + * + * @return 0 on success, a negative AVERROR on error. On error, dst + * will be blank (as if returned by av_packet_alloc()). + */ +int av_packet_ref(AVPacket *dst, const AVPacket *src); + +/** + * Wipe the packet. + * + * Unreference the buffer referenced by the packet and reset the + * remaining packet fields to their default values. + * + * @param pkt The packet to be unreferenced. + */ +void av_packet_unref(AVPacket *pkt); + +/** + * Move every field in src to dst and reset src. + * + * @see av_packet_unref + * + * @param src Source packet, will be reset + * @param dst Destination packet + */ +void av_packet_move_ref(AVPacket *dst, AVPacket *src); + +/** + * Copy only "properties" fields from src to dst. + * + * Properties for the purpose of this function are all the fields + * beside those related to the packet data (buf, data, size) + * + * @param dst Destination packet + * @param src Source packet + * + * @return 0 on success AVERROR on failure. + */ +int av_packet_copy_props(AVPacket *dst, const AVPacket *src); + +/** + * Ensure the data described by a given packet is reference counted. + * + * @note This function does not ensure that the reference will be writable. + * Use av_packet_make_writable instead for that purpose. + * + * @see av_packet_ref + * @see av_packet_make_writable + * + * @param pkt packet whose data should be made reference counted. + * + * @return 0 on success, a negative AVERROR on error. On failure, the + * packet is unchanged. + */ +int av_packet_make_refcounted(AVPacket *pkt); + +/** + * Create a writable reference for the data described by a given packet, + * avoiding data copy if possible. + * + * @param pkt Packet whose data should be made writable. + * + * @return 0 on success, a negative AVERROR on failure. On failure, the + * packet is unchanged. + */ +int av_packet_make_writable(AVPacket *pkt); + +/** + * Convert valid timing fields (timestamps / durations) in a packet from one + * timebase to another. Timestamps with unknown values (AV_NOPTS_VALUE) will be + * ignored. + * + * @param pkt packet on which the conversion will be performed + * @param tb_src source timebase, in which the timing fields in pkt are + * expressed + * @param tb_dst destination timebase, to which the timing fields will be + * converted + */ +void av_packet_rescale_ts(AVPacket *pkt, AVRational tb_src, AVRational tb_dst); + +/** + * @} + */ + +#endif // AVCODEC_PACKET_H diff --git a/libs/FFmpeg/include/libavcodec/qsv.h b/libs/FFmpeg/include/libavcodec/qsv.h new file mode 100644 index 0000000..c156b08 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/qsv.h @@ -0,0 +1,109 @@ +/* + * Intel MediaSDK QSV public API + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_QSV_H +#define AVCODEC_QSV_H + +#include + +#include "libavutil/buffer.h" + +/** + * This struct is used for communicating QSV parameters between libavcodec and + * the caller. It is managed by the caller and must be assigned to + * AVCodecContext.hwaccel_context. + * - decoding: hwaccel_context must be set on return from the get_format() + * callback + * - encoding: hwaccel_context must be set before avcodec_open2() + */ +typedef struct AVQSVContext { + /** + * If non-NULL, the session to use for encoding or decoding. + * Otherwise, libavcodec will try to create an internal session. + */ + mfxSession session; + + /** + * The IO pattern to use. + */ + int iopattern; + + /** + * Extra buffers to pass to encoder or decoder initialization. + */ + mfxExtBuffer **ext_buffers; + int nb_ext_buffers; + + /** + * Encoding only. If this field is set to non-zero by the caller, libavcodec + * will create an mfxExtOpaqueSurfaceAlloc extended buffer and pass it to + * the encoder initialization. This only makes sense if iopattern is also + * set to MFX_IOPATTERN_IN_OPAQUE_MEMORY. + * + * The number of allocated opaque surfaces will be the sum of the number + * required by the encoder and the user-provided value nb_opaque_surfaces. + * The array of the opaque surfaces will be exported to the caller through + * the opaque_surfaces field. + * + * The caller must set this field to zero for oneVPL (MFX_VERSION >= 2.0) + */ + int opaque_alloc; + + /** + * Encoding only, and only if opaque_alloc is set to non-zero. Before + * calling avcodec_open2(), the caller should set this field to the number + * of extra opaque surfaces to allocate beyond what is required by the + * encoder. + * + * On return from avcodec_open2(), this field will be set by libavcodec to + * the total number of allocated opaque surfaces. + */ + int nb_opaque_surfaces; + + /** + * Encoding only, and only if opaque_alloc is set to non-zero. On return + * from avcodec_open2(), this field will be used by libavcodec to export the + * array of the allocated opaque surfaces to the caller, so they can be + * passed to other parts of the pipeline. + * + * The buffer reference exported here is owned and managed by libavcodec, + * the callers should make their own reference with av_buffer_ref() and free + * it with av_buffer_unref() when it is no longer needed. + * + * The buffer data is an nb_opaque_surfaces-sized array of mfxFrameSurface1. + */ + AVBufferRef *opaque_surfaces; + + /** + * Encoding only, and only if opaque_alloc is set to non-zero. On return + * from avcodec_open2(), this field will be set to the surface type used in + * the opaque allocation request. + */ + int opaque_alloc_type; +} AVQSVContext; + +/** + * Allocate a new context. + * + * It must be freed by the caller with av_free(). + */ +AVQSVContext *av_qsv_alloc_context(void); + +#endif /* AVCODEC_QSV_H */ diff --git a/libs/FFmpeg/include/libavcodec/vdpau.h b/libs/FFmpeg/include/libavcodec/vdpau.h new file mode 100644 index 0000000..35c4b10 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/vdpau.h @@ -0,0 +1,157 @@ +/* + * The Video Decode and Presentation API for UNIX (VDPAU) is used for + * hardware-accelerated decoding of MPEG-1/2, H.264 and VC-1. + * + * Copyright (C) 2008 NVIDIA + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_VDPAU_H +#define AVCODEC_VDPAU_H + +/** + * @file + * @ingroup lavc_codec_hwaccel_vdpau + * Public libavcodec VDPAU header. + */ + + +/** + * @defgroup lavc_codec_hwaccel_vdpau VDPAU Decoder and Renderer + * @ingroup lavc_codec_hwaccel + * + * VDPAU hardware acceleration has two modules + * - VDPAU decoding + * - VDPAU presentation + * + * The VDPAU decoding module parses all headers using FFmpeg + * parsing mechanisms and uses VDPAU for the actual decoding. + * + * As per the current implementation, the actual decoding + * and rendering (API calls) are done as part of the VDPAU + * presentation (vo_vdpau.c) module. + * + * @{ + */ + +#include + +#include "libavutil/avconfig.h" +#include "libavutil/attributes.h" + +#include "avcodec.h" + +struct AVCodecContext; +struct AVFrame; + +typedef int (*AVVDPAU_Render2)(struct AVCodecContext *, struct AVFrame *, + const VdpPictureInfo *, uint32_t, + const VdpBitstreamBuffer *); + +/** + * This structure is used to share data between the libavcodec library and + * the client video application. + * The user shall allocate the structure via the av_alloc_vdpau_hwaccel + * function and make it available as + * AVCodecContext.hwaccel_context. Members can be set by the user once + * during initialization or through each AVCodecContext.get_buffer() + * function call. In any case, they must be valid prior to calling + * decoding functions. + * + * The size of this structure is not a part of the public ABI and must not + * be used outside of libavcodec. Use av_vdpau_alloc_context() to allocate an + * AVVDPAUContext. + */ +typedef struct AVVDPAUContext { + /** + * VDPAU decoder handle + * + * Set by user. + */ + VdpDecoder decoder; + + /** + * VDPAU decoder render callback + * + * Set by the user. + */ + VdpDecoderRender *render; + + AVVDPAU_Render2 render2; +} AVVDPAUContext; + +/** + * @brief allocation function for AVVDPAUContext + * + * Allows extending the struct without breaking API/ABI + */ +AVVDPAUContext *av_alloc_vdpaucontext(void); + +AVVDPAU_Render2 av_vdpau_hwaccel_get_render2(const AVVDPAUContext *); +void av_vdpau_hwaccel_set_render2(AVVDPAUContext *, AVVDPAU_Render2); + +/** + * Associate a VDPAU device with a codec context for hardware acceleration. + * This function is meant to be called from the get_format() codec callback, + * or earlier. It can also be called after avcodec_flush_buffers() to change + * the underlying VDPAU device mid-stream (e.g. to recover from non-transparent + * display preemption). + * + * @note get_format() must return AV_PIX_FMT_VDPAU if this function completes + * successfully. + * + * @param avctx decoding context whose get_format() callback is invoked + * @param device VDPAU device handle to use for hardware acceleration + * @param get_proc_address VDPAU device driver + * @param flags zero of more OR'd AV_HWACCEL_FLAG_* flags + * + * @return 0 on success, an AVERROR code on failure. + */ +int av_vdpau_bind_context(AVCodecContext *avctx, VdpDevice device, + VdpGetProcAddress *get_proc_address, unsigned flags); + +/** + * Gets the parameters to create an adequate VDPAU video surface for the codec + * context using VDPAU hardware decoding acceleration. + * + * @note Behavior is undefined if the context was not successfully bound to a + * VDPAU device using av_vdpau_bind_context(). + * + * @param avctx the codec context being used for decoding the stream + * @param type storage space for the VDPAU video surface chroma type + * (or NULL to ignore) + * @param width storage space for the VDPAU video surface pixel width + * (or NULL to ignore) + * @param height storage space for the VDPAU video surface pixel height + * (or NULL to ignore) + * + * @return 0 on success, a negative AVERROR code on failure. + */ +int av_vdpau_get_surface_parameters(AVCodecContext *avctx, VdpChromaType *type, + uint32_t *width, uint32_t *height); + +/** + * Allocate an AVVDPAUContext. + * + * @return Newly-allocated AVVDPAUContext or NULL on failure. + */ +AVVDPAUContext *av_vdpau_alloc_context(void); + +/** @} */ + +#endif /* AVCODEC_VDPAU_H */ diff --git a/libs/FFmpeg/include/libavcodec/version.h b/libs/FFmpeg/include/libavcodec/version.h new file mode 100644 index 0000000..d6f1440 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/version.h @@ -0,0 +1,45 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_VERSION_H +#define AVCODEC_VERSION_H + +/** + * @file + * @ingroup libavc + * Libavcodec version macros. + */ + +#include "libavutil/version.h" + +#include "version_major.h" + +#define LIBAVCODEC_VERSION_MINOR 32 +#define LIBAVCODEC_VERSION_MICRO 102 + +#define LIBAVCODEC_VERSION_INT AV_VERSION_INT(LIBAVCODEC_VERSION_MAJOR, \ + LIBAVCODEC_VERSION_MINOR, \ + LIBAVCODEC_VERSION_MICRO) +#define LIBAVCODEC_VERSION AV_VERSION(LIBAVCODEC_VERSION_MAJOR, \ + LIBAVCODEC_VERSION_MINOR, \ + LIBAVCODEC_VERSION_MICRO) +#define LIBAVCODEC_BUILD LIBAVCODEC_VERSION_INT + +#define LIBAVCODEC_IDENT "Lavc" AV_STRINGIFY(LIBAVCODEC_VERSION) + +#endif /* AVCODEC_VERSION_H */ diff --git a/libs/FFmpeg/include/libavcodec/version_major.h b/libs/FFmpeg/include/libavcodec/version_major.h new file mode 100644 index 0000000..b9164fe --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/version_major.h @@ -0,0 +1,59 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_VERSION_MAJOR_H +#define AVCODEC_VERSION_MAJOR_H + +/** + * @file + * @ingroup libavc + * Libavcodec version macros. + */ + +#define LIBAVCODEC_VERSION_MAJOR 60 + +/** + * FF_API_* defines may be placed below to indicate public API that will be + * dropped at a future version bump. The defines themselves are not part of + * the public API and may change, break or disappear at any time. + * + * @note, when bumping the major version it is recommended to manually + * disable each FF_API_* in its own commit instead of disabling them all + * at once through the bump. This improves the git bisect-ability of the change. + */ + +#define FF_API_INIT_PACKET (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_IDCT_NONE (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_SVTAV1_OPTS (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_AYUV_CODECID (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_VT_OUTPUT_CALLBACK (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_AVCODEC_CHROMA_POS (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_VT_HWACCEL_CONTEXT (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_AVCTX_FRAME_NUMBER (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_SLICE_OFFSET (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_SUBFRAMES (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_TICKS_PER_FRAME (LIBAVCODEC_VERSION_MAJOR < 61) +#define FF_API_DROPCHANGED (LIBAVCODEC_VERSION_MAJOR < 61) + +#define FF_API_AVFFT (LIBAVCODEC_VERSION_MAJOR < 62) +#define FF_API_FF_PROFILE_LEVEL (LIBAVCODEC_VERSION_MAJOR < 62) + +// reminder to remove CrystalHD decoders on next major bump +#define FF_CODEC_CRYSTAL_HD (LIBAVCODEC_VERSION_MAJOR < 61) + +#endif /* AVCODEC_VERSION_MAJOR_H */ diff --git a/libs/FFmpeg/include/libavcodec/videotoolbox.h b/libs/FFmpeg/include/libavcodec/videotoolbox.h new file mode 100644 index 0000000..ba5eddb --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/videotoolbox.h @@ -0,0 +1,150 @@ +/* + * Videotoolbox hardware acceleration + * + * copyright (c) 2012 Sebastien Zwickert + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_VIDEOTOOLBOX_H +#define AVCODEC_VIDEOTOOLBOX_H + +/** + * @file + * @ingroup lavc_codec_hwaccel_videotoolbox + * Public libavcodec Videotoolbox header. + */ + +/** + * @defgroup lavc_codec_hwaccel_videotoolbox VideoToolbox Decoder + * @ingroup lavc_codec_hwaccel + * + * Hardware accelerated decoding using VideoToolbox on Apple Platforms + * + * @{ + */ + +#include + +#define Picture QuickdrawPicture +#include +#undef Picture + +#include "libavcodec/avcodec.h" + +#include "libavutil/attributes.h" + +/** + * This struct holds all the information that needs to be passed + * between the caller and libavcodec for initializing Videotoolbox decoding. + * Its size is not a part of the public ABI, it must be allocated with + * av_videotoolbox_alloc_context() and freed with av_free(). + */ +typedef struct AVVideotoolboxContext { + /** + * Videotoolbox decompression session object. + */ + VTDecompressionSessionRef session; + +#if FF_API_VT_OUTPUT_CALLBACK + /** + * The output callback that must be passed to the session. + * Set by av_videottoolbox_default_init() + */ + attribute_deprecated + VTDecompressionOutputCallback output_callback; +#endif + + /** + * CVPixelBuffer Format Type that Videotoolbox will use for decoded frames. + * set by the caller. If this is set to 0, then no specific format is + * requested from the decoder, and its native format is output. + */ + OSType cv_pix_fmt_type; + + /** + * CoreMedia Format Description that Videotoolbox will use to create the decompression session. + */ + CMVideoFormatDescriptionRef cm_fmt_desc; + + /** + * CoreMedia codec type that Videotoolbox will use to create the decompression session. + */ + int cm_codec_type; +} AVVideotoolboxContext; + +#if FF_API_VT_HWACCEL_CONTEXT + +/** + * Allocate and initialize a Videotoolbox context. + * + * This function should be called from the get_format() callback when the caller + * selects the AV_PIX_FMT_VIDETOOLBOX format. The caller must then create + * the decoder object (using the output callback provided by libavcodec) that + * will be used for Videotoolbox-accelerated decoding. + * + * When decoding with Videotoolbox is finished, the caller must destroy the decoder + * object and free the Videotoolbox context using av_free(). + * + * @return the newly allocated context or NULL on failure + * @deprecated Use AVCodecContext.hw_frames_ctx or hw_device_ctx instead. + */ +attribute_deprecated +AVVideotoolboxContext *av_videotoolbox_alloc_context(void); + +/** + * This is a convenience function that creates and sets up the Videotoolbox context using + * an internal implementation. + * + * @param avctx the corresponding codec context + * + * @return >= 0 on success, a negative AVERROR code on failure + * @deprecated Use AVCodecContext.hw_frames_ctx or hw_device_ctx instead. + */ +attribute_deprecated +int av_videotoolbox_default_init(AVCodecContext *avctx); + +/** + * This is a convenience function that creates and sets up the Videotoolbox context using + * an internal implementation. + * + * @param avctx the corresponding codec context + * @param vtctx the Videotoolbox context to use + * + * @return >= 0 on success, a negative AVERROR code on failure + * @deprecated Use AVCodecContext.hw_frames_ctx or hw_device_ctx instead. + */ +attribute_deprecated +int av_videotoolbox_default_init2(AVCodecContext *avctx, AVVideotoolboxContext *vtctx); + +/** + * This function must be called to free the Videotoolbox context initialized with + * av_videotoolbox_default_init(). + * + * @param avctx the corresponding codec context + * @deprecated Use AVCodecContext.hw_frames_ctx or hw_device_ctx instead. + */ +attribute_deprecated +void av_videotoolbox_default_free(AVCodecContext *avctx); + +#endif /* FF_API_VT_HWACCEL_CONTEXT */ + +/** + * @} + */ + +#endif /* AVCODEC_VIDEOTOOLBOX_H */ diff --git a/libs/FFmpeg/include/libavcodec/vorbis_parser.h b/libs/FFmpeg/include/libavcodec/vorbis_parser.h new file mode 100644 index 0000000..789932a --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/vorbis_parser.h @@ -0,0 +1,74 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * A public API for Vorbis parsing + * + * Determines the duration for each packet. + */ + +#ifndef AVCODEC_VORBIS_PARSER_H +#define AVCODEC_VORBIS_PARSER_H + +#include + +typedef struct AVVorbisParseContext AVVorbisParseContext; + +/** + * Allocate and initialize the Vorbis parser using headers in the extradata. + */ +AVVorbisParseContext *av_vorbis_parse_init(const uint8_t *extradata, + int extradata_size); + +/** + * Free the parser and everything associated with it. + */ +void av_vorbis_parse_free(AVVorbisParseContext **s); + +#define VORBIS_FLAG_HEADER 0x00000001 +#define VORBIS_FLAG_COMMENT 0x00000002 +#define VORBIS_FLAG_SETUP 0x00000004 + +/** + * Get the duration for a Vorbis packet. + * + * If @p flags is @c NULL, + * special frames are considered invalid. + * + * @param s Vorbis parser context + * @param buf buffer containing a Vorbis frame + * @param buf_size size of the buffer + * @param flags flags for special frames + */ +int av_vorbis_parse_frame_flags(AVVorbisParseContext *s, const uint8_t *buf, + int buf_size, int *flags); + +/** + * Get the duration for a Vorbis packet. + * + * @param s Vorbis parser context + * @param buf buffer containing a Vorbis frame + * @param buf_size size of the buffer + */ +int av_vorbis_parse_frame(AVVorbisParseContext *s, const uint8_t *buf, + int buf_size); + +void av_vorbis_parse_reset(AVVorbisParseContext *s); + +#endif /* AVCODEC_VORBIS_PARSER_H */ diff --git a/libs/FFmpeg/include/libavcodec/xvmc.h b/libs/FFmpeg/include/libavcodec/xvmc.h new file mode 100644 index 0000000..52e70c0 --- /dev/null +++ b/libs/FFmpeg/include/libavcodec/xvmc.h @@ -0,0 +1,171 @@ +/* + * Copyright (C) 2003 Ivan Kalvachev + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVCODEC_XVMC_H +#define AVCODEC_XVMC_H + +/** + * @file + * @ingroup lavc_codec_hwaccel_xvmc + * Public libavcodec XvMC header. + */ + +#pragma message("XvMC is no longer supported; this header is deprecated and will be removed") + +#include + +#include "libavutil/attributes.h" +#include "avcodec.h" + +/** + * @defgroup lavc_codec_hwaccel_xvmc XvMC + * @ingroup lavc_codec_hwaccel + * + * @{ + */ + +#define AV_XVMC_ID 0x1DC711C0 /**< special value to ensure that regular pixel routines haven't corrupted the struct + the number is 1337 speak for the letters IDCT MCo (motion compensation) */ + +struct attribute_deprecated xvmc_pix_fmt { + /** The field contains the special constant value AV_XVMC_ID. + It is used as a test that the application correctly uses the API, + and that there is no corruption caused by pixel routines. + - application - set during initialization + - libavcodec - unchanged + */ + int xvmc_id; + + /** Pointer to the block array allocated by XvMCCreateBlocks(). + The array has to be freed by XvMCDestroyBlocks(). + Each group of 64 values represents one data block of differential + pixel information (in MoCo mode) or coefficients for IDCT. + - application - set the pointer during initialization + - libavcodec - fills coefficients/pixel data into the array + */ + short* data_blocks; + + /** Pointer to the macroblock description array allocated by + XvMCCreateMacroBlocks() and freed by XvMCDestroyMacroBlocks(). + - application - set the pointer during initialization + - libavcodec - fills description data into the array + */ + XvMCMacroBlock* mv_blocks; + + /** Number of macroblock descriptions that can be stored in the mv_blocks + array. + - application - set during initialization + - libavcodec - unchanged + */ + int allocated_mv_blocks; + + /** Number of blocks that can be stored at once in the data_blocks array. + - application - set during initialization + - libavcodec - unchanged + */ + int allocated_data_blocks; + + /** Indicate that the hardware would interpret data_blocks as IDCT + coefficients and perform IDCT on them. + - application - set during initialization + - libavcodec - unchanged + */ + int idct; + + /** In MoCo mode it indicates that intra macroblocks are assumed to be in + unsigned format; same as the XVMC_INTRA_UNSIGNED flag. + - application - set during initialization + - libavcodec - unchanged + */ + int unsigned_intra; + + /** Pointer to the surface allocated by XvMCCreateSurface(). + It has to be freed by XvMCDestroySurface() on application exit. + It identifies the frame and its state on the video hardware. + - application - set during initialization + - libavcodec - unchanged + */ + XvMCSurface* p_surface; + +/** Set by the decoder before calling ff_draw_horiz_band(), + needed by the XvMCRenderSurface function. */ +//@{ + /** Pointer to the surface used as past reference + - application - unchanged + - libavcodec - set + */ + XvMCSurface* p_past_surface; + + /** Pointer to the surface used as future reference + - application - unchanged + - libavcodec - set + */ + XvMCSurface* p_future_surface; + + /** top/bottom field or frame + - application - unchanged + - libavcodec - set + */ + unsigned int picture_structure; + + /** XVMC_SECOND_FIELD - 1st or 2nd field in the sequence + - application - unchanged + - libavcodec - set + */ + unsigned int flags; +//}@ + + /** Number of macroblock descriptions in the mv_blocks array + that have already been passed to the hardware. + - application - zeroes it on get_buffer(). + A successful ff_draw_horiz_band() may increment it + with filled_mb_block_num or zero both. + - libavcodec - unchanged + */ + int start_mv_blocks_num; + + /** Number of new macroblock descriptions in the mv_blocks array (after + start_mv_blocks_num) that are filled by libavcodec and have to be + passed to the hardware. + - application - zeroes it on get_buffer() or after successful + ff_draw_horiz_band(). + - libavcodec - increment with one of each stored MB + */ + int filled_mv_blocks_num; + + /** Number of the next free data block; one data block consists of + 64 short values in the data_blocks array. + All blocks before this one have already been claimed by placing their + position into the corresponding block description structure field, + that are part of the mv_blocks array. + - application - zeroes it on get_buffer(). + A successful ff_draw_horiz_band() may zero it together + with start_mb_blocks_num. + - libavcodec - each decoded macroblock increases it by the number + of coded blocks it contains. + */ + int next_free_data_block_num; +}; + +/** + * @} + */ + +#endif /* AVCODEC_XVMC_H */ diff --git a/libs/FFmpeg/include/libavformat/avformat.h b/libs/FFmpeg/include/libavformat/avformat.h new file mode 100644 index 0000000..9e7eca0 --- /dev/null +++ b/libs/FFmpeg/include/libavformat/avformat.h @@ -0,0 +1,2858 @@ +/* + * copyright (c) 2001 Fabrice Bellard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVFORMAT_AVFORMAT_H +#define AVFORMAT_AVFORMAT_H + +/** + * @file + * @ingroup libavf + * Main libavformat public API header + */ + +/** + * @defgroup libavf libavformat + * I/O and Muxing/Demuxing Library + * + * Libavformat (lavf) is a library for dealing with various media container + * formats. Its main two purposes are demuxing - i.e. splitting a media file + * into component streams, and the reverse process of muxing - writing supplied + * data in a specified container format. It also has an @ref lavf_io + * "I/O module" which supports a number of protocols for accessing the data (e.g. + * file, tcp, http and others). + * Unless you are absolutely sure you won't use libavformat's network + * capabilities, you should also call avformat_network_init(). + * + * A supported input format is described by an AVInputFormat struct, conversely + * an output format is described by AVOutputFormat. You can iterate over all + * input/output formats using the av_demuxer_iterate / av_muxer_iterate() functions. + * The protocols layer is not part of the public API, so you can only get the names + * of supported protocols with the avio_enum_protocols() function. + * + * Main lavf structure used for both muxing and demuxing is AVFormatContext, + * which exports all information about the file being read or written. As with + * most Libavformat structures, its size is not part of public ABI, so it cannot be + * allocated on stack or directly with av_malloc(). To create an + * AVFormatContext, use avformat_alloc_context() (some functions, like + * avformat_open_input() might do that for you). + * + * Most importantly an AVFormatContext contains: + * @li the @ref AVFormatContext.iformat "input" or @ref AVFormatContext.oformat + * "output" format. It is either autodetected or set by user for input; + * always set by user for output. + * @li an @ref AVFormatContext.streams "array" of AVStreams, which describe all + * elementary streams stored in the file. AVStreams are typically referred to + * using their index in this array. + * @li an @ref AVFormatContext.pb "I/O context". It is either opened by lavf or + * set by user for input, always set by user for output (unless you are dealing + * with an AVFMT_NOFILE format). + * + * @section lavf_options Passing options to (de)muxers + * It is possible to configure lavf muxers and demuxers using the @ref avoptions + * mechanism. Generic (format-independent) libavformat options are provided by + * AVFormatContext, they can be examined from a user program by calling + * av_opt_next() / av_opt_find() on an allocated AVFormatContext (or its AVClass + * from avformat_get_class()). Private (format-specific) options are provided by + * AVFormatContext.priv_data if and only if AVInputFormat.priv_class / + * AVOutputFormat.priv_class of the corresponding format struct is non-NULL. + * Further options may be provided by the @ref AVFormatContext.pb "I/O context", + * if its AVClass is non-NULL, and the protocols layer. See the discussion on + * nesting in @ref avoptions documentation to learn how to access those. + * + * @section urls + * URL strings in libavformat are made of a scheme/protocol, a ':', and a + * scheme specific string. URLs without a scheme and ':' used for local files + * are supported but deprecated. "file:" should be used for local files. + * + * It is important that the scheme string is not taken from untrusted + * sources without checks. + * + * Note that some schemes/protocols are quite powerful, allowing access to + * both local and remote files, parts of them, concatenations of them, local + * audio and video devices and so on. + * + * @{ + * + * @defgroup lavf_decoding Demuxing + * @{ + * Demuxers read a media file and split it into chunks of data (@em packets). A + * @ref AVPacket "packet" contains one or more encoded frames which belongs to a + * single elementary stream. In the lavf API this process is represented by the + * avformat_open_input() function for opening a file, av_read_frame() for + * reading a single packet and finally avformat_close_input(), which does the + * cleanup. + * + * @section lavf_decoding_open Opening a media file + * The minimum information required to open a file is its URL, which + * is passed to avformat_open_input(), as in the following code: + * @code + * const char *url = "file:in.mp3"; + * AVFormatContext *s = NULL; + * int ret = avformat_open_input(&s, url, NULL, NULL); + * if (ret < 0) + * abort(); + * @endcode + * The above code attempts to allocate an AVFormatContext, open the + * specified file (autodetecting the format) and read the header, exporting the + * information stored there into s. Some formats do not have a header or do not + * store enough information there, so it is recommended that you call the + * avformat_find_stream_info() function which tries to read and decode a few + * frames to find missing information. + * + * In some cases you might want to preallocate an AVFormatContext yourself with + * avformat_alloc_context() and do some tweaking on it before passing it to + * avformat_open_input(). One such case is when you want to use custom functions + * for reading input data instead of lavf internal I/O layer. + * To do that, create your own AVIOContext with avio_alloc_context(), passing + * your reading callbacks to it. Then set the @em pb field of your + * AVFormatContext to newly created AVIOContext. + * + * Since the format of the opened file is in general not known until after + * avformat_open_input() has returned, it is not possible to set demuxer private + * options on a preallocated context. Instead, the options should be passed to + * avformat_open_input() wrapped in an AVDictionary: + * @code + * AVDictionary *options = NULL; + * av_dict_set(&options, "video_size", "640x480", 0); + * av_dict_set(&options, "pixel_format", "rgb24", 0); + * + * if (avformat_open_input(&s, url, NULL, &options) < 0) + * abort(); + * av_dict_free(&options); + * @endcode + * This code passes the private options 'video_size' and 'pixel_format' to the + * demuxer. They would be necessary for e.g. the rawvideo demuxer, since it + * cannot know how to interpret raw video data otherwise. If the format turns + * out to be something different than raw video, those options will not be + * recognized by the demuxer and therefore will not be applied. Such unrecognized + * options are then returned in the options dictionary (recognized options are + * consumed). The calling program can handle such unrecognized options as it + * wishes, e.g. + * @code + * AVDictionaryEntry *e; + * if (e = av_dict_get(options, "", NULL, AV_DICT_IGNORE_SUFFIX)) { + * fprintf(stderr, "Option %s not recognized by the demuxer.\n", e->key); + * abort(); + * } + * @endcode + * + * After you have finished reading the file, you must close it with + * avformat_close_input(). It will free everything associated with the file. + * + * @section lavf_decoding_read Reading from an opened file + * Reading data from an opened AVFormatContext is done by repeatedly calling + * av_read_frame() on it. Each call, if successful, will return an AVPacket + * containing encoded data for one AVStream, identified by + * AVPacket.stream_index. This packet may be passed straight into the libavcodec + * decoding functions avcodec_send_packet() or avcodec_decode_subtitle2() if the + * caller wishes to decode the data. + * + * AVPacket.pts, AVPacket.dts and AVPacket.duration timing information will be + * set if known. They may also be unset (i.e. AV_NOPTS_VALUE for + * pts/dts, 0 for duration) if the stream does not provide them. The timing + * information will be in AVStream.time_base units, i.e. it has to be + * multiplied by the timebase to convert them to seconds. + * + * A packet returned by av_read_frame() is always reference-counted, + * i.e. AVPacket.buf is set and the user may keep it indefinitely. + * The packet must be freed with av_packet_unref() when it is no + * longer needed. + * + * @section lavf_decoding_seek Seeking + * @} + * + * @defgroup lavf_encoding Muxing + * @{ + * Muxers take encoded data in the form of @ref AVPacket "AVPackets" and write + * it into files or other output bytestreams in the specified container format. + * + * The main API functions for muxing are avformat_write_header() for writing the + * file header, av_write_frame() / av_interleaved_write_frame() for writing the + * packets and av_write_trailer() for finalizing the file. + * + * At the beginning of the muxing process, the caller must first call + * avformat_alloc_context() to create a muxing context. The caller then sets up + * the muxer by filling the various fields in this context: + * + * - The @ref AVFormatContext.oformat "oformat" field must be set to select the + * muxer that will be used. + * - Unless the format is of the AVFMT_NOFILE type, the @ref AVFormatContext.pb + * "pb" field must be set to an opened IO context, either returned from + * avio_open2() or a custom one. + * - Unless the format is of the AVFMT_NOSTREAMS type, at least one stream must + * be created with the avformat_new_stream() function. The caller should fill + * the @ref AVStream.codecpar "stream codec parameters" information, such as the + * codec @ref AVCodecParameters.codec_type "type", @ref AVCodecParameters.codec_id + * "id" and other parameters (e.g. width / height, the pixel or sample format, + * etc.) as known. The @ref AVStream.time_base "stream timebase" should + * be set to the timebase that the caller desires to use for this stream (note + * that the timebase actually used by the muxer can be different, as will be + * described later). + * - It is advised to manually initialize only the relevant fields in + * AVCodecParameters, rather than using @ref avcodec_parameters_copy() during + * remuxing: there is no guarantee that the codec context values remain valid + * for both input and output format contexts. + * - The caller may fill in additional information, such as @ref + * AVFormatContext.metadata "global" or @ref AVStream.metadata "per-stream" + * metadata, @ref AVFormatContext.chapters "chapters", @ref + * AVFormatContext.programs "programs", etc. as described in the + * AVFormatContext documentation. Whether such information will actually be + * stored in the output depends on what the container format and the muxer + * support. + * + * When the muxing context is fully set up, the caller must call + * avformat_write_header() to initialize the muxer internals and write the file + * header. Whether anything actually is written to the IO context at this step + * depends on the muxer, but this function must always be called. Any muxer + * private options must be passed in the options parameter to this function. + * + * The data is then sent to the muxer by repeatedly calling av_write_frame() or + * av_interleaved_write_frame() (consult those functions' documentation for + * discussion on the difference between them; only one of them may be used with + * a single muxing context, they should not be mixed). Do note that the timing + * information on the packets sent to the muxer must be in the corresponding + * AVStream's timebase. That timebase is set by the muxer (in the + * avformat_write_header() step) and may be different from the timebase + * requested by the caller. + * + * Once all the data has been written, the caller must call av_write_trailer() + * to flush any buffered packets and finalize the output file, then close the IO + * context (if any) and finally free the muxing context with + * avformat_free_context(). + * @} + * + * @defgroup lavf_io I/O Read/Write + * @{ + * @section lavf_io_dirlist Directory listing + * The directory listing API makes it possible to list files on remote servers. + * + * Some of possible use cases: + * - an "open file" dialog to choose files from a remote location, + * - a recursive media finder providing a player with an ability to play all + * files from a given directory. + * + * @subsection lavf_io_dirlist_open Opening a directory + * At first, a directory needs to be opened by calling avio_open_dir() + * supplied with a URL and, optionally, ::AVDictionary containing + * protocol-specific parameters. The function returns zero or positive + * integer and allocates AVIODirContext on success. + * + * @code + * AVIODirContext *ctx = NULL; + * if (avio_open_dir(&ctx, "smb://example.com/some_dir", NULL) < 0) { + * fprintf(stderr, "Cannot open directory.\n"); + * abort(); + * } + * @endcode + * + * This code tries to open a sample directory using smb protocol without + * any additional parameters. + * + * @subsection lavf_io_dirlist_read Reading entries + * Each directory's entry (i.e. file, another directory, anything else + * within ::AVIODirEntryType) is represented by AVIODirEntry. + * Reading consecutive entries from an opened AVIODirContext is done by + * repeatedly calling avio_read_dir() on it. Each call returns zero or + * positive integer if successful. Reading can be stopped right after the + * NULL entry has been read -- it means there are no entries left to be + * read. The following code reads all entries from a directory associated + * with ctx and prints their names to standard output. + * @code + * AVIODirEntry *entry = NULL; + * for (;;) { + * if (avio_read_dir(ctx, &entry) < 0) { + * fprintf(stderr, "Cannot list directory.\n"); + * abort(); + * } + * if (!entry) + * break; + * printf("%s\n", entry->name); + * avio_free_directory_entry(&entry); + * } + * @endcode + * @} + * + * @defgroup lavf_codec Demuxers + * @{ + * @defgroup lavf_codec_native Native Demuxers + * @{ + * @} + * @defgroup lavf_codec_wrappers External library wrappers + * @{ + * @} + * @} + * @defgroup lavf_protos I/O Protocols + * @{ + * @} + * @defgroup lavf_internal Internal + * @{ + * @} + * @} + */ + +#include /* FILE */ + +#include "libavcodec/codec_par.h" +#include "libavcodec/defs.h" +#include "libavcodec/packet.h" + +#include "libavutil/dict.h" +#include "libavutil/log.h" + +#include "avio.h" +#include "libavformat/version_major.h" +#ifndef HAVE_AV_CONFIG_H +/* When included as part of the ffmpeg build, only include the major version + * to avoid unnecessary rebuilds. When included externally, keep including + * the full version information. */ +#include "libavformat/version.h" + +#include "libavutil/frame.h" +#include "libavcodec/codec.h" +#endif + +struct AVFormatContext; +struct AVFrame; +struct AVDeviceInfoList; + +/** + * @defgroup metadata_api Public Metadata API + * @{ + * @ingroup libavf + * The metadata API allows libavformat to export metadata tags to a client + * application when demuxing. Conversely it allows a client application to + * set metadata when muxing. + * + * Metadata is exported or set as pairs of key/value strings in the 'metadata' + * fields of the AVFormatContext, AVStream, AVChapter and AVProgram structs + * using the @ref lavu_dict "AVDictionary" API. Like all strings in FFmpeg, + * metadata is assumed to be UTF-8 encoded Unicode. Note that metadata + * exported by demuxers isn't checked to be valid UTF-8 in most cases. + * + * Important concepts to keep in mind: + * - Keys are unique; there can never be 2 tags with the same key. This is + * also meant semantically, i.e., a demuxer should not knowingly produce + * several keys that are literally different but semantically identical. + * E.g., key=Author5, key=Author6. In this example, all authors must be + * placed in the same tag. + * - Metadata is flat, not hierarchical; there are no subtags. If you + * want to store, e.g., the email address of the child of producer Alice + * and actor Bob, that could have key=alice_and_bobs_childs_email_address. + * - Several modifiers can be applied to the tag name. This is done by + * appending a dash character ('-') and the modifier name in the order + * they appear in the list below -- e.g. foo-eng-sort, not foo-sort-eng. + * - language -- a tag whose value is localized for a particular language + * is appended with the ISO 639-2/B 3-letter language code. + * For example: Author-ger=Michael, Author-eng=Mike + * The original/default language is in the unqualified "Author" tag. + * A demuxer should set a default if it sets any translated tag. + * - sorting -- a modified version of a tag that should be used for + * sorting will have '-sort' appended. E.g. artist="The Beatles", + * artist-sort="Beatles, The". + * - Some protocols and demuxers support metadata updates. After a successful + * call to av_read_frame(), AVFormatContext.event_flags or AVStream.event_flags + * will be updated to indicate if metadata changed. In order to detect metadata + * changes on a stream, you need to loop through all streams in the AVFormatContext + * and check their individual event_flags. + * + * - Demuxers attempt to export metadata in a generic format, however tags + * with no generic equivalents are left as they are stored in the container. + * Follows a list of generic tag names: + * + @verbatim + album -- name of the set this work belongs to + album_artist -- main creator of the set/album, if different from artist. + e.g. "Various Artists" for compilation albums. + artist -- main creator of the work + comment -- any additional description of the file. + composer -- who composed the work, if different from artist. + copyright -- name of copyright holder. + creation_time-- date when the file was created, preferably in ISO 8601. + date -- date when the work was created, preferably in ISO 8601. + disc -- number of a subset, e.g. disc in a multi-disc collection. + encoder -- name/settings of the software/hardware that produced the file. + encoded_by -- person/group who created the file. + filename -- original name of the file. + genre -- . + language -- main language in which the work is performed, preferably + in ISO 639-2 format. Multiple languages can be specified by + separating them with commas. + performer -- artist who performed the work, if different from artist. + E.g for "Also sprach Zarathustra", artist would be "Richard + Strauss" and performer "London Philharmonic Orchestra". + publisher -- name of the label/publisher. + service_name -- name of the service in broadcasting (channel name). + service_provider -- name of the service provider in broadcasting. + title -- name of the work. + track -- number of this work in the set, can be in form current/total. + variant_bitrate -- the total bitrate of the bitrate variant that the current stream is part of + @endverbatim + * + * Look in the examples section for an application example how to use the Metadata API. + * + * @} + */ + +/* packet functions */ + + +/** + * Allocate and read the payload of a packet and initialize its + * fields with default values. + * + * @param s associated IO context + * @param pkt packet + * @param size desired payload size + * @return >0 (read size) if OK, AVERROR_xxx otherwise + */ +int av_get_packet(AVIOContext *s, AVPacket *pkt, int size); + + +/** + * Read data and append it to the current content of the AVPacket. + * If pkt->size is 0 this is identical to av_get_packet. + * Note that this uses av_grow_packet and thus involves a realloc + * which is inefficient. Thus this function should only be used + * when there is no reasonable way to know (an upper bound of) + * the final size. + * + * @param s associated IO context + * @param pkt packet + * @param size amount of data to read + * @return >0 (read size) if OK, AVERROR_xxx otherwise, previous data + * will not be lost even if an error occurs. + */ +int av_append_packet(AVIOContext *s, AVPacket *pkt, int size); + +/*************************************************/ +/* input/output formats */ + +struct AVCodecTag; + +/** + * This structure contains the data a format has to probe a file. + */ +typedef struct AVProbeData { + const char *filename; + unsigned char *buf; /**< Buffer must have AVPROBE_PADDING_SIZE of extra allocated bytes filled with zero. */ + int buf_size; /**< Size of buf except extra allocated bytes */ + const char *mime_type; /**< mime_type, when known. */ +} AVProbeData; + +#define AVPROBE_SCORE_RETRY (AVPROBE_SCORE_MAX/4) +#define AVPROBE_SCORE_STREAM_RETRY (AVPROBE_SCORE_MAX/4-1) + +#define AVPROBE_SCORE_EXTENSION 50 ///< score for file extension +#define AVPROBE_SCORE_MIME 75 ///< score for file mime type +#define AVPROBE_SCORE_MAX 100 ///< maximum score + +#define AVPROBE_PADDING_SIZE 32 ///< extra allocated bytes at the end of the probe buffer + +/// Demuxer will use avio_open, no opened file should be provided by the caller. +#define AVFMT_NOFILE 0x0001 +#define AVFMT_NEEDNUMBER 0x0002 /**< Needs '%d' in filename. */ +/** + * The muxer/demuxer is experimental and should be used with caution. + * + * - demuxers: will not be selected automatically by probing, must be specified + * explicitly. + */ +#define AVFMT_EXPERIMENTAL 0x0004 +#define AVFMT_SHOW_IDS 0x0008 /**< Show format stream IDs numbers. */ +#define AVFMT_GLOBALHEADER 0x0040 /**< Format wants global header. */ +#define AVFMT_NOTIMESTAMPS 0x0080 /**< Format does not need / have any timestamps. */ +#define AVFMT_GENERIC_INDEX 0x0100 /**< Use generic index building code. */ +#define AVFMT_TS_DISCONT 0x0200 /**< Format allows timestamp discontinuities. Note, muxers always require valid (monotone) timestamps */ +#define AVFMT_VARIABLE_FPS 0x0400 /**< Format allows variable fps. */ +#define AVFMT_NODIMENSIONS 0x0800 /**< Format does not need width/height */ +#define AVFMT_NOSTREAMS 0x1000 /**< Format does not require any streams */ +#define AVFMT_NOBINSEARCH 0x2000 /**< Format does not allow to fall back on binary search via read_timestamp */ +#define AVFMT_NOGENSEARCH 0x4000 /**< Format does not allow to fall back on generic search */ +#define AVFMT_NO_BYTE_SEEK 0x8000 /**< Format does not allow seeking by bytes */ +#if FF_API_ALLOW_FLUSH +#define AVFMT_ALLOW_FLUSH 0x10000 /**< @deprecated: Just send a NULL packet if you want to flush a muxer. */ +#endif +#define AVFMT_TS_NONSTRICT 0x20000 /**< Format does not require strictly + increasing timestamps, but they must + still be monotonic */ +#define AVFMT_TS_NEGATIVE 0x40000 /**< Format allows muxing negative + timestamps. If not set the timestamp + will be shifted in av_write_frame and + av_interleaved_write_frame so they + start from 0. + The user or muxer can override this through + AVFormatContext.avoid_negative_ts + */ + +#define AVFMT_SEEK_TO_PTS 0x4000000 /**< Seeking is based on PTS */ + +/** + * @addtogroup lavf_encoding + * @{ + */ +typedef struct AVOutputFormat { + const char *name; + /** + * Descriptive name for the format, meant to be more human-readable + * than name. You should use the NULL_IF_CONFIG_SMALL() macro + * to define it. + */ + const char *long_name; + const char *mime_type; + const char *extensions; /**< comma-separated filename extensions */ + /* output support */ + enum AVCodecID audio_codec; /**< default audio codec */ + enum AVCodecID video_codec; /**< default video codec */ + enum AVCodecID subtitle_codec; /**< default subtitle codec */ + /** + * can use flags: AVFMT_NOFILE, AVFMT_NEEDNUMBER, + * AVFMT_GLOBALHEADER, AVFMT_NOTIMESTAMPS, AVFMT_VARIABLE_FPS, + * AVFMT_NODIMENSIONS, AVFMT_NOSTREAMS, + * AVFMT_TS_NONSTRICT, AVFMT_TS_NEGATIVE + */ + int flags; + + /** + * List of supported codec_id-codec_tag pairs, ordered by "better + * choice first". The arrays are all terminated by AV_CODEC_ID_NONE. + */ + const struct AVCodecTag * const *codec_tag; + + + const AVClass *priv_class; ///< AVClass for the private context +} AVOutputFormat; +/** + * @} + */ + +/** + * @addtogroup lavf_decoding + * @{ + */ +typedef struct AVInputFormat { + /** + * A comma separated list of short names for the format. New names + * may be appended with a minor bump. + */ + const char *name; + + /** + * Descriptive name for the format, meant to be more human-readable + * than name. You should use the NULL_IF_CONFIG_SMALL() macro + * to define it. + */ + const char *long_name; + + /** + * Can use flags: AVFMT_NOFILE, AVFMT_NEEDNUMBER, AVFMT_SHOW_IDS, + * AVFMT_NOTIMESTAMPS, AVFMT_GENERIC_INDEX, AVFMT_TS_DISCONT, AVFMT_NOBINSEARCH, + * AVFMT_NOGENSEARCH, AVFMT_NO_BYTE_SEEK, AVFMT_SEEK_TO_PTS. + */ + int flags; + + /** + * If extensions are defined, then no probe is done. You should + * usually not use extension format guessing because it is not + * reliable enough + */ + const char *extensions; + + const struct AVCodecTag * const *codec_tag; + + const AVClass *priv_class; ///< AVClass for the private context + + /** + * Comma-separated list of mime types. + * It is used check for matching mime types while probing. + * @see av_probe_input_format2 + */ + const char *mime_type; + + /***************************************************************** + * No fields below this line are part of the public API. They + * may not be used outside of libavformat and can be changed and + * removed at will. + * New public fields should be added right above. + ***************************************************************** + */ + /** + * Raw demuxers store their codec ID here. + */ + int raw_codec_id; + + /** + * Size of private data so that it can be allocated in the wrapper. + */ + int priv_data_size; + + /** + * Internal flags. See FF_FMT_FLAG_* in internal.h. + */ + int flags_internal; + + /** + * Tell if a given file has a chance of being parsed as this format. + * The buffer provided is guaranteed to be AVPROBE_PADDING_SIZE bytes + * big so you do not have to check for that unless you need more. + */ + int (*read_probe)(const AVProbeData *); + + /** + * Read the format header and initialize the AVFormatContext + * structure. Return 0 if OK. 'avformat_new_stream' should be + * called to create new streams. + */ + int (*read_header)(struct AVFormatContext *); + + /** + * Read one packet and put it in 'pkt'. pts and flags are also + * set. 'avformat_new_stream' can be called only if the flag + * AVFMTCTX_NOHEADER is used and only in the calling thread (not in a + * background thread). + * @return 0 on success, < 0 on error. + * Upon returning an error, pkt must be unreferenced by the caller. + */ + int (*read_packet)(struct AVFormatContext *, AVPacket *pkt); + + /** + * Close the stream. The AVFormatContext and AVStreams are not + * freed by this function + */ + int (*read_close)(struct AVFormatContext *); + + /** + * Seek to a given timestamp relative to the frames in + * stream component stream_index. + * @param stream_index Must not be -1. + * @param flags Selects which direction should be preferred if no exact + * match is available. + * @return >= 0 on success (but not necessarily the new offset) + */ + int (*read_seek)(struct AVFormatContext *, + int stream_index, int64_t timestamp, int flags); + + /** + * Get the next timestamp in stream[stream_index].time_base units. + * @return the timestamp or AV_NOPTS_VALUE if an error occurred + */ + int64_t (*read_timestamp)(struct AVFormatContext *s, int stream_index, + int64_t *pos, int64_t pos_limit); + + /** + * Start/resume playing - only meaningful if using a network-based format + * (RTSP). + */ + int (*read_play)(struct AVFormatContext *); + + /** + * Pause playing - only meaningful if using a network-based format + * (RTSP). + */ + int (*read_pause)(struct AVFormatContext *); + + /** + * Seek to timestamp ts. + * Seeking will be done so that the point from which all active streams + * can be presented successfully will be closest to ts and within min/max_ts. + * Active streams are all streams that have AVStream.discard < AVDISCARD_ALL. + */ + int (*read_seek2)(struct AVFormatContext *s, int stream_index, int64_t min_ts, int64_t ts, int64_t max_ts, int flags); + + /** + * Returns device list with it properties. + * @see avdevice_list_devices() for more details. + */ + int (*get_device_list)(struct AVFormatContext *s, struct AVDeviceInfoList *device_list); + +} AVInputFormat; +/** + * @} + */ + +enum AVStreamParseType { + AVSTREAM_PARSE_NONE, + AVSTREAM_PARSE_FULL, /**< full parsing and repack */ + AVSTREAM_PARSE_HEADERS, /**< Only parse headers, do not repack. */ + AVSTREAM_PARSE_TIMESTAMPS, /**< full parsing and interpolation of timestamps for frames not starting on a packet boundary */ + AVSTREAM_PARSE_FULL_ONCE, /**< full parsing and repack of the first frame only, only implemented for H.264 currently */ + AVSTREAM_PARSE_FULL_RAW, /**< full parsing and repack with timestamp and position generation by parser for raw + this assumes that each packet in the file contains no demuxer level headers and + just codec level data, otherwise position generation would fail */ +}; + +typedef struct AVIndexEntry { + int64_t pos; + int64_t timestamp; /**< + * Timestamp in AVStream.time_base units, preferably the time from which on correctly decoded frames are available + * when seeking to this entry. That means preferable PTS on keyframe based formats. + * But demuxers can choose to store a different timestamp, if it is more convenient for the implementation or nothing better + * is known + */ +#define AVINDEX_KEYFRAME 0x0001 +#define AVINDEX_DISCARD_FRAME 0x0002 /** + * Flag is used to indicate which frame should be discarded after decoding. + */ + int flags:2; + int size:30; //Yeah, trying to keep the size of this small to reduce memory requirements (it is 24 vs. 32 bytes due to possible 8-byte alignment). + int min_distance; /**< Minimum distance between this and the previous keyframe, used to avoid unneeded searching. */ +} AVIndexEntry; + +/** + * The stream should be chosen by default among other streams of the same type, + * unless the user has explicitly specified otherwise. + */ +#define AV_DISPOSITION_DEFAULT (1 << 0) +/** + * The stream is not in original language. + * + * @note AV_DISPOSITION_ORIGINAL is the inverse of this disposition. At most + * one of them should be set in properly tagged streams. + * @note This disposition may apply to any stream type, not just audio. + */ +#define AV_DISPOSITION_DUB (1 << 1) +/** + * The stream is in original language. + * + * @see the notes for AV_DISPOSITION_DUB + */ +#define AV_DISPOSITION_ORIGINAL (1 << 2) +/** + * The stream is a commentary track. + */ +#define AV_DISPOSITION_COMMENT (1 << 3) +/** + * The stream contains song lyrics. + */ +#define AV_DISPOSITION_LYRICS (1 << 4) +/** + * The stream contains karaoke audio. + */ +#define AV_DISPOSITION_KARAOKE (1 << 5) + +/** + * Track should be used during playback by default. + * Useful for subtitle track that should be displayed + * even when user did not explicitly ask for subtitles. + */ +#define AV_DISPOSITION_FORCED (1 << 6) +/** + * The stream is intended for hearing impaired audiences. + */ +#define AV_DISPOSITION_HEARING_IMPAIRED (1 << 7) +/** + * The stream is intended for visually impaired audiences. + */ +#define AV_DISPOSITION_VISUAL_IMPAIRED (1 << 8) +/** + * The audio stream contains music and sound effects without voice. + */ +#define AV_DISPOSITION_CLEAN_EFFECTS (1 << 9) +/** + * The stream is stored in the file as an attached picture/"cover art" (e.g. + * APIC frame in ID3v2). The first (usually only) packet associated with it + * will be returned among the first few packets read from the file unless + * seeking takes place. It can also be accessed at any time in + * AVStream.attached_pic. + */ +#define AV_DISPOSITION_ATTACHED_PIC (1 << 10) +/** + * The stream is sparse, and contains thumbnail images, often corresponding + * to chapter markers. Only ever used with AV_DISPOSITION_ATTACHED_PIC. + */ +#define AV_DISPOSITION_TIMED_THUMBNAILS (1 << 11) + +/** + * The stream is intended to be mixed with a spatial audio track. For example, + * it could be used for narration or stereo music, and may remain unchanged by + * listener head rotation. + */ +#define AV_DISPOSITION_NON_DIEGETIC (1 << 12) + +/** + * The subtitle stream contains captions, providing a transcription and possibly + * a translation of audio. Typically intended for hearing-impaired audiences. + */ +#define AV_DISPOSITION_CAPTIONS (1 << 16) +/** + * The subtitle stream contains a textual description of the video content. + * Typically intended for visually-impaired audiences or for the cases where the + * video cannot be seen. + */ +#define AV_DISPOSITION_DESCRIPTIONS (1 << 17) +/** + * The subtitle stream contains time-aligned metadata that is not intended to be + * directly presented to the user. + */ +#define AV_DISPOSITION_METADATA (1 << 18) +/** + * The audio stream is intended to be mixed with another stream before + * presentation. + * Corresponds to mix_type=0 in mpegts. + */ +#define AV_DISPOSITION_DEPENDENT (1 << 19) +/** + * The video stream contains still images. + */ +#define AV_DISPOSITION_STILL_IMAGE (1 << 20) + +/** + * @return The AV_DISPOSITION_* flag corresponding to disp or a negative error + * code if disp does not correspond to a known stream disposition. + */ +int av_disposition_from_string(const char *disp); + +/** + * @param disposition a combination of AV_DISPOSITION_* values + * @return The string description corresponding to the lowest set bit in + * disposition. NULL when the lowest set bit does not correspond + * to a known disposition or when disposition is 0. + */ +const char *av_disposition_to_string(int disposition); + +/** + * Options for behavior on timestamp wrap detection. + */ +#define AV_PTS_WRAP_IGNORE 0 ///< ignore the wrap +#define AV_PTS_WRAP_ADD_OFFSET 1 ///< add the format specific offset on wrap detection +#define AV_PTS_WRAP_SUB_OFFSET -1 ///< subtract the format specific offset on wrap detection + +/** + * Stream structure. + * New fields can be added to the end with minor version bumps. + * Removal, reordering and changes to existing fields require a major + * version bump. + * sizeof(AVStream) must not be used outside libav*. + */ +typedef struct AVStream { + /** + * A class for @ref avoptions. Set on stream creation. + */ + const AVClass *av_class; + + int index; /**< stream index in AVFormatContext */ + /** + * Format-specific stream ID. + * decoding: set by libavformat + * encoding: set by the user, replaced by libavformat if left unset + */ + int id; + + /** + * Codec parameters associated with this stream. Allocated and freed by + * libavformat in avformat_new_stream() and avformat_free_context() + * respectively. + * + * - demuxing: filled by libavformat on stream creation or in + * avformat_find_stream_info() + * - muxing: filled by the caller before avformat_write_header() + */ + AVCodecParameters *codecpar; + + void *priv_data; + + /** + * This is the fundamental unit of time (in seconds) in terms + * of which frame timestamps are represented. + * + * decoding: set by libavformat + * encoding: May be set by the caller before avformat_write_header() to + * provide a hint to the muxer about the desired timebase. In + * avformat_write_header(), the muxer will overwrite this field + * with the timebase that will actually be used for the timestamps + * written into the file (which may or may not be related to the + * user-provided one, depending on the format). + */ + AVRational time_base; + + /** + * Decoding: pts of the first frame of the stream in presentation order, in stream time base. + * Only set this if you are absolutely 100% sure that the value you set + * it to really is the pts of the first frame. + * This may be undefined (AV_NOPTS_VALUE). + * @note The ASF header does NOT contain a correct start_time the ASF + * demuxer must NOT set this. + */ + int64_t start_time; + + /** + * Decoding: duration of the stream, in stream time base. + * If a source file does not specify a duration, but does specify + * a bitrate, this value will be estimated from bitrate and file size. + * + * Encoding: May be set by the caller before avformat_write_header() to + * provide a hint to the muxer about the estimated duration. + */ + int64_t duration; + + int64_t nb_frames; ///< number of frames in this stream if known or 0 + + /** + * Stream disposition - a combination of AV_DISPOSITION_* flags. + * - demuxing: set by libavformat when creating the stream or in + * avformat_find_stream_info(). + * - muxing: may be set by the caller before avformat_write_header(). + */ + int disposition; + + enum AVDiscard discard; ///< Selects which packets can be discarded at will and do not need to be demuxed. + + /** + * sample aspect ratio (0 if unknown) + * - encoding: Set by user. + * - decoding: Set by libavformat. + */ + AVRational sample_aspect_ratio; + + AVDictionary *metadata; + + /** + * Average framerate + * + * - demuxing: May be set by libavformat when creating the stream or in + * avformat_find_stream_info(). + * - muxing: May be set by the caller before avformat_write_header(). + */ + AVRational avg_frame_rate; + + /** + * For streams with AV_DISPOSITION_ATTACHED_PIC disposition, this packet + * will contain the attached picture. + * + * decoding: set by libavformat, must not be modified by the caller. + * encoding: unused + */ + AVPacket attached_pic; + +#if FF_API_AVSTREAM_SIDE_DATA + /** + * An array of side data that applies to the whole stream (i.e. the + * container does not allow it to change between packets). + * + * There may be no overlap between the side data in this array and side data + * in the packets. I.e. a given side data is either exported by the muxer + * (demuxing) / set by the caller (muxing) in this array, then it never + * appears in the packets, or the side data is exported / sent through + * the packets (always in the first packet where the value becomes known or + * changes), then it does not appear in this array. + * + * - demuxing: Set by libavformat when the stream is created. + * - muxing: May be set by the caller before avformat_write_header(). + * + * Freed by libavformat in avformat_free_context(). + * + * @deprecated use AVStream's @ref AVCodecParameters.coded_side_data + * "codecpar side data". + */ + attribute_deprecated + AVPacketSideData *side_data; + /** + * The number of elements in the AVStream.side_data array. + * + * @deprecated use AVStream's @ref AVCodecParameters.nb_coded_side_data + * "codecpar side data". + */ + attribute_deprecated + int nb_side_data; +#endif + + /** + * Flags indicating events happening on the stream, a combination of + * AVSTREAM_EVENT_FLAG_*. + * + * - demuxing: may be set by the demuxer in avformat_open_input(), + * avformat_find_stream_info() and av_read_frame(). Flags must be cleared + * by the user once the event has been handled. + * - muxing: may be set by the user after avformat_write_header(). to + * indicate a user-triggered event. The muxer will clear the flags for + * events it has handled in av_[interleaved]_write_frame(). + */ + int event_flags; +/** + * - demuxing: the demuxer read new metadata from the file and updated + * AVStream.metadata accordingly + * - muxing: the user updated AVStream.metadata and wishes the muxer to write + * it into the file + */ +#define AVSTREAM_EVENT_FLAG_METADATA_UPDATED 0x0001 +/** + * - demuxing: new packets for this stream were read from the file. This + * event is informational only and does not guarantee that new packets + * for this stream will necessarily be returned from av_read_frame(). + */ +#define AVSTREAM_EVENT_FLAG_NEW_PACKETS (1 << 1) + + /** + * Real base framerate of the stream. + * This is the lowest framerate with which all timestamps can be + * represented accurately (it is the least common multiple of all + * framerates in the stream). Note, this value is just a guess! + * For example, if the time base is 1/90000 and all frames have either + * approximately 3600 or 1800 timer ticks, then r_frame_rate will be 50/1. + */ + AVRational r_frame_rate; + + /** + * Number of bits in timestamps. Used for wrapping control. + * + * - demuxing: set by libavformat + * - muxing: set by libavformat + * + */ + int pts_wrap_bits; +} AVStream; + +struct AVCodecParserContext *av_stream_get_parser(const AVStream *s); + +#if FF_API_GET_END_PTS +/** + * Returns the pts of the last muxed packet + its duration + * + * the retuned value is undefined when used with a demuxer. + */ +attribute_deprecated +int64_t av_stream_get_end_pts(const AVStream *st); +#endif + +#define AV_PROGRAM_RUNNING 1 + +/** + * New fields can be added to the end with minor version bumps. + * Removal, reordering and changes to existing fields require a major + * version bump. + * sizeof(AVProgram) must not be used outside libav*. + */ +typedef struct AVProgram { + int id; + int flags; + enum AVDiscard discard; ///< selects which program to discard and which to feed to the caller + unsigned int *stream_index; + unsigned int nb_stream_indexes; + AVDictionary *metadata; + + int program_num; + int pmt_pid; + int pcr_pid; + int pmt_version; + + /***************************************************************** + * All fields below this line are not part of the public API. They + * may not be used outside of libavformat and can be changed and + * removed at will. + * New public fields should be added right above. + ***************************************************************** + */ + int64_t start_time; + int64_t end_time; + + int64_t pts_wrap_reference; ///< reference dts for wrap detection + int pts_wrap_behavior; ///< behavior on wrap detection +} AVProgram; + +#define AVFMTCTX_NOHEADER 0x0001 /**< signal that no header is present + (streams are added dynamically) */ +#define AVFMTCTX_UNSEEKABLE 0x0002 /**< signal that the stream is definitely + not seekable, and attempts to call the + seek function will fail. For some + network protocols (e.g. HLS), this can + change dynamically at runtime. */ + +typedef struct AVChapter { + int64_t id; ///< unique ID to identify the chapter + AVRational time_base; ///< time base in which the start/end timestamps are specified + int64_t start, end; ///< chapter start/end time in time_base units + AVDictionary *metadata; +} AVChapter; + + +/** + * Callback used by devices to communicate with application. + */ +typedef int (*av_format_control_message)(struct AVFormatContext *s, int type, + void *data, size_t data_size); + +typedef int (*AVOpenCallback)(struct AVFormatContext *s, AVIOContext **pb, const char *url, int flags, + const AVIOInterruptCB *int_cb, AVDictionary **options); + +/** + * The duration of a video can be estimated through various ways, and this enum can be used + * to know how the duration was estimated. + */ +enum AVDurationEstimationMethod { + AVFMT_DURATION_FROM_PTS, ///< Duration accurately estimated from PTSes + AVFMT_DURATION_FROM_STREAM, ///< Duration estimated from a stream with a known duration + AVFMT_DURATION_FROM_BITRATE ///< Duration estimated from bitrate (less accurate) +}; + +/** + * Format I/O context. + * New fields can be added to the end with minor version bumps. + * Removal, reordering and changes to existing fields require a major + * version bump. + * sizeof(AVFormatContext) must not be used outside libav*, use + * avformat_alloc_context() to create an AVFormatContext. + * + * Fields can be accessed through AVOptions (av_opt*), + * the name string used matches the associated command line parameter name and + * can be found in libavformat/options_table.h. + * The AVOption/command line parameter names differ in some cases from the C + * structure field names for historic reasons or brevity. + */ +typedef struct AVFormatContext { + /** + * A class for logging and @ref avoptions. Set by avformat_alloc_context(). + * Exports (de)muxer private options if they exist. + */ + const AVClass *av_class; + + /** + * The input container format. + * + * Demuxing only, set by avformat_open_input(). + */ + const struct AVInputFormat *iformat; + + /** + * The output container format. + * + * Muxing only, must be set by the caller before avformat_write_header(). + */ + const struct AVOutputFormat *oformat; + + /** + * Format private data. This is an AVOptions-enabled struct + * if and only if iformat/oformat.priv_class is not NULL. + * + * - muxing: set by avformat_write_header() + * - demuxing: set by avformat_open_input() + */ + void *priv_data; + + /** + * I/O context. + * + * - demuxing: either set by the user before avformat_open_input() (then + * the user must close it manually) or set by avformat_open_input(). + * - muxing: set by the user before avformat_write_header(). The caller must + * take care of closing / freeing the IO context. + * + * Do NOT set this field if AVFMT_NOFILE flag is set in + * iformat/oformat.flags. In such a case, the (de)muxer will handle + * I/O in some other way and this field will be NULL. + */ + AVIOContext *pb; + + /* stream info */ + /** + * Flags signalling stream properties. A combination of AVFMTCTX_*. + * Set by libavformat. + */ + int ctx_flags; + + /** + * Number of elements in AVFormatContext.streams. + * + * Set by avformat_new_stream(), must not be modified by any other code. + */ + unsigned int nb_streams; + /** + * A list of all streams in the file. New streams are created with + * avformat_new_stream(). + * + * - demuxing: streams are created by libavformat in avformat_open_input(). + * If AVFMTCTX_NOHEADER is set in ctx_flags, then new streams may also + * appear in av_read_frame(). + * - muxing: streams are created by the user before avformat_write_header(). + * + * Freed by libavformat in avformat_free_context(). + */ + AVStream **streams; + + /** + * input or output URL. Unlike the old filename field, this field has no + * length restriction. + * + * - demuxing: set by avformat_open_input(), initialized to an empty + * string if url parameter was NULL in avformat_open_input(). + * - muxing: may be set by the caller before calling avformat_write_header() + * (or avformat_init_output() if that is called first) to a string + * which is freeable by av_free(). Set to an empty string if it + * was NULL in avformat_init_output(). + * + * Freed by libavformat in avformat_free_context(). + */ + char *url; + + /** + * Position of the first frame of the component, in + * AV_TIME_BASE fractional seconds. NEVER set this value directly: + * It is deduced from the AVStream values. + * + * Demuxing only, set by libavformat. + */ + int64_t start_time; + + /** + * Duration of the stream, in AV_TIME_BASE fractional + * seconds. Only set this value if you know none of the individual stream + * durations and also do not set any of them. This is deduced from the + * AVStream values if not set. + * + * Demuxing only, set by libavformat. + */ + int64_t duration; + + /** + * Total stream bitrate in bit/s, 0 if not + * available. Never set it directly if the file_size and the + * duration are known as FFmpeg can compute it automatically. + */ + int64_t bit_rate; + + unsigned int packet_size; + int max_delay; + + /** + * Flags modifying the (de)muxer behaviour. A combination of AVFMT_FLAG_*. + * Set by the user before avformat_open_input() / avformat_write_header(). + */ + int flags; +#define AVFMT_FLAG_GENPTS 0x0001 ///< Generate missing pts even if it requires parsing future frames. +#define AVFMT_FLAG_IGNIDX 0x0002 ///< Ignore index. +#define AVFMT_FLAG_NONBLOCK 0x0004 ///< Do not block when reading packets from input. +#define AVFMT_FLAG_IGNDTS 0x0008 ///< Ignore DTS on frames that contain both DTS & PTS +#define AVFMT_FLAG_NOFILLIN 0x0010 ///< Do not infer any values from other values, just return what is stored in the container +#define AVFMT_FLAG_NOPARSE 0x0020 ///< Do not use AVParsers, you also must set AVFMT_FLAG_NOFILLIN as the fillin code works on frames and no parsing -> no frames. Also seeking to frames can not work if parsing to find frame boundaries has been disabled +#define AVFMT_FLAG_NOBUFFER 0x0040 ///< Do not buffer frames when possible +#define AVFMT_FLAG_CUSTOM_IO 0x0080 ///< The caller has supplied a custom AVIOContext, don't avio_close() it. +#define AVFMT_FLAG_DISCARD_CORRUPT 0x0100 ///< Discard frames marked corrupted +#define AVFMT_FLAG_FLUSH_PACKETS 0x0200 ///< Flush the AVIOContext every packet. +/** + * When muxing, try to avoid writing any random/volatile data to the output. + * This includes any random IDs, real-time timestamps/dates, muxer version, etc. + * + * This flag is mainly intended for testing. + */ +#define AVFMT_FLAG_BITEXACT 0x0400 +#define AVFMT_FLAG_SORT_DTS 0x10000 ///< try to interleave outputted packets by dts (using this flag can slow demuxing down) +#define AVFMT_FLAG_FAST_SEEK 0x80000 ///< Enable fast, but inaccurate seeks for some formats +#if FF_API_LAVF_SHORTEST +#define AVFMT_FLAG_SHORTEST 0x100000 ///< Stop muxing when the shortest stream stops. +#endif +#define AVFMT_FLAG_AUTO_BSF 0x200000 ///< Add bitstream filters as requested by the muxer + + /** + * Maximum number of bytes read from input in order to determine stream + * properties. Used when reading the global header and in + * avformat_find_stream_info(). + * + * Demuxing only, set by the caller before avformat_open_input(). + * + * @note this is \e not used for determining the \ref AVInputFormat + * "input format" + * @sa format_probesize + */ + int64_t probesize; + + /** + * Maximum duration (in AV_TIME_BASE units) of the data read + * from input in avformat_find_stream_info(). + * Demuxing only, set by the caller before avformat_find_stream_info(). + * Can be set to 0 to let avformat choose using a heuristic. + */ + int64_t max_analyze_duration; + + const uint8_t *key; + int keylen; + + unsigned int nb_programs; + AVProgram **programs; + + /** + * Forced video codec_id. + * Demuxing: Set by user. + */ + enum AVCodecID video_codec_id; + + /** + * Forced audio codec_id. + * Demuxing: Set by user. + */ + enum AVCodecID audio_codec_id; + + /** + * Forced subtitle codec_id. + * Demuxing: Set by user. + */ + enum AVCodecID subtitle_codec_id; + + /** + * Maximum amount of memory in bytes to use for the index of each stream. + * If the index exceeds this size, entries will be discarded as + * needed to maintain a smaller size. This can lead to slower or less + * accurate seeking (depends on demuxer). + * Demuxers for which a full in-memory index is mandatory will ignore + * this. + * - muxing: unused + * - demuxing: set by user + */ + unsigned int max_index_size; + + /** + * Maximum amount of memory in bytes to use for buffering frames + * obtained from realtime capture devices. + */ + unsigned int max_picture_buffer; + + /** + * Number of chapters in AVChapter array. + * When muxing, chapters are normally written in the file header, + * so nb_chapters should normally be initialized before write_header + * is called. Some muxers (e.g. mov and mkv) can also write chapters + * in the trailer. To write chapters in the trailer, nb_chapters + * must be zero when write_header is called and non-zero when + * write_trailer is called. + * - muxing: set by user + * - demuxing: set by libavformat + */ + unsigned int nb_chapters; + AVChapter **chapters; + + /** + * Metadata that applies to the whole file. + * + * - demuxing: set by libavformat in avformat_open_input() + * - muxing: may be set by the caller before avformat_write_header() + * + * Freed by libavformat in avformat_free_context(). + */ + AVDictionary *metadata; + + /** + * Start time of the stream in real world time, in microseconds + * since the Unix epoch (00:00 1st January 1970). That is, pts=0 in the + * stream was captured at this real world time. + * - muxing: Set by the caller before avformat_write_header(). If set to + * either 0 or AV_NOPTS_VALUE, then the current wall-time will + * be used. + * - demuxing: Set by libavformat. AV_NOPTS_VALUE if unknown. Note that + * the value may become known after some number of frames + * have been received. + */ + int64_t start_time_realtime; + + /** + * The number of frames used for determining the framerate in + * avformat_find_stream_info(). + * Demuxing only, set by the caller before avformat_find_stream_info(). + */ + int fps_probe_size; + + /** + * Error recognition; higher values will detect more errors but may + * misdetect some more or less valid parts as errors. + * Demuxing only, set by the caller before avformat_open_input(). + */ + int error_recognition; + + /** + * Custom interrupt callbacks for the I/O layer. + * + * demuxing: set by the user before avformat_open_input(). + * muxing: set by the user before avformat_write_header() + * (mainly useful for AVFMT_NOFILE formats). The callback + * should also be passed to avio_open2() if it's used to + * open the file. + */ + AVIOInterruptCB interrupt_callback; + + /** + * Flags to enable debugging. + */ + int debug; +#define FF_FDEBUG_TS 0x0001 + + /** + * Maximum buffering duration for interleaving. + * + * To ensure all the streams are interleaved correctly, + * av_interleaved_write_frame() will wait until it has at least one packet + * for each stream before actually writing any packets to the output file. + * When some streams are "sparse" (i.e. there are large gaps between + * successive packets), this can result in excessive buffering. + * + * This field specifies the maximum difference between the timestamps of the + * first and the last packet in the muxing queue, above which libavformat + * will output a packet regardless of whether it has queued a packet for all + * the streams. + * + * Muxing only, set by the caller before avformat_write_header(). + */ + int64_t max_interleave_delta; + + /** + * Allow non-standard and experimental extension + * @see AVCodecContext.strict_std_compliance + */ + int strict_std_compliance; + + /** + * Flags indicating events happening on the file, a combination of + * AVFMT_EVENT_FLAG_*. + * + * - demuxing: may be set by the demuxer in avformat_open_input(), + * avformat_find_stream_info() and av_read_frame(). Flags must be cleared + * by the user once the event has been handled. + * - muxing: may be set by the user after avformat_write_header() to + * indicate a user-triggered event. The muxer will clear the flags for + * events it has handled in av_[interleaved]_write_frame(). + */ + int event_flags; +/** + * - demuxing: the demuxer read new metadata from the file and updated + * AVFormatContext.metadata accordingly + * - muxing: the user updated AVFormatContext.metadata and wishes the muxer to + * write it into the file + */ +#define AVFMT_EVENT_FLAG_METADATA_UPDATED 0x0001 + + /** + * Maximum number of packets to read while waiting for the first timestamp. + * Decoding only. + */ + int max_ts_probe; + + /** + * Avoid negative timestamps during muxing. + * Any value of the AVFMT_AVOID_NEG_TS_* constants. + * Note, this works better when using av_interleaved_write_frame(). + * - muxing: Set by user + * - demuxing: unused + */ + int avoid_negative_ts; +#define AVFMT_AVOID_NEG_TS_AUTO -1 ///< Enabled when required by target format +#define AVFMT_AVOID_NEG_TS_DISABLED 0 ///< Do not shift timestamps even when they are negative. +#define AVFMT_AVOID_NEG_TS_MAKE_NON_NEGATIVE 1 ///< Shift timestamps so they are non negative +#define AVFMT_AVOID_NEG_TS_MAKE_ZERO 2 ///< Shift timestamps so that they start at 0 + + /** + * Transport stream id. + * This will be moved into demuxer private options. Thus no API/ABI compatibility + */ + int ts_id; + + /** + * Audio preload in microseconds. + * Note, not all formats support this and unpredictable things may happen if it is used when not supported. + * - encoding: Set by user + * - decoding: unused + */ + int audio_preload; + + /** + * Max chunk time in microseconds. + * Note, not all formats support this and unpredictable things may happen if it is used when not supported. + * - encoding: Set by user + * - decoding: unused + */ + int max_chunk_duration; + + /** + * Max chunk size in bytes + * Note, not all formats support this and unpredictable things may happen if it is used when not supported. + * - encoding: Set by user + * - decoding: unused + */ + int max_chunk_size; + + /** + * forces the use of wallclock timestamps as pts/dts of packets + * This has undefined results in the presence of B frames. + * - encoding: unused + * - decoding: Set by user + */ + int use_wallclock_as_timestamps; + + /** + * avio flags, used to force AVIO_FLAG_DIRECT. + * - encoding: unused + * - decoding: Set by user + */ + int avio_flags; + + /** + * The duration field can be estimated through various ways, and this field can be used + * to know how the duration was estimated. + * - encoding: unused + * - decoding: Read by user + */ + enum AVDurationEstimationMethod duration_estimation_method; + + /** + * Skip initial bytes when opening stream + * - encoding: unused + * - decoding: Set by user + */ + int64_t skip_initial_bytes; + + /** + * Correct single timestamp overflows + * - encoding: unused + * - decoding: Set by user + */ + unsigned int correct_ts_overflow; + + /** + * Force seeking to any (also non key) frames. + * - encoding: unused + * - decoding: Set by user + */ + int seek2any; + + /** + * Flush the I/O context after each packet. + * - encoding: Set by user + * - decoding: unused + */ + int flush_packets; + + /** + * format probing score. + * The maximal score is AVPROBE_SCORE_MAX, its set when the demuxer probes + * the format. + * - encoding: unused + * - decoding: set by avformat, read by user + */ + int probe_score; + + /** + * Maximum number of bytes read from input in order to identify the + * \ref AVInputFormat "input format". Only used when the format is not set + * explicitly by the caller. + * + * Demuxing only, set by the caller before avformat_open_input(). + * + * @sa probesize + */ + int format_probesize; + + /** + * ',' separated list of allowed decoders. + * If NULL then all are allowed + * - encoding: unused + * - decoding: set by user + */ + char *codec_whitelist; + + /** + * ',' separated list of allowed demuxers. + * If NULL then all are allowed + * - encoding: unused + * - decoding: set by user + */ + char *format_whitelist; + + /** + * IO repositioned flag. + * This is set by avformat when the underlaying IO context read pointer + * is repositioned, for example when doing byte based seeking. + * Demuxers can use the flag to detect such changes. + */ + int io_repositioned; + + /** + * Forced video codec. + * This allows forcing a specific decoder, even when there are multiple with + * the same codec_id. + * Demuxing: Set by user + */ + const struct AVCodec *video_codec; + + /** + * Forced audio codec. + * This allows forcing a specific decoder, even when there are multiple with + * the same codec_id. + * Demuxing: Set by user + */ + const struct AVCodec *audio_codec; + + /** + * Forced subtitle codec. + * This allows forcing a specific decoder, even when there are multiple with + * the same codec_id. + * Demuxing: Set by user + */ + const struct AVCodec *subtitle_codec; + + /** + * Forced data codec. + * This allows forcing a specific decoder, even when there are multiple with + * the same codec_id. + * Demuxing: Set by user + */ + const struct AVCodec *data_codec; + + /** + * Number of bytes to be written as padding in a metadata header. + * Demuxing: Unused. + * Muxing: Set by user via av_format_set_metadata_header_padding. + */ + int metadata_header_padding; + + /** + * User data. + * This is a place for some private data of the user. + */ + void *opaque; + + /** + * Callback used by devices to communicate with application. + */ + av_format_control_message control_message_cb; + + /** + * Output timestamp offset, in microseconds. + * Muxing: set by user + */ + int64_t output_ts_offset; + + /** + * dump format separator. + * can be ", " or "\n " or anything else + * - muxing: Set by user. + * - demuxing: Set by user. + */ + uint8_t *dump_separator; + + /** + * Forced Data codec_id. + * Demuxing: Set by user. + */ + enum AVCodecID data_codec_id; + + /** + * ',' separated list of allowed protocols. + * - encoding: unused + * - decoding: set by user + */ + char *protocol_whitelist; + + /** + * A callback for opening new IO streams. + * + * Whenever a muxer or a demuxer needs to open an IO stream (typically from + * avformat_open_input() for demuxers, but for certain formats can happen at + * other times as well), it will call this callback to obtain an IO context. + * + * @param s the format context + * @param pb on success, the newly opened IO context should be returned here + * @param url the url to open + * @param flags a combination of AVIO_FLAG_* + * @param options a dictionary of additional options, with the same + * semantics as in avio_open2() + * @return 0 on success, a negative AVERROR code on failure + * + * @note Certain muxers and demuxers do nesting, i.e. they open one or more + * additional internal format contexts. Thus the AVFormatContext pointer + * passed to this callback may be different from the one facing the caller. + * It will, however, have the same 'opaque' field. + */ + int (*io_open)(struct AVFormatContext *s, AVIOContext **pb, const char *url, + int flags, AVDictionary **options); + +#if FF_API_AVFORMAT_IO_CLOSE + /** + * A callback for closing the streams opened with AVFormatContext.io_open(). + * + * @deprecated use io_close2 + */ + attribute_deprecated + void (*io_close)(struct AVFormatContext *s, AVIOContext *pb); +#endif + + /** + * ',' separated list of disallowed protocols. + * - encoding: unused + * - decoding: set by user + */ + char *protocol_blacklist; + + /** + * The maximum number of streams. + * - encoding: unused + * - decoding: set by user + */ + int max_streams; + + /** + * Skip duration calcuation in estimate_timings_from_pts. + * - encoding: unused + * - decoding: set by user + */ + int skip_estimate_duration_from_pts; + + /** + * Maximum number of packets that can be probed + * - encoding: unused + * - decoding: set by user + */ + int max_probe_packets; + + /** + * A callback for closing the streams opened with AVFormatContext.io_open(). + * + * Using this is preferred over io_close, because this can return an error. + * Therefore this callback is used instead of io_close by the generic + * libavformat code if io_close is NULL or the default. + * + * @param s the format context + * @param pb IO context to be closed and freed + * @return 0 on success, a negative AVERROR code on failure + */ + int (*io_close2)(struct AVFormatContext *s, AVIOContext *pb); +} AVFormatContext; + +/** + * This function will cause global side data to be injected in the next packet + * of each stream as well as after any subsequent seek. + * + * @note global side data is always available in every AVStream's + * @ref AVCodecParameters.coded_side_data "codecpar side data" array, and + * in a @ref AVCodecContext.coded_side_data "decoder's side data" array if + * initialized with said stream's codecpar. + * @see av_packet_side_data_get() + */ +void av_format_inject_global_side_data(AVFormatContext *s); + +/** + * Returns the method used to set ctx->duration. + * + * @return AVFMT_DURATION_FROM_PTS, AVFMT_DURATION_FROM_STREAM, or AVFMT_DURATION_FROM_BITRATE. + */ +enum AVDurationEstimationMethod av_fmt_ctx_get_duration_estimation_method(const AVFormatContext* ctx); + +/** + * @defgroup lavf_core Core functions + * @ingroup libavf + * + * Functions for querying libavformat capabilities, allocating core structures, + * etc. + * @{ + */ + +/** + * Return the LIBAVFORMAT_VERSION_INT constant. + */ +unsigned avformat_version(void); + +/** + * Return the libavformat build-time configuration. + */ +const char *avformat_configuration(void); + +/** + * Return the libavformat license. + */ +const char *avformat_license(void); + +/** + * Do global initialization of network libraries. This is optional, + * and not recommended anymore. + * + * This functions only exists to work around thread-safety issues + * with older GnuTLS or OpenSSL libraries. If libavformat is linked + * to newer versions of those libraries, or if you do not use them, + * calling this function is unnecessary. Otherwise, you need to call + * this function before any other threads using them are started. + * + * This function will be deprecated once support for older GnuTLS and + * OpenSSL libraries is removed, and this function has no purpose + * anymore. + */ +int avformat_network_init(void); + +/** + * Undo the initialization done by avformat_network_init. Call it only + * once for each time you called avformat_network_init. + */ +int avformat_network_deinit(void); + +/** + * Iterate over all registered muxers. + * + * @param opaque a pointer where libavformat will store the iteration state. Must + * point to NULL to start the iteration. + * + * @return the next registered muxer or NULL when the iteration is + * finished + */ +const AVOutputFormat *av_muxer_iterate(void **opaque); + +/** + * Iterate over all registered demuxers. + * + * @param opaque a pointer where libavformat will store the iteration state. + * Must point to NULL to start the iteration. + * + * @return the next registered demuxer or NULL when the iteration is + * finished + */ +const AVInputFormat *av_demuxer_iterate(void **opaque); + +/** + * Allocate an AVFormatContext. + * avformat_free_context() can be used to free the context and everything + * allocated by the framework within it. + */ +AVFormatContext *avformat_alloc_context(void); + +/** + * Free an AVFormatContext and all its streams. + * @param s context to free + */ +void avformat_free_context(AVFormatContext *s); + +/** + * Get the AVClass for AVFormatContext. It can be used in combination with + * AV_OPT_SEARCH_FAKE_OBJ for examining options. + * + * @see av_opt_find(). + */ +const AVClass *avformat_get_class(void); + +/** + * Get the AVClass for AVStream. It can be used in combination with + * AV_OPT_SEARCH_FAKE_OBJ for examining options. + * + * @see av_opt_find(). + */ +const AVClass *av_stream_get_class(void); + +/** + * Add a new stream to a media file. + * + * When demuxing, it is called by the demuxer in read_header(). If the + * flag AVFMTCTX_NOHEADER is set in s.ctx_flags, then it may also + * be called in read_packet(). + * + * When muxing, should be called by the user before avformat_write_header(). + * + * User is required to call avformat_free_context() to clean up the allocation + * by avformat_new_stream(). + * + * @param s media file handle + * @param c unused, does nothing + * + * @return newly created stream or NULL on error. + */ +AVStream *avformat_new_stream(AVFormatContext *s, const struct AVCodec *c); + +#if FF_API_AVSTREAM_SIDE_DATA +/** + * Wrap an existing array as stream side data. + * + * @param st stream + * @param type side information type + * @param data the side data array. It must be allocated with the av_malloc() + * family of functions. The ownership of the data is transferred to + * st. + * @param size side information size + * + * @return zero on success, a negative AVERROR code on failure. On failure, + * the stream is unchanged and the data remains owned by the caller. + * @deprecated use av_packet_side_data_add() with the stream's + * @ref AVCodecParameters.coded_side_data "codecpar side data" + */ +attribute_deprecated +int av_stream_add_side_data(AVStream *st, enum AVPacketSideDataType type, + uint8_t *data, size_t size); + +/** + * Allocate new information from stream. + * + * @param stream stream + * @param type desired side information type + * @param size side information size + * + * @return pointer to fresh allocated data or NULL otherwise + * @deprecated use av_packet_side_data_new() with the stream's + * @ref AVCodecParameters.coded_side_data "codecpar side data" + */ +attribute_deprecated +uint8_t *av_stream_new_side_data(AVStream *stream, + enum AVPacketSideDataType type, size_t size); +/** + * Get side information from stream. + * + * @param stream stream + * @param type desired side information type + * @param size If supplied, *size will be set to the size of the side data + * or to zero if the desired side data is not present. + * + * @return pointer to data if present or NULL otherwise + * @deprecated use av_packet_side_data_get() with the stream's + * @ref AVCodecParameters.coded_side_data "codecpar side data" + */ +attribute_deprecated +uint8_t *av_stream_get_side_data(const AVStream *stream, + enum AVPacketSideDataType type, size_t *size); +#endif + +AVProgram *av_new_program(AVFormatContext *s, int id); + +/** + * @} + */ + + +/** + * Allocate an AVFormatContext for an output format. + * avformat_free_context() can be used to free the context and + * everything allocated by the framework within it. + * + * @param ctx pointee is set to the created format context, + * or to NULL in case of failure + * @param oformat format to use for allocating the context, if NULL + * format_name and filename are used instead + * @param format_name the name of output format to use for allocating the + * context, if NULL filename is used instead + * @param filename the name of the filename to use for allocating the + * context, may be NULL + * + * @return >= 0 in case of success, a negative AVERROR code in case of + * failure + */ +int avformat_alloc_output_context2(AVFormatContext **ctx, const AVOutputFormat *oformat, + const char *format_name, const char *filename); + +/** + * @addtogroup lavf_decoding + * @{ + */ + +/** + * Find AVInputFormat based on the short name of the input format. + */ +const AVInputFormat *av_find_input_format(const char *short_name); + +/** + * Guess the file format. + * + * @param pd data to be probed + * @param is_opened Whether the file is already opened; determines whether + * demuxers with or without AVFMT_NOFILE are probed. + */ +const AVInputFormat *av_probe_input_format(const AVProbeData *pd, int is_opened); + +/** + * Guess the file format. + * + * @param pd data to be probed + * @param is_opened Whether the file is already opened; determines whether + * demuxers with or without AVFMT_NOFILE are probed. + * @param score_max A probe score larger that this is required to accept a + * detection, the variable is set to the actual detection + * score afterwards. + * If the score is <= AVPROBE_SCORE_MAX / 4 it is recommended + * to retry with a larger probe buffer. + */ +const AVInputFormat *av_probe_input_format2(const AVProbeData *pd, + int is_opened, int *score_max); + +/** + * Guess the file format. + * + * @param is_opened Whether the file is already opened; determines whether + * demuxers with or without AVFMT_NOFILE are probed. + * @param score_ret The score of the best detection. + */ +const AVInputFormat *av_probe_input_format3(const AVProbeData *pd, + int is_opened, int *score_ret); + +/** + * Probe a bytestream to determine the input format. Each time a probe returns + * with a score that is too low, the probe buffer size is increased and another + * attempt is made. When the maximum probe size is reached, the input format + * with the highest score is returned. + * + * @param pb the bytestream to probe + * @param fmt the input format is put here + * @param url the url of the stream + * @param logctx the log context + * @param offset the offset within the bytestream to probe from + * @param max_probe_size the maximum probe buffer size (zero for default) + * + * @return the score in case of success, a negative value corresponding to an + * the maximal score is AVPROBE_SCORE_MAX + * AVERROR code otherwise + */ +int av_probe_input_buffer2(AVIOContext *pb, const AVInputFormat **fmt, + const char *url, void *logctx, + unsigned int offset, unsigned int max_probe_size); + +/** + * Like av_probe_input_buffer2() but returns 0 on success + */ +int av_probe_input_buffer(AVIOContext *pb, const AVInputFormat **fmt, + const char *url, void *logctx, + unsigned int offset, unsigned int max_probe_size); + +/** + * Open an input stream and read the header. The codecs are not opened. + * The stream must be closed with avformat_close_input(). + * + * @param ps Pointer to user-supplied AVFormatContext (allocated by + * avformat_alloc_context). May be a pointer to NULL, in + * which case an AVFormatContext is allocated by this + * function and written into ps. + * Note that a user-supplied AVFormatContext will be freed + * on failure. + * @param url URL of the stream to open. + * @param fmt If non-NULL, this parameter forces a specific input format. + * Otherwise the format is autodetected. + * @param options A dictionary filled with AVFormatContext and demuxer-private + * options. + * On return this parameter will be destroyed and replaced with + * a dict containing options that were not found. May be NULL. + * + * @return 0 on success, a negative AVERROR on failure. + * + * @note If you want to use custom IO, preallocate the format context and set its pb field. + */ +int avformat_open_input(AVFormatContext **ps, const char *url, + const AVInputFormat *fmt, AVDictionary **options); + +/** + * Read packets of a media file to get stream information. This + * is useful for file formats with no headers such as MPEG. This + * function also computes the real framerate in case of MPEG-2 repeat + * frame mode. + * The logical file position is not changed by this function; + * examined packets may be buffered for later processing. + * + * @param ic media file handle + * @param options If non-NULL, an ic.nb_streams long array of pointers to + * dictionaries, where i-th member contains options for + * codec corresponding to i-th stream. + * On return each dictionary will be filled with options that were not found. + * @return >=0 if OK, AVERROR_xxx on error + * + * @note this function isn't guaranteed to open all the codecs, so + * options being non-empty at return is a perfectly normal behavior. + * + * @todo Let the user decide somehow what information is needed so that + * we do not waste time getting stuff the user does not need. + */ +int avformat_find_stream_info(AVFormatContext *ic, AVDictionary **options); + +/** + * Find the programs which belong to a given stream. + * + * @param ic media file handle + * @param last the last found program, the search will start after this + * program, or from the beginning if it is NULL + * @param s stream index + * + * @return the next program which belongs to s, NULL if no program is found or + * the last program is not among the programs of ic. + */ +AVProgram *av_find_program_from_stream(AVFormatContext *ic, AVProgram *last, int s); + +void av_program_add_stream_index(AVFormatContext *ac, int progid, unsigned int idx); + +/** + * Find the "best" stream in the file. + * The best stream is determined according to various heuristics as the most + * likely to be what the user expects. + * If the decoder parameter is non-NULL, av_find_best_stream will find the + * default decoder for the stream's codec; streams for which no decoder can + * be found are ignored. + * + * @param ic media file handle + * @param type stream type: video, audio, subtitles, etc. + * @param wanted_stream_nb user-requested stream number, + * or -1 for automatic selection + * @param related_stream try to find a stream related (eg. in the same + * program) to this one, or -1 if none + * @param decoder_ret if non-NULL, returns the decoder for the + * selected stream + * @param flags flags; none are currently defined + * + * @return the non-negative stream number in case of success, + * AVERROR_STREAM_NOT_FOUND if no stream with the requested type + * could be found, + * AVERROR_DECODER_NOT_FOUND if streams were found but no decoder + * + * @note If av_find_best_stream returns successfully and decoder_ret is not + * NULL, then *decoder_ret is guaranteed to be set to a valid AVCodec. + */ +int av_find_best_stream(AVFormatContext *ic, + enum AVMediaType type, + int wanted_stream_nb, + int related_stream, + const struct AVCodec **decoder_ret, + int flags); + +/** + * Return the next frame of a stream. + * This function returns what is stored in the file, and does not validate + * that what is there are valid frames for the decoder. It will split what is + * stored in the file into frames and return one for each call. It will not + * omit invalid data between valid frames so as to give the decoder the maximum + * information possible for decoding. + * + * On success, the returned packet is reference-counted (pkt->buf is set) and + * valid indefinitely. The packet must be freed with av_packet_unref() when + * it is no longer needed. For video, the packet contains exactly one frame. + * For audio, it contains an integer number of frames if each frame has + * a known fixed size (e.g. PCM or ADPCM data). If the audio frames have + * a variable size (e.g. MPEG audio), then it contains one frame. + * + * pkt->pts, pkt->dts and pkt->duration are always set to correct + * values in AVStream.time_base units (and guessed if the format cannot + * provide them). pkt->pts can be AV_NOPTS_VALUE if the video format + * has B-frames, so it is better to rely on pkt->dts if you do not + * decompress the payload. + * + * @return 0 if OK, < 0 on error or end of file. On error, pkt will be blank + * (as if it came from av_packet_alloc()). + * + * @note pkt will be initialized, so it may be uninitialized, but it must not + * contain data that needs to be freed. + */ +int av_read_frame(AVFormatContext *s, AVPacket *pkt); + +/** + * Seek to the keyframe at timestamp. + * 'timestamp' in 'stream_index'. + * + * @param s media file handle + * @param stream_index If stream_index is (-1), a default stream is selected, + * and timestamp is automatically converted from + * AV_TIME_BASE units to the stream specific time_base. + * @param timestamp Timestamp in AVStream.time_base units or, if no stream + * is specified, in AV_TIME_BASE units. + * @param flags flags which select direction and seeking mode + * + * @return >= 0 on success + */ +int av_seek_frame(AVFormatContext *s, int stream_index, int64_t timestamp, + int flags); + +/** + * Seek to timestamp ts. + * Seeking will be done so that the point from which all active streams + * can be presented successfully will be closest to ts and within min/max_ts. + * Active streams are all streams that have AVStream.discard < AVDISCARD_ALL. + * + * If flags contain AVSEEK_FLAG_BYTE, then all timestamps are in bytes and + * are the file position (this may not be supported by all demuxers). + * If flags contain AVSEEK_FLAG_FRAME, then all timestamps are in frames + * in the stream with stream_index (this may not be supported by all demuxers). + * Otherwise all timestamps are in units of the stream selected by stream_index + * or if stream_index is -1, in AV_TIME_BASE units. + * If flags contain AVSEEK_FLAG_ANY, then non-keyframes are treated as + * keyframes (this may not be supported by all demuxers). + * If flags contain AVSEEK_FLAG_BACKWARD, it is ignored. + * + * @param s media file handle + * @param stream_index index of the stream which is used as time base reference + * @param min_ts smallest acceptable timestamp + * @param ts target timestamp + * @param max_ts largest acceptable timestamp + * @param flags flags + * @return >=0 on success, error code otherwise + * + * @note This is part of the new seek API which is still under construction. + */ +int avformat_seek_file(AVFormatContext *s, int stream_index, int64_t min_ts, int64_t ts, int64_t max_ts, int flags); + +/** + * Discard all internally buffered data. This can be useful when dealing with + * discontinuities in the byte stream. Generally works only with formats that + * can resync. This includes headerless formats like MPEG-TS/TS but should also + * work with NUT, Ogg and in a limited way AVI for example. + * + * The set of streams, the detected duration, stream parameters and codecs do + * not change when calling this function. If you want a complete reset, it's + * better to open a new AVFormatContext. + * + * This does not flush the AVIOContext (s->pb). If necessary, call + * avio_flush(s->pb) before calling this function. + * + * @param s media file handle + * @return >=0 on success, error code otherwise + */ +int avformat_flush(AVFormatContext *s); + +/** + * Start playing a network-based stream (e.g. RTSP stream) at the + * current position. + */ +int av_read_play(AVFormatContext *s); + +/** + * Pause a network-based stream (e.g. RTSP stream). + * + * Use av_read_play() to resume it. + */ +int av_read_pause(AVFormatContext *s); + +/** + * Close an opened input AVFormatContext. Free it and all its contents + * and set *s to NULL. + */ +void avformat_close_input(AVFormatContext **s); +/** + * @} + */ + +#define AVSEEK_FLAG_BACKWARD 1 ///< seek backward +#define AVSEEK_FLAG_BYTE 2 ///< seeking based on position in bytes +#define AVSEEK_FLAG_ANY 4 ///< seek to any frame, even non-keyframes +#define AVSEEK_FLAG_FRAME 8 ///< seeking based on frame number + +/** + * @addtogroup lavf_encoding + * @{ + */ + +#define AVSTREAM_INIT_IN_WRITE_HEADER 0 ///< stream parameters initialized in avformat_write_header +#define AVSTREAM_INIT_IN_INIT_OUTPUT 1 ///< stream parameters initialized in avformat_init_output + +/** + * Allocate the stream private data and write the stream header to + * an output media file. + * + * @param s Media file handle, must be allocated with + * avformat_alloc_context(). + * Its \ref AVFormatContext.oformat "oformat" field must be set + * to the desired output format; + * Its \ref AVFormatContext.pb "pb" field must be set to an + * already opened ::AVIOContext. + * @param options An ::AVDictionary filled with AVFormatContext and + * muxer-private options. + * On return this parameter will be destroyed and replaced with + * a dict containing options that were not found. May be NULL. + * + * @retval AVSTREAM_INIT_IN_WRITE_HEADER On success, if the codec had not already been + * fully initialized in avformat_init_output(). + * @retval AVSTREAM_INIT_IN_INIT_OUTPUT On success, if the codec had already been fully + * initialized in avformat_init_output(). + * @retval AVERROR A negative AVERROR on failure. + * + * @see av_opt_find, av_dict_set, avio_open, av_oformat_next, avformat_init_output. + */ +av_warn_unused_result +int avformat_write_header(AVFormatContext *s, AVDictionary **options); + +/** + * Allocate the stream private data and initialize the codec, but do not write the header. + * May optionally be used before avformat_write_header() to initialize stream parameters + * before actually writing the header. + * If using this function, do not pass the same options to avformat_write_header(). + * + * @param s Media file handle, must be allocated with + * avformat_alloc_context(). + * Its \ref AVFormatContext.oformat "oformat" field must be set + * to the desired output format; + * Its \ref AVFormatContext.pb "pb" field must be set to an + * already opened ::AVIOContext. + * @param options An ::AVDictionary filled with AVFormatContext and + * muxer-private options. + * On return this parameter will be destroyed and replaced with + * a dict containing options that were not found. May be NULL. + * + * @retval AVSTREAM_INIT_IN_WRITE_HEADER On success, if the codec requires + * avformat_write_header to fully initialize. + * @retval AVSTREAM_INIT_IN_INIT_OUTPUT On success, if the codec has been fully + * initialized. + * @retval AVERROR Anegative AVERROR on failure. + * + * @see av_opt_find, av_dict_set, avio_open, av_oformat_next, avformat_write_header. + */ +av_warn_unused_result +int avformat_init_output(AVFormatContext *s, AVDictionary **options); + +/** + * Write a packet to an output media file. + * + * This function passes the packet directly to the muxer, without any buffering + * or reordering. The caller is responsible for correctly interleaving the + * packets if the format requires it. Callers that want libavformat to handle + * the interleaving should call av_interleaved_write_frame() instead of this + * function. + * + * @param s media file handle + * @param pkt The packet containing the data to be written. Note that unlike + * av_interleaved_write_frame(), this function does not take + * ownership of the packet passed to it (though some muxers may make + * an internal reference to the input packet). + *
+ * This parameter can be NULL (at any time, not just at the end), in + * order to immediately flush data buffered within the muxer, for + * muxers that buffer up data internally before writing it to the + * output. + *
+ * Packet's @ref AVPacket.stream_index "stream_index" field must be + * set to the index of the corresponding stream in @ref + * AVFormatContext.streams "s->streams". + *
+ * The timestamps (@ref AVPacket.pts "pts", @ref AVPacket.dts "dts") + * must be set to correct values in the stream's timebase (unless the + * output format is flagged with the AVFMT_NOTIMESTAMPS flag, then + * they can be set to AV_NOPTS_VALUE). + * The dts for subsequent packets passed to this function must be strictly + * increasing when compared in their respective timebases (unless the + * output format is flagged with the AVFMT_TS_NONSTRICT, then they + * merely have to be nondecreasing). @ref AVPacket.duration + * "duration") should also be set if known. + * @return < 0 on error, = 0 if OK, 1 if flushed and there is no more data to flush + * + * @see av_interleaved_write_frame() + */ +int av_write_frame(AVFormatContext *s, AVPacket *pkt); + +/** + * Write a packet to an output media file ensuring correct interleaving. + * + * This function will buffer the packets internally as needed to make sure the + * packets in the output file are properly interleaved, usually ordered by + * increasing dts. Callers doing their own interleaving should call + * av_write_frame() instead of this function. + * + * Using this function instead of av_write_frame() can give muxers advance + * knowledge of future packets, improving e.g. the behaviour of the mp4 + * muxer for VFR content in fragmenting mode. + * + * @param s media file handle + * @param pkt The packet containing the data to be written. + *
+ * If the packet is reference-counted, this function will take + * ownership of this reference and unreference it later when it sees + * fit. If the packet is not reference-counted, libavformat will + * make a copy. + * The returned packet will be blank (as if returned from + * av_packet_alloc()), even on error. + *
+ * This parameter can be NULL (at any time, not just at the end), to + * flush the interleaving queues. + *
+ * Packet's @ref AVPacket.stream_index "stream_index" field must be + * set to the index of the corresponding stream in @ref + * AVFormatContext.streams "s->streams". + *
+ * The timestamps (@ref AVPacket.pts "pts", @ref AVPacket.dts "dts") + * must be set to correct values in the stream's timebase (unless the + * output format is flagged with the AVFMT_NOTIMESTAMPS flag, then + * they can be set to AV_NOPTS_VALUE). + * The dts for subsequent packets in one stream must be strictly + * increasing (unless the output format is flagged with the + * AVFMT_TS_NONSTRICT, then they merely have to be nondecreasing). + * @ref AVPacket.duration "duration" should also be set if known. + * + * @return 0 on success, a negative AVERROR on error. + * + * @see av_write_frame(), AVFormatContext.max_interleave_delta + */ +int av_interleaved_write_frame(AVFormatContext *s, AVPacket *pkt); + +/** + * Write an uncoded frame to an output media file. + * + * The frame must be correctly interleaved according to the container + * specification; if not, av_interleaved_write_uncoded_frame() must be used. + * + * See av_interleaved_write_uncoded_frame() for details. + */ +int av_write_uncoded_frame(AVFormatContext *s, int stream_index, + struct AVFrame *frame); + +/** + * Write an uncoded frame to an output media file. + * + * If the muxer supports it, this function makes it possible to write an AVFrame + * structure directly, without encoding it into a packet. + * It is mostly useful for devices and similar special muxers that use raw + * video or PCM data and will not serialize it into a byte stream. + * + * To test whether it is possible to use it with a given muxer and stream, + * use av_write_uncoded_frame_query(). + * + * The caller gives up ownership of the frame and must not access it + * afterwards. + * + * @return >=0 for success, a negative code on error + */ +int av_interleaved_write_uncoded_frame(AVFormatContext *s, int stream_index, + struct AVFrame *frame); + +/** + * Test whether a muxer supports uncoded frame. + * + * @return >=0 if an uncoded frame can be written to that muxer and stream, + * <0 if not + */ +int av_write_uncoded_frame_query(AVFormatContext *s, int stream_index); + +/** + * Write the stream trailer to an output media file and free the + * file private data. + * + * May only be called after a successful call to avformat_write_header. + * + * @param s media file handle + * @return 0 if OK, AVERROR_xxx on error + */ +int av_write_trailer(AVFormatContext *s); + +/** + * Return the output format in the list of registered output formats + * which best matches the provided parameters, or return NULL if + * there is no match. + * + * @param short_name if non-NULL checks if short_name matches with the + * names of the registered formats + * @param filename if non-NULL checks if filename terminates with the + * extensions of the registered formats + * @param mime_type if non-NULL checks if mime_type matches with the + * MIME type of the registered formats + */ +const AVOutputFormat *av_guess_format(const char *short_name, + const char *filename, + const char *mime_type); + +/** + * Guess the codec ID based upon muxer and filename. + */ +enum AVCodecID av_guess_codec(const AVOutputFormat *fmt, const char *short_name, + const char *filename, const char *mime_type, + enum AVMediaType type); + +/** + * Get timing information for the data currently output. + * The exact meaning of "currently output" depends on the format. + * It is mostly relevant for devices that have an internal buffer and/or + * work in real time. + * @param s media file handle + * @param stream stream in the media file + * @param[out] dts DTS of the last packet output for the stream, in stream + * time_base units + * @param[out] wall absolute time when that packet whas output, + * in microsecond + * @retval 0 Success + * @retval AVERROR(ENOSYS) The format does not support it + * + * @note Some formats or devices may not allow to measure dts and wall + * atomically. + */ +int av_get_output_timestamp(struct AVFormatContext *s, int stream, + int64_t *dts, int64_t *wall); + + +/** + * @} + */ + + +/** + * @defgroup lavf_misc Utility functions + * @ingroup libavf + * @{ + * + * Miscellaneous utility functions related to both muxing and demuxing + * (or neither). + */ + +/** + * Send a nice hexadecimal dump of a buffer to the specified file stream. + * + * @param f The file stream pointer where the dump should be sent to. + * @param buf buffer + * @param size buffer size + * + * @see av_hex_dump_log, av_pkt_dump2, av_pkt_dump_log2 + */ +void av_hex_dump(FILE *f, const uint8_t *buf, int size); + +/** + * Send a nice hexadecimal dump of a buffer to the log. + * + * @param avcl A pointer to an arbitrary struct of which the first field is a + * pointer to an AVClass struct. + * @param level The importance level of the message, lower values signifying + * higher importance. + * @param buf buffer + * @param size buffer size + * + * @see av_hex_dump, av_pkt_dump2, av_pkt_dump_log2 + */ +void av_hex_dump_log(void *avcl, int level, const uint8_t *buf, int size); + +/** + * Send a nice dump of a packet to the specified file stream. + * + * @param f The file stream pointer where the dump should be sent to. + * @param pkt packet to dump + * @param dump_payload True if the payload must be displayed, too. + * @param st AVStream that the packet belongs to + */ +void av_pkt_dump2(FILE *f, const AVPacket *pkt, int dump_payload, const AVStream *st); + + +/** + * Send a nice dump of a packet to the log. + * + * @param avcl A pointer to an arbitrary struct of which the first field is a + * pointer to an AVClass struct. + * @param level The importance level of the message, lower values signifying + * higher importance. + * @param pkt packet to dump + * @param dump_payload True if the payload must be displayed, too. + * @param st AVStream that the packet belongs to + */ +void av_pkt_dump_log2(void *avcl, int level, const AVPacket *pkt, int dump_payload, + const AVStream *st); + +/** + * Get the AVCodecID for the given codec tag tag. + * If no codec id is found returns AV_CODEC_ID_NONE. + * + * @param tags list of supported codec_id-codec_tag pairs, as stored + * in AVInputFormat.codec_tag and AVOutputFormat.codec_tag + * @param tag codec tag to match to a codec ID + */ +enum AVCodecID av_codec_get_id(const struct AVCodecTag * const *tags, unsigned int tag); + +/** + * Get the codec tag for the given codec id id. + * If no codec tag is found returns 0. + * + * @param tags list of supported codec_id-codec_tag pairs, as stored + * in AVInputFormat.codec_tag and AVOutputFormat.codec_tag + * @param id codec ID to match to a codec tag + */ +unsigned int av_codec_get_tag(const struct AVCodecTag * const *tags, enum AVCodecID id); + +/** + * Get the codec tag for the given codec id. + * + * @param tags list of supported codec_id - codec_tag pairs, as stored + * in AVInputFormat.codec_tag and AVOutputFormat.codec_tag + * @param id codec id that should be searched for in the list + * @param tag A pointer to the found tag + * @return 0 if id was not found in tags, > 0 if it was found + */ +int av_codec_get_tag2(const struct AVCodecTag * const *tags, enum AVCodecID id, + unsigned int *tag); + +int av_find_default_stream_index(AVFormatContext *s); + +/** + * Get the index for a specific timestamp. + * + * @param st stream that the timestamp belongs to + * @param timestamp timestamp to retrieve the index for + * @param flags if AVSEEK_FLAG_BACKWARD then the returned index will correspond + * to the timestamp which is <= the requested one, if backward + * is 0, then it will be >= + * if AVSEEK_FLAG_ANY seek to any frame, only keyframes otherwise + * @return < 0 if no such timestamp could be found + */ +int av_index_search_timestamp(AVStream *st, int64_t timestamp, int flags); + +/** + * Get the index entry count for the given AVStream. + * + * @param st stream + * @return the number of index entries in the stream + */ +int avformat_index_get_entries_count(const AVStream *st); + +/** + * Get the AVIndexEntry corresponding to the given index. + * + * @param st Stream containing the requested AVIndexEntry. + * @param idx The desired index. + * @return A pointer to the requested AVIndexEntry if it exists, NULL otherwise. + * + * @note The pointer returned by this function is only guaranteed to be valid + * until any function that takes the stream or the parent AVFormatContext + * as input argument is called. + */ +const AVIndexEntry *avformat_index_get_entry(AVStream *st, int idx); + +/** + * Get the AVIndexEntry corresponding to the given timestamp. + * + * @param st Stream containing the requested AVIndexEntry. + * @param wanted_timestamp Timestamp to retrieve the index entry for. + * @param flags If AVSEEK_FLAG_BACKWARD then the returned entry will correspond + * to the timestamp which is <= the requested one, if backward + * is 0, then it will be >= + * if AVSEEK_FLAG_ANY seek to any frame, only keyframes otherwise. + * @return A pointer to the requested AVIndexEntry if it exists, NULL otherwise. + * + * @note The pointer returned by this function is only guaranteed to be valid + * until any function that takes the stream or the parent AVFormatContext + * as input argument is called. + */ +const AVIndexEntry *avformat_index_get_entry_from_timestamp(AVStream *st, + int64_t wanted_timestamp, + int flags); +/** + * Add an index entry into a sorted list. Update the entry if the list + * already contains it. + * + * @param timestamp timestamp in the time base of the given stream + */ +int av_add_index_entry(AVStream *st, int64_t pos, int64_t timestamp, + int size, int distance, int flags); + + +/** + * Split a URL string into components. + * + * The pointers to buffers for storing individual components may be null, + * in order to ignore that component. Buffers for components not found are + * set to empty strings. If the port is not found, it is set to a negative + * value. + * + * @param proto the buffer for the protocol + * @param proto_size the size of the proto buffer + * @param authorization the buffer for the authorization + * @param authorization_size the size of the authorization buffer + * @param hostname the buffer for the host name + * @param hostname_size the size of the hostname buffer + * @param port_ptr a pointer to store the port number in + * @param path the buffer for the path + * @param path_size the size of the path buffer + * @param url the URL to split + */ +void av_url_split(char *proto, int proto_size, + char *authorization, int authorization_size, + char *hostname, int hostname_size, + int *port_ptr, + char *path, int path_size, + const char *url); + + +/** + * Print detailed information about the input or output format, such as + * duration, bitrate, streams, container, programs, metadata, side data, + * codec and time base. + * + * @param ic the context to analyze + * @param index index of the stream to dump information about + * @param url the URL to print, such as source or destination file + * @param is_output Select whether the specified context is an input(0) or output(1) + */ +void av_dump_format(AVFormatContext *ic, + int index, + const char *url, + int is_output); + + +#define AV_FRAME_FILENAME_FLAGS_MULTIPLE 1 ///< Allow multiple %d + +/** + * Return in 'buf' the path with '%d' replaced by a number. + * + * Also handles the '%0nd' format where 'n' is the total number + * of digits and '%%'. + * + * @param buf destination buffer + * @param buf_size destination buffer size + * @param path numbered sequence string + * @param number frame number + * @param flags AV_FRAME_FILENAME_FLAGS_* + * @return 0 if OK, -1 on format error + */ +int av_get_frame_filename2(char *buf, int buf_size, + const char *path, int number, int flags); + +int av_get_frame_filename(char *buf, int buf_size, + const char *path, int number); + +/** + * Check whether filename actually is a numbered sequence generator. + * + * @param filename possible numbered sequence string + * @return 1 if a valid numbered sequence string, 0 otherwise + */ +int av_filename_number_test(const char *filename); + +/** + * Generate an SDP for an RTP session. + * + * Note, this overwrites the id values of AVStreams in the muxer contexts + * for getting unique dynamic payload types. + * + * @param ac array of AVFormatContexts describing the RTP streams. If the + * array is composed by only one context, such context can contain + * multiple AVStreams (one AVStream per RTP stream). Otherwise, + * all the contexts in the array (an AVCodecContext per RTP stream) + * must contain only one AVStream. + * @param n_files number of AVCodecContexts contained in ac + * @param buf buffer where the SDP will be stored (must be allocated by + * the caller) + * @param size the size of the buffer + * @return 0 if OK, AVERROR_xxx on error + */ +int av_sdp_create(AVFormatContext *ac[], int n_files, char *buf, int size); + +/** + * Return a positive value if the given filename has one of the given + * extensions, 0 otherwise. + * + * @param filename file name to check against the given extensions + * @param extensions a comma-separated list of filename extensions + */ +int av_match_ext(const char *filename, const char *extensions); + +/** + * Test if the given container can store a codec. + * + * @param ofmt container to check for compatibility + * @param codec_id codec to potentially store in container + * @param std_compliance standards compliance level, one of FF_COMPLIANCE_* + * + * @return 1 if codec with ID codec_id can be stored in ofmt, 0 if it cannot. + * A negative number if this information is not available. + */ +int avformat_query_codec(const AVOutputFormat *ofmt, enum AVCodecID codec_id, + int std_compliance); + +/** + * @defgroup riff_fourcc RIFF FourCCs + * @{ + * Get the tables mapping RIFF FourCCs to libavcodec AVCodecIDs. The tables are + * meant to be passed to av_codec_get_id()/av_codec_get_tag() as in the + * following code: + * @code + * uint32_t tag = MKTAG('H', '2', '6', '4'); + * const struct AVCodecTag *table[] = { avformat_get_riff_video_tags(), 0 }; + * enum AVCodecID id = av_codec_get_id(table, tag); + * @endcode + */ +/** + * @return the table mapping RIFF FourCCs for video to libavcodec AVCodecID. + */ +const struct AVCodecTag *avformat_get_riff_video_tags(void); +/** + * @return the table mapping RIFF FourCCs for audio to AVCodecID. + */ +const struct AVCodecTag *avformat_get_riff_audio_tags(void); +/** + * @return the table mapping MOV FourCCs for video to libavcodec AVCodecID. + */ +const struct AVCodecTag *avformat_get_mov_video_tags(void); +/** + * @return the table mapping MOV FourCCs for audio to AVCodecID. + */ +const struct AVCodecTag *avformat_get_mov_audio_tags(void); + +/** + * @} + */ + +/** + * Guess the sample aspect ratio of a frame, based on both the stream and the + * frame aspect ratio. + * + * Since the frame aspect ratio is set by the codec but the stream aspect ratio + * is set by the demuxer, these two may not be equal. This function tries to + * return the value that you should use if you would like to display the frame. + * + * Basic logic is to use the stream aspect ratio if it is set to something sane + * otherwise use the frame aspect ratio. This way a container setting, which is + * usually easy to modify can override the coded value in the frames. + * + * @param format the format context which the stream is part of + * @param stream the stream which the frame is part of + * @param frame the frame with the aspect ratio to be determined + * @return the guessed (valid) sample_aspect_ratio, 0/1 if no idea + */ +AVRational av_guess_sample_aspect_ratio(AVFormatContext *format, AVStream *stream, + struct AVFrame *frame); + +/** + * Guess the frame rate, based on both the container and codec information. + * + * @param ctx the format context which the stream is part of + * @param stream the stream which the frame is part of + * @param frame the frame for which the frame rate should be determined, may be NULL + * @return the guessed (valid) frame rate, 0/1 if no idea + */ +AVRational av_guess_frame_rate(AVFormatContext *ctx, AVStream *stream, + struct AVFrame *frame); + +/** + * Check if the stream st contained in s is matched by the stream specifier + * spec. + * + * See the "stream specifiers" chapter in the documentation for the syntax + * of spec. + * + * @return >0 if st is matched by spec; + * 0 if st is not matched by spec; + * AVERROR code if spec is invalid + * + * @note A stream specifier can match several streams in the format. + */ +int avformat_match_stream_specifier(AVFormatContext *s, AVStream *st, + const char *spec); + +int avformat_queue_attached_pictures(AVFormatContext *s); + +enum AVTimebaseSource { + AVFMT_TBCF_AUTO = -1, + AVFMT_TBCF_DECODER, + AVFMT_TBCF_DEMUXER, +#if FF_API_R_FRAME_RATE + AVFMT_TBCF_R_FRAMERATE, +#endif +}; + +/** + * Transfer internal timing information from one stream to another. + * + * This function is useful when doing stream copy. + * + * @param ofmt target output format for ost + * @param ost output stream which needs timings copy and adjustments + * @param ist reference input stream to copy timings from + * @param copy_tb define from where the stream codec timebase needs to be imported + */ +int avformat_transfer_internal_stream_timing_info(const AVOutputFormat *ofmt, + AVStream *ost, const AVStream *ist, + enum AVTimebaseSource copy_tb); + +/** + * Get the internal codec timebase from a stream. + * + * @param st input stream to extract the timebase from + */ +AVRational av_stream_get_codec_timebase(const AVStream *st); + +/** + * @} + */ + +#endif /* AVFORMAT_AVFORMAT_H */ diff --git a/libs/FFmpeg/include/libavformat/avio.h b/libs/FFmpeg/include/libavformat/avio.h new file mode 100644 index 0000000..887a397 --- /dev/null +++ b/libs/FFmpeg/include/libavformat/avio.h @@ -0,0 +1,850 @@ +/* + * copyright (c) 2001 Fabrice Bellard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ +#ifndef AVFORMAT_AVIO_H +#define AVFORMAT_AVIO_H + +/** + * @file + * @ingroup lavf_io + * Buffered I/O operations + */ + +#include +#include + +#include "libavutil/attributes.h" +#include "libavutil/dict.h" +#include "libavutil/log.h" + +#include "libavformat/version_major.h" + +/** + * Seeking works like for a local file. + */ +#define AVIO_SEEKABLE_NORMAL (1 << 0) + +/** + * Seeking by timestamp with avio_seek_time() is possible. + */ +#define AVIO_SEEKABLE_TIME (1 << 1) + +/** + * Callback for checking whether to abort blocking functions. + * AVERROR_EXIT is returned in this case by the interrupted + * function. During blocking operations, callback is called with + * opaque as parameter. If the callback returns 1, the + * blocking operation will be aborted. + * + * No members can be added to this struct without a major bump, if + * new elements have been added after this struct in AVFormatContext + * or AVIOContext. + */ +typedef struct AVIOInterruptCB { + int (*callback)(void*); + void *opaque; +} AVIOInterruptCB; + +/** + * Directory entry types. + */ +enum AVIODirEntryType { + AVIO_ENTRY_UNKNOWN, + AVIO_ENTRY_BLOCK_DEVICE, + AVIO_ENTRY_CHARACTER_DEVICE, + AVIO_ENTRY_DIRECTORY, + AVIO_ENTRY_NAMED_PIPE, + AVIO_ENTRY_SYMBOLIC_LINK, + AVIO_ENTRY_SOCKET, + AVIO_ENTRY_FILE, + AVIO_ENTRY_SERVER, + AVIO_ENTRY_SHARE, + AVIO_ENTRY_WORKGROUP, +}; + +/** + * Describes single entry of the directory. + * + * Only name and type fields are guaranteed be set. + * Rest of fields are protocol or/and platform dependent and might be unknown. + */ +typedef struct AVIODirEntry { + char *name; /**< Filename */ + int type; /**< Type of the entry */ + int utf8; /**< Set to 1 when name is encoded with UTF-8, 0 otherwise. + Name can be encoded with UTF-8 even though 0 is set. */ + int64_t size; /**< File size in bytes, -1 if unknown. */ + int64_t modification_timestamp; /**< Time of last modification in microseconds since unix + epoch, -1 if unknown. */ + int64_t access_timestamp; /**< Time of last access in microseconds since unix epoch, + -1 if unknown. */ + int64_t status_change_timestamp; /**< Time of last status change in microseconds since unix + epoch, -1 if unknown. */ + int64_t user_id; /**< User ID of owner, -1 if unknown. */ + int64_t group_id; /**< Group ID of owner, -1 if unknown. */ + int64_t filemode; /**< Unix file mode, -1 if unknown. */ +} AVIODirEntry; + +#if FF_API_AVIODIRCONTEXT +typedef struct AVIODirContext { + struct URLContext *url_context; +} AVIODirContext; +#else +typedef struct AVIODirContext AVIODirContext; +#endif + +/** + * Different data types that can be returned via the AVIO + * write_data_type callback. + */ +enum AVIODataMarkerType { + /** + * Header data; this needs to be present for the stream to be decodeable. + */ + AVIO_DATA_MARKER_HEADER, + /** + * A point in the output bytestream where a decoder can start decoding + * (i.e. a keyframe). A demuxer/decoder given the data flagged with + * AVIO_DATA_MARKER_HEADER, followed by any AVIO_DATA_MARKER_SYNC_POINT, + * should give decodeable results. + */ + AVIO_DATA_MARKER_SYNC_POINT, + /** + * A point in the output bytestream where a demuxer can start parsing + * (for non self synchronizing bytestream formats). That is, any + * non-keyframe packet start point. + */ + AVIO_DATA_MARKER_BOUNDARY_POINT, + /** + * This is any, unlabelled data. It can either be a muxer not marking + * any positions at all, it can be an actual boundary/sync point + * that the muxer chooses not to mark, or a later part of a packet/fragment + * that is cut into multiple write callbacks due to limited IO buffer size. + */ + AVIO_DATA_MARKER_UNKNOWN, + /** + * Trailer data, which doesn't contain actual content, but only for + * finalizing the output file. + */ + AVIO_DATA_MARKER_TRAILER, + /** + * A point in the output bytestream where the underlying AVIOContext might + * flush the buffer depending on latency or buffering requirements. Typically + * means the end of a packet. + */ + AVIO_DATA_MARKER_FLUSH_POINT, +}; + +/** + * Bytestream IO Context. + * New public fields can be added with minor version bumps. + * Removal, reordering and changes to existing public fields require + * a major version bump. + * sizeof(AVIOContext) must not be used outside libav*. + * + * @note None of the function pointers in AVIOContext should be called + * directly, they should only be set by the client application + * when implementing custom I/O. Normally these are set to the + * function pointers specified in avio_alloc_context() + */ +typedef struct AVIOContext { + /** + * A class for private options. + * + * If this AVIOContext is created by avio_open2(), av_class is set and + * passes the options down to protocols. + * + * If this AVIOContext is manually allocated, then av_class may be set by + * the caller. + * + * warning -- this field can be NULL, be sure to not pass this AVIOContext + * to any av_opt_* functions in that case. + */ + const AVClass *av_class; + + /* + * The following shows the relationship between buffer, buf_ptr, + * buf_ptr_max, buf_end, buf_size, and pos, when reading and when writing + * (since AVIOContext is used for both): + * + ********************************************************************************** + * READING + ********************************************************************************** + * + * | buffer_size | + * |---------------------------------------| + * | | + * + * buffer buf_ptr buf_end + * +---------------+-----------------------+ + * |/ / / / / / / /|/ / / / / / /| | + * read buffer: |/ / consumed / | to be read /| | + * |/ / / / / / / /|/ / / / / / /| | + * +---------------+-----------------------+ + * + * pos + * +-------------------------------------------+-----------------+ + * input file: | | | + * +-------------------------------------------+-----------------+ + * + * + ********************************************************************************** + * WRITING + ********************************************************************************** + * + * | buffer_size | + * |--------------------------------------| + * | | + * + * buf_ptr_max + * buffer (buf_ptr) buf_end + * +-----------------------+--------------+ + * |/ / / / / / / / / / / /| | + * write buffer: | / / to be flushed / / | | + * |/ / / / / / / / / / / /| | + * +-----------------------+--------------+ + * buf_ptr can be in this + * due to a backward seek + * + * pos + * +-------------+----------------------------------------------+ + * output file: | | | + * +-------------+----------------------------------------------+ + * + */ + unsigned char *buffer; /**< Start of the buffer. */ + int buffer_size; /**< Maximum buffer size */ + unsigned char *buf_ptr; /**< Current position in the buffer */ + unsigned char *buf_end; /**< End of the data, may be less than + buffer+buffer_size if the read function returned + less data than requested, e.g. for streams where + no more data has been received yet. */ + void *opaque; /**< A private pointer, passed to the read/write/seek/... + functions. */ + int (*read_packet)(void *opaque, uint8_t *buf, int buf_size); +#if FF_API_AVIO_WRITE_NONCONST + int (*write_packet)(void *opaque, uint8_t *buf, int buf_size); +#else + int (*write_packet)(void *opaque, const uint8_t *buf, int buf_size); +#endif + int64_t (*seek)(void *opaque, int64_t offset, int whence); + int64_t pos; /**< position in the file of the current buffer */ + int eof_reached; /**< true if was unable to read due to error or eof */ + int error; /**< contains the error code or 0 if no error happened */ + int write_flag; /**< true if open for writing */ + int max_packet_size; + int min_packet_size; /**< Try to buffer at least this amount of data + before flushing it. */ + unsigned long checksum; + unsigned char *checksum_ptr; + unsigned long (*update_checksum)(unsigned long checksum, const uint8_t *buf, unsigned int size); + /** + * Pause or resume playback for network streaming protocols - e.g. MMS. + */ + int (*read_pause)(void *opaque, int pause); + /** + * Seek to a given timestamp in stream with the specified stream_index. + * Needed for some network streaming protocols which don't support seeking + * to byte position. + */ + int64_t (*read_seek)(void *opaque, int stream_index, + int64_t timestamp, int flags); + /** + * A combination of AVIO_SEEKABLE_ flags or 0 when the stream is not seekable. + */ + int seekable; + + /** + * avio_read and avio_write should if possible be satisfied directly + * instead of going through a buffer, and avio_seek will always + * call the underlying seek function directly. + */ + int direct; + + /** + * ',' separated list of allowed protocols. + */ + const char *protocol_whitelist; + + /** + * ',' separated list of disallowed protocols. + */ + const char *protocol_blacklist; + + /** + * A callback that is used instead of write_packet. + */ +#if FF_API_AVIO_WRITE_NONCONST + int (*write_data_type)(void *opaque, uint8_t *buf, int buf_size, + enum AVIODataMarkerType type, int64_t time); +#else + int (*write_data_type)(void *opaque, const uint8_t *buf, int buf_size, + enum AVIODataMarkerType type, int64_t time); +#endif + /** + * If set, don't call write_data_type separately for AVIO_DATA_MARKER_BOUNDARY_POINT, + * but ignore them and treat them as AVIO_DATA_MARKER_UNKNOWN (to avoid needlessly + * small chunks of data returned from the callback). + */ + int ignore_boundary_point; + + /** + * Maximum reached position before a backward seek in the write buffer, + * used keeping track of already written data for a later flush. + */ + unsigned char *buf_ptr_max; + + /** + * Read-only statistic of bytes read for this AVIOContext. + */ + int64_t bytes_read; + + /** + * Read-only statistic of bytes written for this AVIOContext. + */ + int64_t bytes_written; +} AVIOContext; + +/** + * Return the name of the protocol that will handle the passed URL. + * + * NULL is returned if no protocol could be found for the given URL. + * + * @return Name of the protocol or NULL. + */ +const char *avio_find_protocol_name(const char *url); + +/** + * Return AVIO_FLAG_* access flags corresponding to the access permissions + * of the resource in url, or a negative value corresponding to an + * AVERROR code in case of failure. The returned access flags are + * masked by the value in flags. + * + * @note This function is intrinsically unsafe, in the sense that the + * checked resource may change its existence or permission status from + * one call to another. Thus you should not trust the returned value, + * unless you are sure that no other processes are accessing the + * checked resource. + */ +int avio_check(const char *url, int flags); + +/** + * Open directory for reading. + * + * @param s directory read context. Pointer to a NULL pointer must be passed. + * @param url directory to be listed. + * @param options A dictionary filled with protocol-private options. On return + * this parameter will be destroyed and replaced with a dictionary + * containing options that were not found. May be NULL. + * @return >=0 on success or negative on error. + */ +int avio_open_dir(AVIODirContext **s, const char *url, AVDictionary **options); + +/** + * Get next directory entry. + * + * Returned entry must be freed with avio_free_directory_entry(). In particular + * it may outlive AVIODirContext. + * + * @param s directory read context. + * @param[out] next next entry or NULL when no more entries. + * @return >=0 on success or negative on error. End of list is not considered an + * error. + */ +int avio_read_dir(AVIODirContext *s, AVIODirEntry **next); + +/** + * Close directory. + * + * @note Entries created using avio_read_dir() are not deleted and must be + * freeded with avio_free_directory_entry(). + * + * @param s directory read context. + * @return >=0 on success or negative on error. + */ +int avio_close_dir(AVIODirContext **s); + +/** + * Free entry allocated by avio_read_dir(). + * + * @param entry entry to be freed. + */ +void avio_free_directory_entry(AVIODirEntry **entry); + +/** + * Allocate and initialize an AVIOContext for buffered I/O. It must be later + * freed with avio_context_free(). + * + * @param buffer Memory block for input/output operations via AVIOContext. + * The buffer must be allocated with av_malloc() and friends. + * It may be freed and replaced with a new buffer by libavformat. + * AVIOContext.buffer holds the buffer currently in use, + * which must be later freed with av_free(). + * @param buffer_size The buffer size is very important for performance. + * For protocols with fixed blocksize it should be set to this blocksize. + * For others a typical size is a cache page, e.g. 4kb. + * @param write_flag Set to 1 if the buffer should be writable, 0 otherwise. + * @param opaque An opaque pointer to user-specific data. + * @param read_packet A function for refilling the buffer, may be NULL. + * For stream protocols, must never return 0 but rather + * a proper AVERROR code. + * @param write_packet A function for writing the buffer contents, may be NULL. + * The function may not change the input buffers content. + * @param seek A function for seeking to specified byte position, may be NULL. + * + * @return Allocated AVIOContext or NULL on failure. + */ +AVIOContext *avio_alloc_context( + unsigned char *buffer, + int buffer_size, + int write_flag, + void *opaque, + int (*read_packet)(void *opaque, uint8_t *buf, int buf_size), +#if FF_API_AVIO_WRITE_NONCONST + int (*write_packet)(void *opaque, uint8_t *buf, int buf_size), +#else + int (*write_packet)(void *opaque, const uint8_t *buf, int buf_size), +#endif + int64_t (*seek)(void *opaque, int64_t offset, int whence)); + +/** + * Free the supplied IO context and everything associated with it. + * + * @param s Double pointer to the IO context. This function will write NULL + * into s. + */ +void avio_context_free(AVIOContext **s); + +void avio_w8(AVIOContext *s, int b); +void avio_write(AVIOContext *s, const unsigned char *buf, int size); +void avio_wl64(AVIOContext *s, uint64_t val); +void avio_wb64(AVIOContext *s, uint64_t val); +void avio_wl32(AVIOContext *s, unsigned int val); +void avio_wb32(AVIOContext *s, unsigned int val); +void avio_wl24(AVIOContext *s, unsigned int val); +void avio_wb24(AVIOContext *s, unsigned int val); +void avio_wl16(AVIOContext *s, unsigned int val); +void avio_wb16(AVIOContext *s, unsigned int val); + +/** + * Write a NULL-terminated string. + * @return number of bytes written. + */ +int avio_put_str(AVIOContext *s, const char *str); + +/** + * Convert an UTF-8 string to UTF-16LE and write it. + * @param s the AVIOContext + * @param str NULL-terminated UTF-8 string + * + * @return number of bytes written. + */ +int avio_put_str16le(AVIOContext *s, const char *str); + +/** + * Convert an UTF-8 string to UTF-16BE and write it. + * @param s the AVIOContext + * @param str NULL-terminated UTF-8 string + * + * @return number of bytes written. + */ +int avio_put_str16be(AVIOContext *s, const char *str); + +/** + * Mark the written bytestream as a specific type. + * + * Zero-length ranges are omitted from the output. + * + * @param s the AVIOContext + * @param time the stream time the current bytestream pos corresponds to + * (in AV_TIME_BASE units), or AV_NOPTS_VALUE if unknown or not + * applicable + * @param type the kind of data written starting at the current pos + */ +void avio_write_marker(AVIOContext *s, int64_t time, enum AVIODataMarkerType type); + +/** + * ORing this as the "whence" parameter to a seek function causes it to + * return the filesize without seeking anywhere. Supporting this is optional. + * If it is not supported then the seek function will return <0. + */ +#define AVSEEK_SIZE 0x10000 + +/** + * Passing this flag as the "whence" parameter to a seek function causes it to + * seek by any means (like reopening and linear reading) or other normally unreasonable + * means that can be extremely slow. + * This may be ignored by the seek code. + */ +#define AVSEEK_FORCE 0x20000 + +/** + * fseek() equivalent for AVIOContext. + * @return new position or AVERROR. + */ +int64_t avio_seek(AVIOContext *s, int64_t offset, int whence); + +/** + * Skip given number of bytes forward + * @return new position or AVERROR. + */ +int64_t avio_skip(AVIOContext *s, int64_t offset); + +/** + * ftell() equivalent for AVIOContext. + * @return position or AVERROR. + */ +static av_always_inline int64_t avio_tell(AVIOContext *s) +{ + return avio_seek(s, 0, SEEK_CUR); +} + +/** + * Get the filesize. + * @return filesize or AVERROR + */ +int64_t avio_size(AVIOContext *s); + +/** + * Similar to feof() but also returns nonzero on read errors. + * @return non zero if and only if at end of file or a read error happened when reading. + */ +int avio_feof(AVIOContext *s); + +/** + * Writes a formatted string to the context taking a va_list. + * @return number of bytes written, < 0 on error. + */ +int avio_vprintf(AVIOContext *s, const char *fmt, va_list ap); + +/** + * Writes a formatted string to the context. + * @return number of bytes written, < 0 on error. + */ +int avio_printf(AVIOContext *s, const char *fmt, ...) av_printf_format(2, 3); + +/** + * Write a NULL terminated array of strings to the context. + * Usually you don't need to use this function directly but its macro wrapper, + * avio_print. + */ +void avio_print_string_array(AVIOContext *s, const char *strings[]); + +/** + * Write strings (const char *) to the context. + * This is a convenience macro around avio_print_string_array and it + * automatically creates the string array from the variable argument list. + * For simple string concatenations this function is more performant than using + * avio_printf since it does not need a temporary buffer. + */ +#define avio_print(s, ...) \ + avio_print_string_array(s, (const char*[]){__VA_ARGS__, NULL}) + +/** + * Force flushing of buffered data. + * + * For write streams, force the buffered data to be immediately written to the output, + * without to wait to fill the internal buffer. + * + * For read streams, discard all currently buffered data, and advance the + * reported file position to that of the underlying stream. This does not + * read new data, and does not perform any seeks. + */ +void avio_flush(AVIOContext *s); + +/** + * Read size bytes from AVIOContext into buf. + * @return number of bytes read or AVERROR + */ +int avio_read(AVIOContext *s, unsigned char *buf, int size); + +/** + * Read size bytes from AVIOContext into buf. Unlike avio_read(), this is allowed + * to read fewer bytes than requested. The missing bytes can be read in the next + * call. This always tries to read at least 1 byte. + * Useful to reduce latency in certain cases. + * @return number of bytes read or AVERROR + */ +int avio_read_partial(AVIOContext *s, unsigned char *buf, int size); + +/** + * @name Functions for reading from AVIOContext + * @{ + * + * @note return 0 if EOF, so you cannot use it if EOF handling is + * necessary + */ +int avio_r8 (AVIOContext *s); +unsigned int avio_rl16(AVIOContext *s); +unsigned int avio_rl24(AVIOContext *s); +unsigned int avio_rl32(AVIOContext *s); +uint64_t avio_rl64(AVIOContext *s); +unsigned int avio_rb16(AVIOContext *s); +unsigned int avio_rb24(AVIOContext *s); +unsigned int avio_rb32(AVIOContext *s); +uint64_t avio_rb64(AVIOContext *s); +/** + * @} + */ + +/** + * Read a string from pb into buf. The reading will terminate when either + * a NULL character was encountered, maxlen bytes have been read, or nothing + * more can be read from pb. The result is guaranteed to be NULL-terminated, it + * will be truncated if buf is too small. + * Note that the string is not interpreted or validated in any way, it + * might get truncated in the middle of a sequence for multi-byte encodings. + * + * @return number of bytes read (is always <= maxlen). + * If reading ends on EOF or error, the return value will be one more than + * bytes actually read. + */ +int avio_get_str(AVIOContext *pb, int maxlen, char *buf, int buflen); + +/** + * Read a UTF-16 string from pb and convert it to UTF-8. + * The reading will terminate when either a null or invalid character was + * encountered or maxlen bytes have been read. + * @return number of bytes read (is always <= maxlen) + */ +int avio_get_str16le(AVIOContext *pb, int maxlen, char *buf, int buflen); +int avio_get_str16be(AVIOContext *pb, int maxlen, char *buf, int buflen); + + +/** + * @name URL open modes + * The flags argument to avio_open must be one of the following + * constants, optionally ORed with other flags. + * @{ + */ +#define AVIO_FLAG_READ 1 /**< read-only */ +#define AVIO_FLAG_WRITE 2 /**< write-only */ +#define AVIO_FLAG_READ_WRITE (AVIO_FLAG_READ|AVIO_FLAG_WRITE) /**< read-write pseudo flag */ +/** + * @} + */ + +/** + * Use non-blocking mode. + * If this flag is set, operations on the context will return + * AVERROR(EAGAIN) if they can not be performed immediately. + * If this flag is not set, operations on the context will never return + * AVERROR(EAGAIN). + * Note that this flag does not affect the opening/connecting of the + * context. Connecting a protocol will always block if necessary (e.g. on + * network protocols) but never hang (e.g. on busy devices). + * Warning: non-blocking protocols is work-in-progress; this flag may be + * silently ignored. + */ +#define AVIO_FLAG_NONBLOCK 8 + +/** + * Use direct mode. + * avio_read and avio_write should if possible be satisfied directly + * instead of going through a buffer, and avio_seek will always + * call the underlying seek function directly. + */ +#define AVIO_FLAG_DIRECT 0x8000 + +/** + * Create and initialize a AVIOContext for accessing the + * resource indicated by url. + * @note When the resource indicated by url has been opened in + * read+write mode, the AVIOContext can be used only for writing. + * + * @param s Used to return the pointer to the created AVIOContext. + * In case of failure the pointed to value is set to NULL. + * @param url resource to access + * @param flags flags which control how the resource indicated by url + * is to be opened + * @return >= 0 in case of success, a negative value corresponding to an + * AVERROR code in case of failure + */ +int avio_open(AVIOContext **s, const char *url, int flags); + +/** + * Create and initialize a AVIOContext for accessing the + * resource indicated by url. + * @note When the resource indicated by url has been opened in + * read+write mode, the AVIOContext can be used only for writing. + * + * @param s Used to return the pointer to the created AVIOContext. + * In case of failure the pointed to value is set to NULL. + * @param url resource to access + * @param flags flags which control how the resource indicated by url + * is to be opened + * @param int_cb an interrupt callback to be used at the protocols level + * @param options A dictionary filled with protocol-private options. On return + * this parameter will be destroyed and replaced with a dict containing options + * that were not found. May be NULL. + * @return >= 0 in case of success, a negative value corresponding to an + * AVERROR code in case of failure + */ +int avio_open2(AVIOContext **s, const char *url, int flags, + const AVIOInterruptCB *int_cb, AVDictionary **options); + +/** + * Close the resource accessed by the AVIOContext s and free it. + * This function can only be used if s was opened by avio_open(). + * + * The internal buffer is automatically flushed before closing the + * resource. + * + * @return 0 on success, an AVERROR < 0 on error. + * @see avio_closep + */ +int avio_close(AVIOContext *s); + +/** + * Close the resource accessed by the AVIOContext *s, free it + * and set the pointer pointing to it to NULL. + * This function can only be used if s was opened by avio_open(). + * + * The internal buffer is automatically flushed before closing the + * resource. + * + * @return 0 on success, an AVERROR < 0 on error. + * @see avio_close + */ +int avio_closep(AVIOContext **s); + + +/** + * Open a write only memory stream. + * + * @param s new IO context + * @return zero if no error. + */ +int avio_open_dyn_buf(AVIOContext **s); + +/** + * Return the written size and a pointer to the buffer. + * The AVIOContext stream is left intact. + * The buffer must NOT be freed. + * No padding is added to the buffer. + * + * @param s IO context + * @param pbuffer pointer to a byte buffer + * @return the length of the byte buffer + */ +int avio_get_dyn_buf(AVIOContext *s, uint8_t **pbuffer); + +/** + * Return the written size and a pointer to the buffer. The buffer + * must be freed with av_free(). + * Padding of AV_INPUT_BUFFER_PADDING_SIZE is added to the buffer. + * + * @param s IO context + * @param pbuffer pointer to a byte buffer + * @return the length of the byte buffer + */ +int avio_close_dyn_buf(AVIOContext *s, uint8_t **pbuffer); + +/** + * Iterate through names of available protocols. + * + * @param opaque A private pointer representing current protocol. + * It must be a pointer to NULL on first iteration and will + * be updated by successive calls to avio_enum_protocols. + * @param output If set to 1, iterate over output protocols, + * otherwise over input protocols. + * + * @return A static string containing the name of current protocol or NULL + */ +const char *avio_enum_protocols(void **opaque, int output); + +/** + * Get AVClass by names of available protocols. + * + * @return A AVClass of input protocol name or NULL + */ +const AVClass *avio_protocol_get_class(const char *name); + +/** + * Pause and resume playing - only meaningful if using a network streaming + * protocol (e.g. MMS). + * + * @param h IO context from which to call the read_pause function pointer + * @param pause 1 for pause, 0 for resume + */ +int avio_pause(AVIOContext *h, int pause); + +/** + * Seek to a given timestamp relative to some component stream. + * Only meaningful if using a network streaming protocol (e.g. MMS.). + * + * @param h IO context from which to call the seek function pointers + * @param stream_index The stream index that the timestamp is relative to. + * If stream_index is (-1) the timestamp should be in AV_TIME_BASE + * units from the beginning of the presentation. + * If a stream_index >= 0 is used and the protocol does not support + * seeking based on component streams, the call will fail. + * @param timestamp timestamp in AVStream.time_base units + * or if there is no stream specified then in AV_TIME_BASE units. + * @param flags Optional combination of AVSEEK_FLAG_BACKWARD, AVSEEK_FLAG_BYTE + * and AVSEEK_FLAG_ANY. The protocol may silently ignore + * AVSEEK_FLAG_BACKWARD and AVSEEK_FLAG_ANY, but AVSEEK_FLAG_BYTE will + * fail if used and not supported. + * @return >= 0 on success + * @see AVInputFormat::read_seek + */ +int64_t avio_seek_time(AVIOContext *h, int stream_index, + int64_t timestamp, int flags); + +/* Avoid a warning. The header can not be included because it breaks c++. */ +struct AVBPrint; + +/** + * Read contents of h into print buffer, up to max_size bytes, or up to EOF. + * + * @return 0 for success (max_size bytes read or EOF reached), negative error + * code otherwise + */ +int avio_read_to_bprint(AVIOContext *h, struct AVBPrint *pb, size_t max_size); + +/** + * Accept and allocate a client context on a server context. + * @param s the server context + * @param c the client context, must be unallocated + * @return >= 0 on success or a negative value corresponding + * to an AVERROR on failure + */ +int avio_accept(AVIOContext *s, AVIOContext **c); + +/** + * Perform one step of the protocol handshake to accept a new client. + * This function must be called on a client returned by avio_accept() before + * using it as a read/write context. + * It is separate from avio_accept() because it may block. + * A step of the handshake is defined by places where the application may + * decide to change the proceedings. + * For example, on a protocol with a request header and a reply header, each + * one can constitute a step because the application may use the parameters + * from the request to change parameters in the reply; or each individual + * chunk of the request can constitute a step. + * If the handshake is already finished, avio_handshake() does nothing and + * returns 0 immediately. + * + * @param c the client context to perform the handshake on + * @return 0 on a complete and successful handshake + * > 0 if the handshake progressed, but is not complete + * < 0 for an AVERROR code + */ +int avio_handshake(AVIOContext *c); +#endif /* AVFORMAT_AVIO_H */ diff --git a/libs/FFmpeg/include/libavformat/version.h b/libs/FFmpeg/include/libavformat/version.h new file mode 100644 index 0000000..2a28a3b --- /dev/null +++ b/libs/FFmpeg/include/libavformat/version.h @@ -0,0 +1,47 @@ +/* + * Version macros. + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVFORMAT_VERSION_H +#define AVFORMAT_VERSION_H + +/** + * @file + * @ingroup libavf + * Libavformat version macros + */ + +#include "libavutil/version.h" + +#include "version_major.h" + +#define LIBAVFORMAT_VERSION_MINOR 17 +#define LIBAVFORMAT_VERSION_MICRO 100 + +#define LIBAVFORMAT_VERSION_INT AV_VERSION_INT(LIBAVFORMAT_VERSION_MAJOR, \ + LIBAVFORMAT_VERSION_MINOR, \ + LIBAVFORMAT_VERSION_MICRO) +#define LIBAVFORMAT_VERSION AV_VERSION(LIBAVFORMAT_VERSION_MAJOR, \ + LIBAVFORMAT_VERSION_MINOR, \ + LIBAVFORMAT_VERSION_MICRO) +#define LIBAVFORMAT_BUILD LIBAVFORMAT_VERSION_INT + +#define LIBAVFORMAT_IDENT "Lavf" AV_STRINGIFY(LIBAVFORMAT_VERSION) + +#endif /* AVFORMAT_VERSION_H */ diff --git a/libs/FFmpeg/include/libavformat/version_major.h b/libs/FFmpeg/include/libavformat/version_major.h new file mode 100644 index 0000000..224fdac --- /dev/null +++ b/libs/FFmpeg/include/libavformat/version_major.h @@ -0,0 +1,56 @@ +/* + * Version macros. + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVFORMAT_VERSION_MAJOR_H +#define AVFORMAT_VERSION_MAJOR_H + +/** + * @file + * @ingroup libavf + * Libavformat version macros + */ + +// Major bumping may affect Ticket5467, 5421, 5451(compatibility with Chromium) +// Also please add any ticket numbers that you believe might be affected here +#define LIBAVFORMAT_VERSION_MAJOR 60 + +/** + * FF_API_* defines may be placed below to indicate public API that will be + * dropped at a future version bump. The defines themselves are not part of + * the public API and may change, break or disappear at any time. + * + * @note, when bumping the major version it is recommended to manually + * disable each FF_API_* in its own commit instead of disabling them all + * at once through the bump. This improves the git bisect-ability of the change. + * + */ +#define FF_API_COMPUTE_PKT_FIELDS2 (LIBAVFORMAT_VERSION_MAJOR < 61) +#define FF_API_GET_END_PTS (LIBAVFORMAT_VERSION_MAJOR < 61) +#define FF_API_AVIODIRCONTEXT (LIBAVFORMAT_VERSION_MAJOR < 61) +#define FF_API_AVFORMAT_IO_CLOSE (LIBAVFORMAT_VERSION_MAJOR < 61) +#define FF_API_AVIO_WRITE_NONCONST (LIBAVFORMAT_VERSION_MAJOR < 61) +#define FF_API_LAVF_SHORTEST (LIBAVFORMAT_VERSION_MAJOR < 61) +#define FF_API_ALLOW_FLUSH (LIBAVFORMAT_VERSION_MAJOR < 61) +#define FF_API_AVSTREAM_SIDE_DATA (LIBAVFORMAT_VERSION_MAJOR < 61) + + +#define FF_API_R_FRAME_RATE 1 + +#endif /* AVFORMAT_VERSION_MAJOR_H */ diff --git a/libs/FFmpeg/include/libavutil/adler32.h b/libs/FFmpeg/include/libavutil/adler32.h new file mode 100644 index 0000000..232d07f --- /dev/null +++ b/libs/FFmpeg/include/libavutil/adler32.h @@ -0,0 +1,63 @@ +/* + * copyright (c) 2006 Mans Rullgard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_adler32 + * Public header for Adler-32 hash function implementation. + */ + +#ifndef AVUTIL_ADLER32_H +#define AVUTIL_ADLER32_H + +#include +#include +#include "attributes.h" + +/** + * @defgroup lavu_adler32 Adler-32 + * @ingroup lavu_hash + * Adler-32 hash function implementation. + * + * @{ + */ + +typedef uint32_t AVAdler; + +/** + * Calculate the Adler32 checksum of a buffer. + * + * Passing the return value to a subsequent av_adler32_update() call + * allows the checksum of multiple buffers to be calculated as though + * they were concatenated. + * + * @param adler initial checksum value + * @param buf pointer to input buffer + * @param len size of input buffer + * @return updated checksum + */ +AVAdler av_adler32_update(AVAdler adler, const uint8_t *buf, + size_t len) av_pure; + +/** + * @} + */ + +#endif /* AVUTIL_ADLER32_H */ diff --git a/libs/FFmpeg/include/libavutil/aes.h b/libs/FFmpeg/include/libavutil/aes.h new file mode 100644 index 0000000..4e73473 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/aes.h @@ -0,0 +1,69 @@ +/* + * copyright (c) 2007 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_AES_H +#define AVUTIL_AES_H + +#include + +#include "attributes.h" + +/** + * @defgroup lavu_aes AES + * @ingroup lavu_crypto + * @{ + */ + +extern const int av_aes_size; + +struct AVAES; + +/** + * Allocate an AVAES context. + */ +struct AVAES *av_aes_alloc(void); + +/** + * Initialize an AVAES context. + * + * @param a The AVAES context + * @param key Pointer to the key + * @param key_bits 128, 192 or 256 + * @param decrypt 0 for encryption, 1 for decryption + */ +int av_aes_init(struct AVAES *a, const uint8_t *key, int key_bits, int decrypt); + +/** + * Encrypt or decrypt a buffer using a previously initialized context. + * + * @param a The AVAES context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 16 byte blocks + * @param iv initialization vector for CBC mode, if NULL then ECB will be used + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_aes_crypt(struct AVAES *a, uint8_t *dst, const uint8_t *src, int count, uint8_t *iv, int decrypt); + +/** + * @} + */ + +#endif /* AVUTIL_AES_H */ diff --git a/libs/FFmpeg/include/libavutil/aes_ctr.h b/libs/FFmpeg/include/libavutil/aes_ctr.h new file mode 100644 index 0000000..d98c071 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/aes_ctr.h @@ -0,0 +1,99 @@ +/* + * AES-CTR cipher + * Copyright (c) 2015 Eran Kornblau + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_AES_CTR_H +#define AVUTIL_AES_CTR_H + +/** + * @defgroup lavu_aes_ctr AES-CTR + * @ingroup lavu_crypto + * @{ + */ + +#include + +#include "attributes.h" + +#define AES_CTR_KEY_SIZE (16) +#define AES_CTR_IV_SIZE (8) + +struct AVAESCTR; + +/** + * Allocate an AVAESCTR context. + */ +struct AVAESCTR *av_aes_ctr_alloc(void); + +/** + * Initialize an AVAESCTR context. + * + * @param a The AVAESCTR context to initialize + * @param key encryption key, must have a length of AES_CTR_KEY_SIZE + */ +int av_aes_ctr_init(struct AVAESCTR *a, const uint8_t *key); + +/** + * Release an AVAESCTR context. + * + * @param a The AVAESCTR context + */ +void av_aes_ctr_free(struct AVAESCTR *a); + +/** + * Process a buffer using a previously initialized context. + * + * @param a The AVAESCTR context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param size the size of src and dst + */ +void av_aes_ctr_crypt(struct AVAESCTR *a, uint8_t *dst, const uint8_t *src, int size); + +/** + * Get the current iv + */ +const uint8_t* av_aes_ctr_get_iv(struct AVAESCTR *a); + +/** + * Generate a random iv + */ +void av_aes_ctr_set_random_iv(struct AVAESCTR *a); + +/** + * Forcefully change the 8-byte iv + */ +void av_aes_ctr_set_iv(struct AVAESCTR *a, const uint8_t* iv); + +/** + * Forcefully change the "full" 16-byte iv, including the counter + */ +void av_aes_ctr_set_full_iv(struct AVAESCTR *a, const uint8_t* iv); + +/** + * Increment the top 64 bit of the iv (performed after each frame) + */ +void av_aes_ctr_increment_iv(struct AVAESCTR *a); + +/** + * @} + */ + +#endif /* AVUTIL_AES_CTR_H */ diff --git a/libs/FFmpeg/include/libavutil/ambient_viewing_environment.h b/libs/FFmpeg/include/libavutil/ambient_viewing_environment.h new file mode 100644 index 0000000..e5e4ac2 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/ambient_viewing_environment.h @@ -0,0 +1,72 @@ +/* + * Copyright (c) 2023 Jan Ekström + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_AMBIENT_VIEWING_ENVIRONMENT_H +#define AVUTIL_AMBIENT_VIEWING_ENVIRONMENT_H + +#include +#include "frame.h" +#include "rational.h" + +/** + * Ambient viewing environment metadata as defined by H.274. The values are + * saved in AVRationals so that they keep their exactness, while allowing for + * easy access to a double value with f.ex. av_q2d. + * + * @note sizeof(AVAmbientViewingEnvironment) is not part of the public ABI, and + * it must be allocated using av_ambient_viewing_environment_alloc. + */ +typedef struct AVAmbientViewingEnvironment { + /** + * Environmental illuminance of the ambient viewing environment in lux. + */ + AVRational ambient_illuminance; + + /** + * Normalized x chromaticity coordinate of the environmental ambient light + * in the nominal viewing environment according to the CIE 1931 definition + * of x and y as specified in ISO/CIE 11664-1. + */ + AVRational ambient_light_x; + + /** + * Normalized y chromaticity coordinate of the environmental ambient light + * in the nominal viewing environment according to the CIE 1931 definition + * of x and y as specified in ISO/CIE 11664-1. + */ + AVRational ambient_light_y; +} AVAmbientViewingEnvironment; + +/** + * Allocate an AVAmbientViewingEnvironment structure. + * + * @return the newly allocated struct or NULL on failure + */ +AVAmbientViewingEnvironment *av_ambient_viewing_environment_alloc(size_t *size); + +/** + * Allocate and add an AVAmbientViewingEnvironment structure to an existing + * AVFrame as side data. + * + * @return the newly allocated struct, or NULL on failure + */ +AVAmbientViewingEnvironment *av_ambient_viewing_environment_create_side_data(AVFrame *frame); + +#endif /* AVUTIL_AMBIENT_VIEWING_ENVIRONMENT_H */ diff --git a/libs/FFmpeg/include/libavutil/attributes.h b/libs/FFmpeg/include/libavutil/attributes.h new file mode 100644 index 0000000..04c615c --- /dev/null +++ b/libs/FFmpeg/include/libavutil/attributes.h @@ -0,0 +1,173 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * Macro definitions for various function/variable attributes + */ + +#ifndef AVUTIL_ATTRIBUTES_H +#define AVUTIL_ATTRIBUTES_H + +#ifdef __GNUC__ +# define AV_GCC_VERSION_AT_LEAST(x,y) (__GNUC__ > (x) || __GNUC__ == (x) && __GNUC_MINOR__ >= (y)) +# define AV_GCC_VERSION_AT_MOST(x,y) (__GNUC__ < (x) || __GNUC__ == (x) && __GNUC_MINOR__ <= (y)) +#else +# define AV_GCC_VERSION_AT_LEAST(x,y) 0 +# define AV_GCC_VERSION_AT_MOST(x,y) 0 +#endif + +#ifdef __has_builtin +# define AV_HAS_BUILTIN(x) __has_builtin(x) +#else +# define AV_HAS_BUILTIN(x) 0 +#endif + +#ifndef av_always_inline +#if AV_GCC_VERSION_AT_LEAST(3,1) +# define av_always_inline __attribute__((always_inline)) inline +#elif defined(_MSC_VER) +# define av_always_inline __forceinline +#else +# define av_always_inline inline +#endif +#endif + +#ifndef av_extern_inline +#if defined(__ICL) && __ICL >= 1210 || defined(__GNUC_STDC_INLINE__) +# define av_extern_inline extern inline +#else +# define av_extern_inline inline +#endif +#endif + +#if AV_GCC_VERSION_AT_LEAST(3,4) +# define av_warn_unused_result __attribute__((warn_unused_result)) +#else +# define av_warn_unused_result +#endif + +#if AV_GCC_VERSION_AT_LEAST(3,1) +# define av_noinline __attribute__((noinline)) +#elif defined(_MSC_VER) +# define av_noinline __declspec(noinline) +#else +# define av_noinline +#endif + +#if AV_GCC_VERSION_AT_LEAST(3,1) || defined(__clang__) +# define av_pure __attribute__((pure)) +#else +# define av_pure +#endif + +#if AV_GCC_VERSION_AT_LEAST(2,6) || defined(__clang__) +# define av_const __attribute__((const)) +#else +# define av_const +#endif + +#if AV_GCC_VERSION_AT_LEAST(4,3) || defined(__clang__) +# define av_cold __attribute__((cold)) +#else +# define av_cold +#endif + +#if AV_GCC_VERSION_AT_LEAST(4,1) && !defined(__llvm__) +# define av_flatten __attribute__((flatten)) +#else +# define av_flatten +#endif + +#if AV_GCC_VERSION_AT_LEAST(3,1) +# define attribute_deprecated __attribute__((deprecated)) +#elif defined(_MSC_VER) +# define attribute_deprecated __declspec(deprecated) +#else +# define attribute_deprecated +#endif + +/** + * Disable warnings about deprecated features + * This is useful for sections of code kept for backward compatibility and + * scheduled for removal. + */ +#ifndef AV_NOWARN_DEPRECATED +#if AV_GCC_VERSION_AT_LEAST(4,6) || defined(__clang__) +# define AV_NOWARN_DEPRECATED(code) \ + _Pragma("GCC diagnostic push") \ + _Pragma("GCC diagnostic ignored \"-Wdeprecated-declarations\"") \ + code \ + _Pragma("GCC diagnostic pop") +#elif defined(_MSC_VER) +# define AV_NOWARN_DEPRECATED(code) \ + __pragma(warning(push)) \ + __pragma(warning(disable : 4996)) \ + code; \ + __pragma(warning(pop)) +#else +# define AV_NOWARN_DEPRECATED(code) code +#endif +#endif + +#if defined(__GNUC__) || defined(__clang__) +# define av_unused __attribute__((unused)) +#else +# define av_unused +#endif + +/** + * Mark a variable as used and prevent the compiler from optimizing it + * away. This is useful for variables accessed only from inline + * assembler without the compiler being aware. + */ +#if AV_GCC_VERSION_AT_LEAST(3,1) || defined(__clang__) +# define av_used __attribute__((used)) +#else +# define av_used +#endif + +#if AV_GCC_VERSION_AT_LEAST(3,3) || defined(__clang__) +# define av_alias __attribute__((may_alias)) +#else +# define av_alias +#endif + +#if (defined(__GNUC__) || defined(__clang__)) && !defined(__INTEL_COMPILER) +# define av_uninit(x) x=x +#else +# define av_uninit(x) x +#endif + +#if defined(__GNUC__) || defined(__clang__) +# define av_builtin_constant_p __builtin_constant_p +# define av_printf_format(fmtpos, attrpos) __attribute__((__format__(__printf__, fmtpos, attrpos))) +#else +# define av_builtin_constant_p(x) 0 +# define av_printf_format(fmtpos, attrpos) +#endif + +#if AV_GCC_VERSION_AT_LEAST(2,5) || defined(__clang__) +# define av_noreturn __attribute__((noreturn)) +#else +# define av_noreturn +#endif + +#endif /* AVUTIL_ATTRIBUTES_H */ diff --git a/libs/FFmpeg/include/libavutil/audio_fifo.h b/libs/FFmpeg/include/libavutil/audio_fifo.h new file mode 100644 index 0000000..fa5f59a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/audio_fifo.h @@ -0,0 +1,187 @@ +/* + * Audio FIFO + * Copyright (c) 2012 Justin Ruggles + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * Audio FIFO Buffer + */ + +#ifndef AVUTIL_AUDIO_FIFO_H +#define AVUTIL_AUDIO_FIFO_H + +#include "attributes.h" +#include "samplefmt.h" + +/** + * @addtogroup lavu_audio + * @{ + * + * @defgroup lavu_audiofifo Audio FIFO Buffer + * @{ + */ + +/** + * Context for an Audio FIFO Buffer. + * + * - Operates at the sample level rather than the byte level. + * - Supports multiple channels with either planar or packed sample format. + * - Automatic reallocation when writing to a full buffer. + */ +typedef struct AVAudioFifo AVAudioFifo; + +/** + * Free an AVAudioFifo. + * + * @param af AVAudioFifo to free + */ +void av_audio_fifo_free(AVAudioFifo *af); + +/** + * Allocate an AVAudioFifo. + * + * @param sample_fmt sample format + * @param channels number of channels + * @param nb_samples initial allocation size, in samples + * @return newly allocated AVAudioFifo, or NULL on error + */ +AVAudioFifo *av_audio_fifo_alloc(enum AVSampleFormat sample_fmt, int channels, + int nb_samples); + +/** + * Reallocate an AVAudioFifo. + * + * @param af AVAudioFifo to reallocate + * @param nb_samples new allocation size, in samples + * @return 0 if OK, or negative AVERROR code on failure + */ +av_warn_unused_result +int av_audio_fifo_realloc(AVAudioFifo *af, int nb_samples); + +/** + * Write data to an AVAudioFifo. + * + * The AVAudioFifo will be reallocated automatically if the available space + * is less than nb_samples. + * + * @see enum AVSampleFormat + * The documentation for AVSampleFormat describes the data layout. + * + * @param af AVAudioFifo to write to + * @param data audio data plane pointers + * @param nb_samples number of samples to write + * @return number of samples actually written, or negative AVERROR + * code on failure. If successful, the number of samples + * actually written will always be nb_samples. + */ +int av_audio_fifo_write(AVAudioFifo *af, void * const *data, int nb_samples); + +/** + * Peek data from an AVAudioFifo. + * + * @see enum AVSampleFormat + * The documentation for AVSampleFormat describes the data layout. + * + * @param af AVAudioFifo to read from + * @param data audio data plane pointers + * @param nb_samples number of samples to peek + * @return number of samples actually peek, or negative AVERROR code + * on failure. The number of samples actually peek will not + * be greater than nb_samples, and will only be less than + * nb_samples if av_audio_fifo_size is less than nb_samples. + */ +int av_audio_fifo_peek(const AVAudioFifo *af, void * const *data, int nb_samples); + +/** + * Peek data from an AVAudioFifo. + * + * @see enum AVSampleFormat + * The documentation for AVSampleFormat describes the data layout. + * + * @param af AVAudioFifo to read from + * @param data audio data plane pointers + * @param nb_samples number of samples to peek + * @param offset offset from current read position + * @return number of samples actually peek, or negative AVERROR code + * on failure. The number of samples actually peek will not + * be greater than nb_samples, and will only be less than + * nb_samples if av_audio_fifo_size is less than nb_samples. + */ +int av_audio_fifo_peek_at(const AVAudioFifo *af, void * const *data, + int nb_samples, int offset); + +/** + * Read data from an AVAudioFifo. + * + * @see enum AVSampleFormat + * The documentation for AVSampleFormat describes the data layout. + * + * @param af AVAudioFifo to read from + * @param data audio data plane pointers + * @param nb_samples number of samples to read + * @return number of samples actually read, or negative AVERROR code + * on failure. The number of samples actually read will not + * be greater than nb_samples, and will only be less than + * nb_samples if av_audio_fifo_size is less than nb_samples. + */ +int av_audio_fifo_read(AVAudioFifo *af, void * const *data, int nb_samples); + +/** + * Drain data from an AVAudioFifo. + * + * Removes the data without reading it. + * + * @param af AVAudioFifo to drain + * @param nb_samples number of samples to drain + * @return 0 if OK, or negative AVERROR code on failure + */ +int av_audio_fifo_drain(AVAudioFifo *af, int nb_samples); + +/** + * Reset the AVAudioFifo buffer. + * + * This empties all data in the buffer. + * + * @param af AVAudioFifo to reset + */ +void av_audio_fifo_reset(AVAudioFifo *af); + +/** + * Get the current number of samples in the AVAudioFifo available for reading. + * + * @param af the AVAudioFifo to query + * @return number of samples available for reading + */ +int av_audio_fifo_size(AVAudioFifo *af); + +/** + * Get the current number of samples in the AVAudioFifo available for writing. + * + * @param af the AVAudioFifo to query + * @return number of samples available for writing + */ +int av_audio_fifo_space(AVAudioFifo *af); + +/** + * @} + * @} + */ + +#endif /* AVUTIL_AUDIO_FIFO_H */ diff --git a/libs/FFmpeg/include/libavutil/avassert.h b/libs/FFmpeg/include/libavutil/avassert.h new file mode 100644 index 0000000..1895fb7 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/avassert.h @@ -0,0 +1,78 @@ +/* + * copyright (c) 2010 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * simple assert() macros that are a bit more flexible than ISO C assert(). + * @author Michael Niedermayer + */ + +#ifndef AVUTIL_AVASSERT_H +#define AVUTIL_AVASSERT_H + +#include +#ifdef HAVE_AV_CONFIG_H +# include "config.h" +#endif +#include "log.h" +#include "macros.h" + +/** + * assert() equivalent, that is always enabled. + */ +#define av_assert0(cond) do { \ + if (!(cond)) { \ + av_log(NULL, AV_LOG_PANIC, "Assertion %s failed at %s:%d\n", \ + AV_STRINGIFY(cond), __FILE__, __LINE__); \ + abort(); \ + } \ +} while (0) + + +/** + * assert() equivalent, that does not lie in speed critical code. + * These asserts() thus can be enabled without fearing speed loss. + */ +#if defined(ASSERT_LEVEL) && ASSERT_LEVEL > 0 +#define av_assert1(cond) av_assert0(cond) +#else +#define av_assert1(cond) ((void)0) +#endif + + +/** + * assert() equivalent, that does lie in speed critical code. + */ +#if defined(ASSERT_LEVEL) && ASSERT_LEVEL > 1 +#define av_assert2(cond) av_assert0(cond) +#define av_assert2_fpu() av_assert0_fpu() +#else +#define av_assert2(cond) ((void)0) +#define av_assert2_fpu() ((void)0) +#endif + +/** + * Assert that floating point operations can be executed. + * + * This will av_assert0() that the cpu is not in MMX state on X86 + */ +void av_assert0_fpu(void); + +#endif /* AVUTIL_AVASSERT_H */ diff --git a/libs/FFmpeg/include/libavutil/avconfig.h b/libs/FFmpeg/include/libavutil/avconfig.h new file mode 100644 index 0000000..c289fbb --- /dev/null +++ b/libs/FFmpeg/include/libavutil/avconfig.h @@ -0,0 +1,6 @@ +/* Generated by ffmpeg configure */ +#ifndef AVUTIL_AVCONFIG_H +#define AVUTIL_AVCONFIG_H +#define AV_HAVE_BIGENDIAN 0 +#define AV_HAVE_FAST_UNALIGNED 1 +#endif /* AVUTIL_AVCONFIG_H */ diff --git a/libs/FFmpeg/include/libavutil/avstring.h b/libs/FFmpeg/include/libavutil/avstring.h new file mode 100644 index 0000000..fc09534 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/avstring.h @@ -0,0 +1,428 @@ +/* + * Copyright (c) 2007 Mans Rullgard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_AVSTRING_H +#define AVUTIL_AVSTRING_H + +#include +#include +#include "attributes.h" + +/** + * @addtogroup lavu_string + * @{ + */ + +/** + * Return non-zero if pfx is a prefix of str. If it is, *ptr is set to + * the address of the first character in str after the prefix. + * + * @param str input string + * @param pfx prefix to test + * @param ptr updated if the prefix is matched inside str + * @return non-zero if the prefix matches, zero otherwise + */ +int av_strstart(const char *str, const char *pfx, const char **ptr); + +/** + * Return non-zero if pfx is a prefix of str independent of case. If + * it is, *ptr is set to the address of the first character in str + * after the prefix. + * + * @param str input string + * @param pfx prefix to test + * @param ptr updated if the prefix is matched inside str + * @return non-zero if the prefix matches, zero otherwise + */ +int av_stristart(const char *str, const char *pfx, const char **ptr); + +/** + * Locate the first case-independent occurrence in the string haystack + * of the string needle. A zero-length string needle is considered to + * match at the start of haystack. + * + * This function is a case-insensitive version of the standard strstr(). + * + * @param haystack string to search in + * @param needle string to search for + * @return pointer to the located match within haystack + * or a null pointer if no match + */ +char *av_stristr(const char *haystack, const char *needle); + +/** + * Locate the first occurrence of the string needle in the string haystack + * where not more than hay_length characters are searched. A zero-length + * string needle is considered to match at the start of haystack. + * + * This function is a length-limited version of the standard strstr(). + * + * @param haystack string to search in + * @param needle string to search for + * @param hay_length length of string to search in + * @return pointer to the located match within haystack + * or a null pointer if no match + */ +char *av_strnstr(const char *haystack, const char *needle, size_t hay_length); + +/** + * Copy the string src to dst, but no more than size - 1 bytes, and + * null-terminate dst. + * + * This function is the same as BSD strlcpy(). + * + * @param dst destination buffer + * @param src source string + * @param size size of destination buffer + * @return the length of src + * + * @warning since the return value is the length of src, src absolutely + * _must_ be a properly 0-terminated string, otherwise this will read beyond + * the end of the buffer and possibly crash. + */ +size_t av_strlcpy(char *dst, const char *src, size_t size); + +/** + * Append the string src to the string dst, but to a total length of + * no more than size - 1 bytes, and null-terminate dst. + * + * This function is similar to BSD strlcat(), but differs when + * size <= strlen(dst). + * + * @param dst destination buffer + * @param src source string + * @param size size of destination buffer + * @return the total length of src and dst + * + * @warning since the return value use the length of src and dst, these + * absolutely _must_ be a properly 0-terminated strings, otherwise this + * will read beyond the end of the buffer and possibly crash. + */ +size_t av_strlcat(char *dst, const char *src, size_t size); + +/** + * Append output to a string, according to a format. Never write out of + * the destination buffer, and always put a terminating 0 within + * the buffer. + * @param dst destination buffer (string to which the output is + * appended) + * @param size total size of the destination buffer + * @param fmt printf-compatible format string, specifying how the + * following parameters are used + * @return the length of the string that would have been generated + * if enough space had been available + */ +size_t av_strlcatf(char *dst, size_t size, const char *fmt, ...) av_printf_format(3, 4); + +/** + * Get the count of continuous non zero chars starting from the beginning. + * + * @param s the string whose length to count + * @param len maximum number of characters to check in the string, that + * is the maximum value which is returned by the function + */ +static inline size_t av_strnlen(const char *s, size_t len) +{ + size_t i; + for (i = 0; i < len && s[i]; i++) + ; + return i; +} + +/** + * Print arguments following specified format into a large enough auto + * allocated buffer. It is similar to GNU asprintf(). + * @param fmt printf-compatible format string, specifying how the + * following parameters are used. + * @return the allocated string + * @note You have to free the string yourself with av_free(). + */ +char *av_asprintf(const char *fmt, ...) av_printf_format(1, 2); + +/** + * Unescape the given string until a non escaped terminating char, + * and return the token corresponding to the unescaped string. + * + * The normal \ and ' escaping is supported. Leading and trailing + * whitespaces are removed, unless they are escaped with '\' or are + * enclosed between ''. + * + * @param buf the buffer to parse, buf will be updated to point to the + * terminating char + * @param term a 0-terminated list of terminating chars + * @return the malloced unescaped string, which must be av_freed by + * the user, NULL in case of allocation failure + */ +char *av_get_token(const char **buf, const char *term); + +/** + * Split the string into several tokens which can be accessed by + * successive calls to av_strtok(). + * + * A token is defined as a sequence of characters not belonging to the + * set specified in delim. + * + * On the first call to av_strtok(), s should point to the string to + * parse, and the value of saveptr is ignored. In subsequent calls, s + * should be NULL, and saveptr should be unchanged since the previous + * call. + * + * This function is similar to strtok_r() defined in POSIX.1. + * + * @param s the string to parse, may be NULL + * @param delim 0-terminated list of token delimiters, must be non-NULL + * @param saveptr user-provided pointer which points to stored + * information necessary for av_strtok() to continue scanning the same + * string. saveptr is updated to point to the next character after the + * first delimiter found, or to NULL if the string was terminated + * @return the found token, or NULL when no token is found + */ +char *av_strtok(char *s, const char *delim, char **saveptr); + +/** + * Locale-independent conversion of ASCII isdigit. + */ +static inline av_const int av_isdigit(int c) +{ + return c >= '0' && c <= '9'; +} + +/** + * Locale-independent conversion of ASCII isgraph. + */ +static inline av_const int av_isgraph(int c) +{ + return c > 32 && c < 127; +} + +/** + * Locale-independent conversion of ASCII isspace. + */ +static inline av_const int av_isspace(int c) +{ + return c == ' ' || c == '\f' || c == '\n' || c == '\r' || c == '\t' || + c == '\v'; +} + +/** + * Locale-independent conversion of ASCII characters to uppercase. + */ +static inline av_const int av_toupper(int c) +{ + if (c >= 'a' && c <= 'z') + c ^= 0x20; + return c; +} + +/** + * Locale-independent conversion of ASCII characters to lowercase. + */ +static inline av_const int av_tolower(int c) +{ + if (c >= 'A' && c <= 'Z') + c ^= 0x20; + return c; +} + +/** + * Locale-independent conversion of ASCII isxdigit. + */ +static inline av_const int av_isxdigit(int c) +{ + c = av_tolower(c); + return av_isdigit(c) || (c >= 'a' && c <= 'f'); +} + +/** + * Locale-independent case-insensitive compare. + * @note This means only ASCII-range characters are case-insensitive + */ +int av_strcasecmp(const char *a, const char *b); + +/** + * Locale-independent case-insensitive compare. + * @note This means only ASCII-range characters are case-insensitive + */ +int av_strncasecmp(const char *a, const char *b, size_t n); + +/** + * Locale-independent strings replace. + * @note This means only ASCII-range characters are replaced. + */ +char *av_strireplace(const char *str, const char *from, const char *to); + +/** + * Thread safe basename. + * @param path the string to parse, on DOS both \ and / are considered separators. + * @return pointer to the basename substring. + * If path does not contain a slash, the function returns a copy of path. + * If path is a NULL pointer or points to an empty string, a pointer + * to a string "." is returned. + */ +const char *av_basename(const char *path); + +/** + * Thread safe dirname. + * @param path the string to parse, on DOS both \ and / are considered separators. + * @return A pointer to a string that's the parent directory of path. + * If path is a NULL pointer or points to an empty string, a pointer + * to a string "." is returned. + * @note the function may modify the contents of the path, so copies should be passed. + */ +const char *av_dirname(char *path); + +/** + * Match instances of a name in a comma-separated list of names. + * List entries are checked from the start to the end of the names list, + * the first match ends further processing. If an entry prefixed with '-' + * matches, then 0 is returned. The "ALL" list entry is considered to + * match all names. + * + * @param name Name to look for. + * @param names List of names. + * @return 1 on match, 0 otherwise. + */ +int av_match_name(const char *name, const char *names); + +/** + * Append path component to the existing path. + * Path separator '/' is placed between when needed. + * Resulting string have to be freed with av_free(). + * @param path base path + * @param component component to be appended + * @return new path or NULL on error. + */ +char *av_append_path_component(const char *path, const char *component); + +enum AVEscapeMode { + AV_ESCAPE_MODE_AUTO, ///< Use auto-selected escaping mode. + AV_ESCAPE_MODE_BACKSLASH, ///< Use backslash escaping. + AV_ESCAPE_MODE_QUOTE, ///< Use single-quote escaping. + AV_ESCAPE_MODE_XML, ///< Use XML non-markup character data escaping. +}; + +/** + * Consider spaces special and escape them even in the middle of the + * string. + * + * This is equivalent to adding the whitespace characters to the special + * characters lists, except it is guaranteed to use the exact same list + * of whitespace characters as the rest of libavutil. + */ +#define AV_ESCAPE_FLAG_WHITESPACE (1 << 0) + +/** + * Escape only specified special characters. + * Without this flag, escape also any characters that may be considered + * special by av_get_token(), such as the single quote. + */ +#define AV_ESCAPE_FLAG_STRICT (1 << 1) + +/** + * Within AV_ESCAPE_MODE_XML, additionally escape single quotes for single + * quoted attributes. + */ +#define AV_ESCAPE_FLAG_XML_SINGLE_QUOTES (1 << 2) + +/** + * Within AV_ESCAPE_MODE_XML, additionally escape double quotes for double + * quoted attributes. + */ +#define AV_ESCAPE_FLAG_XML_DOUBLE_QUOTES (1 << 3) + + +/** + * Escape string in src, and put the escaped string in an allocated + * string in *dst, which must be freed with av_free(). + * + * @param dst pointer where an allocated string is put + * @param src string to escape, must be non-NULL + * @param special_chars string containing the special characters which + * need to be escaped, can be NULL + * @param mode escape mode to employ, see AV_ESCAPE_MODE_* macros. + * Any unknown value for mode will be considered equivalent to + * AV_ESCAPE_MODE_BACKSLASH, but this behaviour can change without + * notice. + * @param flags flags which control how to escape, see AV_ESCAPE_FLAG_ macros + * @return the length of the allocated string, or a negative error code in case of error + * @see av_bprint_escape() + */ +av_warn_unused_result +int av_escape(char **dst, const char *src, const char *special_chars, + enum AVEscapeMode mode, int flags); + +#define AV_UTF8_FLAG_ACCEPT_INVALID_BIG_CODES 1 ///< accept codepoints over 0x10FFFF +#define AV_UTF8_FLAG_ACCEPT_NON_CHARACTERS 2 ///< accept non-characters - 0xFFFE and 0xFFFF +#define AV_UTF8_FLAG_ACCEPT_SURROGATES 4 ///< accept UTF-16 surrogates codes +#define AV_UTF8_FLAG_EXCLUDE_XML_INVALID_CONTROL_CODES 8 ///< exclude control codes not accepted by XML + +#define AV_UTF8_FLAG_ACCEPT_ALL \ + AV_UTF8_FLAG_ACCEPT_INVALID_BIG_CODES|AV_UTF8_FLAG_ACCEPT_NON_CHARACTERS|AV_UTF8_FLAG_ACCEPT_SURROGATES + +/** + * Read and decode a single UTF-8 code point (character) from the + * buffer in *buf, and update *buf to point to the next byte to + * decode. + * + * In case of an invalid byte sequence, the pointer will be updated to + * the next byte after the invalid sequence and the function will + * return an error code. + * + * Depending on the specified flags, the function will also fail in + * case the decoded code point does not belong to a valid range. + * + * @note For speed-relevant code a carefully implemented use of + * GET_UTF8() may be preferred. + * + * @param codep pointer used to return the parsed code in case of success. + * The value in *codep is set even in case the range check fails. + * @param bufp pointer to the address the first byte of the sequence + * to decode, updated by the function to point to the + * byte next after the decoded sequence + * @param buf_end pointer to the end of the buffer, points to the next + * byte past the last in the buffer. This is used to + * avoid buffer overreads (in case of an unfinished + * UTF-8 sequence towards the end of the buffer). + * @param flags a collection of AV_UTF8_FLAG_* flags + * @return >= 0 in case a sequence was successfully read, a negative + * value in case of invalid sequence + */ +av_warn_unused_result +int av_utf8_decode(int32_t *codep, const uint8_t **bufp, const uint8_t *buf_end, + unsigned int flags); + +/** + * Check if a name is in a list. + * @returns 0 if not found, or the 1 based index where it has been found in the + * list. + */ +int av_match_list(const char *name, const char *list, char separator); + +/** + * See libc sscanf manual for more information. + * Locale-independent sscanf implementation. + */ +int av_sscanf(const char *string, const char *format, ...); + +/** + * @} + */ + +#endif /* AVUTIL_AVSTRING_H */ diff --git a/libs/FFmpeg/include/libavutil/avutil.h b/libs/FFmpeg/include/libavutil/avutil.h new file mode 100644 index 0000000..a362c8b --- /dev/null +++ b/libs/FFmpeg/include/libavutil/avutil.h @@ -0,0 +1,375 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_AVUTIL_H +#define AVUTIL_AVUTIL_H + +/** + * @file + * @ingroup lavu + * Convenience header that includes @ref lavu "libavutil"'s core. + */ + +/** + * @mainpage + * + * @section ffmpeg_intro Introduction + * + * This document describes the usage of the different libraries + * provided by FFmpeg. + * + * @li @ref libavc "libavcodec" encoding/decoding library + * @li @ref lavfi "libavfilter" graph-based frame editing library + * @li @ref libavf "libavformat" I/O and muxing/demuxing library + * @li @ref lavd "libavdevice" special devices muxing/demuxing library + * @li @ref lavu "libavutil" common utility library + * @li @ref lswr "libswresample" audio resampling, format conversion and mixing + * @li @ref lpp "libpostproc" post processing library + * @li @ref libsws "libswscale" color conversion and scaling library + * + * @section ffmpeg_versioning Versioning and compatibility + * + * Each of the FFmpeg libraries contains a version.h header, which defines a + * major, minor and micro version number with the + * LIBRARYNAME_VERSION_{MAJOR,MINOR,MICRO} macros. The major version + * number is incremented with backward incompatible changes - e.g. removing + * parts of the public API, reordering public struct members, etc. The minor + * version number is incremented for backward compatible API changes or major + * new features - e.g. adding a new public function or a new decoder. The micro + * version number is incremented for smaller changes that a calling program + * might still want to check for - e.g. changing behavior in a previously + * unspecified situation. + * + * FFmpeg guarantees backward API and ABI compatibility for each library as long + * as its major version number is unchanged. This means that no public symbols + * will be removed or renamed. Types and names of the public struct members and + * values of public macros and enums will remain the same (unless they were + * explicitly declared as not part of the public API). Documented behavior will + * not change. + * + * In other words, any correct program that works with a given FFmpeg snapshot + * should work just as well without any changes with any later snapshot with the + * same major versions. This applies to both rebuilding the program against new + * FFmpeg versions or to replacing the dynamic FFmpeg libraries that a program + * links against. + * + * However, new public symbols may be added and new members may be appended to + * public structs whose size is not part of public ABI (most public structs in + * FFmpeg). New macros and enum values may be added. Behavior in undocumented + * situations may change slightly (and be documented). All those are accompanied + * by an entry in doc/APIchanges and incrementing either the minor or micro + * version number. + */ + +/** + * @defgroup lavu libavutil + * Common code shared across all FFmpeg libraries. + * + * @note + * libavutil is designed to be modular. In most cases, in order to use the + * functions provided by one component of libavutil you must explicitly include + * the specific header containing that feature. If you are only using + * media-related components, you could simply include libavutil/avutil.h, which + * brings in most of the "core" components. + * + * @{ + * + * @defgroup lavu_crypto Crypto and Hashing + * + * @{ + * @} + * + * @defgroup lavu_math Mathematics + * @{ + * + * @} + * + * @defgroup lavu_string String Manipulation + * + * @{ + * + * @} + * + * @defgroup lavu_mem Memory Management + * + * @{ + * + * @} + * + * @defgroup lavu_data Data Structures + * @{ + * + * @} + * + * @defgroup lavu_video Video related + * + * @{ + * + * @} + * + * @defgroup lavu_audio Audio related + * + * @{ + * + * @} + * + * @defgroup lavu_error Error Codes + * + * @{ + * + * @} + * + * @defgroup lavu_log Logging Facility + * + * @{ + * + * @} + * + * @defgroup lavu_misc Other + * + * @{ + * + * @defgroup preproc_misc Preprocessor String Macros + * + * @{ + * + * @} + * + * @defgroup version_utils Library Version Macros + * + * @{ + * + * @} + */ + + +/** + * @addtogroup lavu_ver + * @{ + */ + +/** + * Return the LIBAVUTIL_VERSION_INT constant. + */ +unsigned avutil_version(void); + +/** + * Return an informative version string. This usually is the actual release + * version number or a git commit description. This string has no fixed format + * and can change any time. It should never be parsed by code. + */ +const char *av_version_info(void); + +/** + * Return the libavutil build-time configuration. + */ +const char *avutil_configuration(void); + +/** + * Return the libavutil license. + */ +const char *avutil_license(void); + +/** + * @} + */ + +/** + * @addtogroup lavu_media Media Type + * @brief Media Type + */ + +enum AVMediaType { + AVMEDIA_TYPE_UNKNOWN = -1, ///< Usually treated as AVMEDIA_TYPE_DATA + AVMEDIA_TYPE_VIDEO, + AVMEDIA_TYPE_AUDIO, + AVMEDIA_TYPE_DATA, ///< Opaque data information usually continuous + AVMEDIA_TYPE_SUBTITLE, + AVMEDIA_TYPE_ATTACHMENT, ///< Opaque data information usually sparse + AVMEDIA_TYPE_NB +}; + +/** + * Return a string describing the media_type enum, NULL if media_type + * is unknown. + */ +const char *av_get_media_type_string(enum AVMediaType media_type); + +/** + * @defgroup lavu_const Constants + * @{ + * + * @defgroup lavu_enc Encoding specific + * + * @note those definition should move to avcodec + * @{ + */ + +#define FF_LAMBDA_SHIFT 7 +#define FF_LAMBDA_SCALE (1< + +/** + * @defgroup lavu_base64 Base64 + * @ingroup lavu_crypto + * @{ + */ + +/** + * Decode a base64-encoded string. + * + * @param out buffer for decoded data + * @param in null-terminated input string + * @param out_size size in bytes of the out buffer, must be at + * least 3/4 of the length of in, that is AV_BASE64_DECODE_SIZE(strlen(in)) + * @return number of bytes written, or a negative value in case of + * invalid input + */ +int av_base64_decode(uint8_t *out, const char *in, int out_size); + +/** + * Calculate the output size in bytes needed to decode a base64 string + * with length x to a data buffer. + */ +#define AV_BASE64_DECODE_SIZE(x) ((x) * 3LL / 4) + +/** + * Encode data to base64 and null-terminate. + * + * @param out buffer for encoded data + * @param out_size size in bytes of the out buffer (including the + * null terminator), must be at least AV_BASE64_SIZE(in_size) + * @param in input buffer containing the data to encode + * @param in_size size in bytes of the in buffer + * @return out or NULL in case of error + */ +char *av_base64_encode(char *out, int out_size, const uint8_t *in, int in_size); + +/** + * Calculate the output size needed to base64-encode x bytes to a + * null-terminated string. + */ +#define AV_BASE64_SIZE(x) (((x)+2) / 3 * 4 + 1) + + /** + * @} + */ + +#endif /* AVUTIL_BASE64_H */ diff --git a/libs/FFmpeg/include/libavutil/blowfish.h b/libs/FFmpeg/include/libavutil/blowfish.h new file mode 100644 index 0000000..9e289a4 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/blowfish.h @@ -0,0 +1,82 @@ +/* + * Blowfish algorithm + * Copyright (c) 2012 Samuel Pitoiset + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_BLOWFISH_H +#define AVUTIL_BLOWFISH_H + +#include + +/** + * @defgroup lavu_blowfish Blowfish + * @ingroup lavu_crypto + * @{ + */ + +#define AV_BF_ROUNDS 16 + +typedef struct AVBlowfish { + uint32_t p[AV_BF_ROUNDS + 2]; + uint32_t s[4][256]; +} AVBlowfish; + +/** + * Allocate an AVBlowfish context. + */ +AVBlowfish *av_blowfish_alloc(void); + +/** + * Initialize an AVBlowfish context. + * + * @param ctx an AVBlowfish context + * @param key a key + * @param key_len length of the key + */ +void av_blowfish_init(struct AVBlowfish *ctx, const uint8_t *key, int key_len); + +/** + * Encrypt or decrypt a buffer using a previously initialized context. + * + * @param ctx an AVBlowfish context + * @param xl left four bytes halves of input to be encrypted + * @param xr right four bytes halves of input to be encrypted + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_blowfish_crypt_ecb(struct AVBlowfish *ctx, uint32_t *xl, uint32_t *xr, + int decrypt); + +/** + * Encrypt or decrypt a buffer using a previously initialized context. + * + * @param ctx an AVBlowfish context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 8 byte blocks + * @param iv initialization vector for CBC mode, if NULL ECB will be used + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_blowfish_crypt(struct AVBlowfish *ctx, uint8_t *dst, const uint8_t *src, + int count, uint8_t *iv, int decrypt); + +/** + * @} + */ + +#endif /* AVUTIL_BLOWFISH_H */ diff --git a/libs/FFmpeg/include/libavutil/bprint.h b/libs/FFmpeg/include/libavutil/bprint.h new file mode 100644 index 0000000..8559745 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/bprint.h @@ -0,0 +1,254 @@ +/* + * Copyright (c) 2012 Nicolas George + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_avbprint + * AVBPrint public header + */ + +#ifndef AVUTIL_BPRINT_H +#define AVUTIL_BPRINT_H + +#include + +#include "attributes.h" +#include "avstring.h" + +/** + * @defgroup lavu_avbprint AVBPrint + * @ingroup lavu_data + * + * A buffer to print data progressively + * @{ + */ + +/** + * Define a structure with extra padding to a fixed size + * This helps ensuring binary compatibility with future versions. + */ + +#define FF_PAD_STRUCTURE(name, size, ...) \ +struct ff_pad_helper_##name { __VA_ARGS__ }; \ +typedef struct name { \ + __VA_ARGS__ \ + char reserved_padding[size - sizeof(struct ff_pad_helper_##name)]; \ +} name; + +/** + * Buffer to print data progressively + * + * The string buffer grows as necessary and is always 0-terminated. + * The content of the string is never accessed, and thus is + * encoding-agnostic and can even hold binary data. + * + * Small buffers are kept in the structure itself, and thus require no + * memory allocation at all (unless the contents of the buffer is needed + * after the structure goes out of scope). This is almost as lightweight as + * declaring a local `char buf[512]`. + * + * The length of the string can go beyond the allocated size: the buffer is + * then truncated, but the functions still keep account of the actual total + * length. + * + * In other words, AVBPrint.len can be greater than AVBPrint.size and records + * the total length of what would have been to the buffer if there had been + * enough memory. + * + * Append operations do not need to be tested for failure: if a memory + * allocation fails, data stop being appended to the buffer, but the length + * is still updated. This situation can be tested with + * av_bprint_is_complete(). + * + * The AVBPrint.size_max field determines several possible behaviours: + * - `size_max = -1` (= `UINT_MAX`) or any large value will let the buffer be + * reallocated as necessary, with an amortized linear cost. + * - `size_max = 0` prevents writing anything to the buffer: only the total + * length is computed. The write operations can then possibly be repeated in + * a buffer with exactly the necessary size + * (using `size_init = size_max = len + 1`). + * - `size_max = 1` is automatically replaced by the exact size available in the + * structure itself, thus ensuring no dynamic memory allocation. The + * internal buffer is large enough to hold a reasonable paragraph of text, + * such as the current paragraph. + */ + +FF_PAD_STRUCTURE(AVBPrint, 1024, + char *str; /**< string so far */ + unsigned len; /**< length so far */ + unsigned size; /**< allocated memory */ + unsigned size_max; /**< maximum allocated memory */ + char reserved_internal_buffer[1]; +) + +/** + * @name Max size special values + * Convenience macros for special values for av_bprint_init() size_max + * parameter. + * @{ + */ + +/** + * Buffer will be reallocated as necessary, with an amortized linear cost. + */ +#define AV_BPRINT_SIZE_UNLIMITED ((unsigned)-1) +/** + * Use the exact size available in the AVBPrint structure itself. + * + * Thus ensuring no dynamic memory allocation. The internal buffer is large + * enough to hold a reasonable paragraph of text, such as the current paragraph. + */ +#define AV_BPRINT_SIZE_AUTOMATIC 1 +/** + * Do not write anything to the buffer, only calculate the total length. + * + * The write operations can then possibly be repeated in a buffer with + * exactly the necessary size (using `size_init = size_max = AVBPrint.len + 1`). + */ +#define AV_BPRINT_SIZE_COUNT_ONLY 0 +/** @} */ + +/** + * Init a print buffer. + * + * @param buf buffer to init + * @param size_init initial size (including the final 0) + * @param size_max maximum size; + * - `0` means do not write anything, just count the length + * - `1` is replaced by the maximum value for automatic storage + * any large value means that the internal buffer will be + * reallocated as needed up to that limit + * - `-1` is converted to `UINT_MAX`, the largest limit possible. + * Check also `AV_BPRINT_SIZE_*` macros. + */ +void av_bprint_init(AVBPrint *buf, unsigned size_init, unsigned size_max); + +/** + * Init a print buffer using a pre-existing buffer. + * + * The buffer will not be reallocated. + * In case size equals zero, the AVBPrint will be initialized to use + * the internal buffer as if using AV_BPRINT_SIZE_COUNT_ONLY with + * av_bprint_init(). + * + * @param buf buffer structure to init + * @param buffer byte buffer to use for the string data + * @param size size of buffer + */ +void av_bprint_init_for_buffer(AVBPrint *buf, char *buffer, unsigned size); + +/** + * Append a formatted string to a print buffer. + */ +void av_bprintf(AVBPrint *buf, const char *fmt, ...) av_printf_format(2, 3); + +/** + * Append a formatted string to a print buffer. + */ +void av_vbprintf(AVBPrint *buf, const char *fmt, va_list vl_arg); + +/** + * Append char c n times to a print buffer. + */ +void av_bprint_chars(AVBPrint *buf, char c, unsigned n); + +/** + * Append data to a print buffer. + * + * param buf bprint buffer to use + * param data pointer to data + * param size size of data + */ +void av_bprint_append_data(AVBPrint *buf, const char *data, unsigned size); + +struct tm; +/** + * Append a formatted date and time to a print buffer. + * + * param buf bprint buffer to use + * param fmt date and time format string, see strftime() + * param tm broken-down time structure to translate + * + * @note due to poor design of the standard strftime function, it may + * produce poor results if the format string expands to a very long text and + * the bprint buffer is near the limit stated by the size_max option. + */ +void av_bprint_strftime(AVBPrint *buf, const char *fmt, const struct tm *tm); + +/** + * Allocate bytes in the buffer for external use. + * + * @param[in] buf buffer structure + * @param[in] size required size + * @param[out] mem pointer to the memory area + * @param[out] actual_size size of the memory area after allocation; + * can be larger or smaller than size + */ +void av_bprint_get_buffer(AVBPrint *buf, unsigned size, + unsigned char **mem, unsigned *actual_size); + +/** + * Reset the string to "" but keep internal allocated data. + */ +void av_bprint_clear(AVBPrint *buf); + +/** + * Test if the print buffer is complete (not truncated). + * + * It may have been truncated due to a memory allocation failure + * or the size_max limit (compare size and size_max if necessary). + */ +static inline int av_bprint_is_complete(const AVBPrint *buf) +{ + return buf->len < buf->size; +} + +/** + * Finalize a print buffer. + * + * The print buffer can no longer be used afterwards, + * but the len and size fields are still valid. + * + * @arg[out] ret_str if not NULL, used to return a permanent copy of the + * buffer contents, or NULL if memory allocation fails; + * if NULL, the buffer is discarded and freed + * @return 0 for success or error code (probably AVERROR(ENOMEM)) + */ +int av_bprint_finalize(AVBPrint *buf, char **ret_str); + +/** + * Escape the content in src and append it to dstbuf. + * + * @param dstbuf already inited destination bprint buffer + * @param src string containing the text to escape + * @param special_chars string containing the special characters which + * need to be escaped, can be NULL + * @param mode escape mode to employ, see AV_ESCAPE_MODE_* macros. + * Any unknown value for mode will be considered equivalent to + * AV_ESCAPE_MODE_BACKSLASH, but this behaviour can change without + * notice. + * @param flags flags which control how to escape, see AV_ESCAPE_FLAG_* macros + */ +void av_bprint_escape(AVBPrint *dstbuf, const char *src, const char *special_chars, + enum AVEscapeMode mode, int flags); + +/** @} */ + +#endif /* AVUTIL_BPRINT_H */ diff --git a/libs/FFmpeg/include/libavutil/bswap.h b/libs/FFmpeg/include/libavutil/bswap.h new file mode 100644 index 0000000..4840ab4 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/bswap.h @@ -0,0 +1,111 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * byte swapping routines + */ + +#ifndef AVUTIL_BSWAP_H +#define AVUTIL_BSWAP_H + +#include +#include "libavutil/avconfig.h" +#include "attributes.h" + +#ifdef HAVE_AV_CONFIG_H + +#include "config.h" + +#if ARCH_AARCH64 +# include "aarch64/bswap.h" +#elif ARCH_ARM +# include "arm/bswap.h" +#elif ARCH_AVR32 +# include "avr32/bswap.h" +#elif ARCH_RISCV +# include "riscv/bswap.h" +#elif ARCH_SH4 +# include "sh4/bswap.h" +#elif ARCH_X86 +# include "x86/bswap.h" +#endif + +#endif /* HAVE_AV_CONFIG_H */ + +#define AV_BSWAP16C(x) (((x) << 8 & 0xff00) | ((x) >> 8 & 0x00ff)) +#define AV_BSWAP32C(x) (AV_BSWAP16C(x) << 16 | AV_BSWAP16C((x) >> 16)) +#define AV_BSWAP64C(x) (AV_BSWAP32C(x) << 32 | AV_BSWAP32C((x) >> 32)) + +#define AV_BSWAPC(s, x) AV_BSWAP##s##C(x) + +#ifndef av_bswap16 +static av_always_inline av_const uint16_t av_bswap16(uint16_t x) +{ + x= (x>>8) | (x<<8); + return x; +} +#endif + +#ifndef av_bswap32 +static av_always_inline av_const uint32_t av_bswap32(uint32_t x) +{ + return AV_BSWAP32C(x); +} +#endif + +#ifndef av_bswap64 +static inline uint64_t av_const av_bswap64(uint64_t x) +{ + return (uint64_t)av_bswap32(x) << 32 | av_bswap32(x >> 32); +} +#endif + +// be2ne ... big-endian to native-endian +// le2ne ... little-endian to native-endian + +#if AV_HAVE_BIGENDIAN +#define av_be2ne16(x) (x) +#define av_be2ne32(x) (x) +#define av_be2ne64(x) (x) +#define av_le2ne16(x) av_bswap16(x) +#define av_le2ne32(x) av_bswap32(x) +#define av_le2ne64(x) av_bswap64(x) +#define AV_BE2NEC(s, x) (x) +#define AV_LE2NEC(s, x) AV_BSWAPC(s, x) +#else +#define av_be2ne16(x) av_bswap16(x) +#define av_be2ne32(x) av_bswap32(x) +#define av_be2ne64(x) av_bswap64(x) +#define av_le2ne16(x) (x) +#define av_le2ne32(x) (x) +#define av_le2ne64(x) (x) +#define AV_BE2NEC(s, x) AV_BSWAPC(s, x) +#define AV_LE2NEC(s, x) (x) +#endif + +#define AV_BE2NE16C(x) AV_BE2NEC(16, x) +#define AV_BE2NE32C(x) AV_BE2NEC(32, x) +#define AV_BE2NE64C(x) AV_BE2NEC(64, x) +#define AV_LE2NE16C(x) AV_LE2NEC(16, x) +#define AV_LE2NE32C(x) AV_LE2NEC(32, x) +#define AV_LE2NE64C(x) AV_LE2NEC(64, x) + +#endif /* AVUTIL_BSWAP_H */ diff --git a/libs/FFmpeg/include/libavutil/buffer.h b/libs/FFmpeg/include/libavutil/buffer.h new file mode 100644 index 0000000..e1ef5b7 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/buffer.h @@ -0,0 +1,322 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_buffer + * refcounted data buffer API + */ + +#ifndef AVUTIL_BUFFER_H +#define AVUTIL_BUFFER_H + +#include +#include + +/** + * @defgroup lavu_buffer AVBuffer + * @ingroup lavu_data + * + * @{ + * AVBuffer is an API for reference-counted data buffers. + * + * There are two core objects in this API -- AVBuffer and AVBufferRef. AVBuffer + * represents the data buffer itself; it is opaque and not meant to be accessed + * by the caller directly, but only through AVBufferRef. However, the caller may + * e.g. compare two AVBuffer pointers to check whether two different references + * are describing the same data buffer. AVBufferRef represents a single + * reference to an AVBuffer and it is the object that may be manipulated by the + * caller directly. + * + * There are two functions provided for creating a new AVBuffer with a single + * reference -- av_buffer_alloc() to just allocate a new buffer, and + * av_buffer_create() to wrap an existing array in an AVBuffer. From an existing + * reference, additional references may be created with av_buffer_ref(). + * Use av_buffer_unref() to free a reference (this will automatically free the + * data once all the references are freed). + * + * The convention throughout this API and the rest of FFmpeg is such that the + * buffer is considered writable if there exists only one reference to it (and + * it has not been marked as read-only). The av_buffer_is_writable() function is + * provided to check whether this is true and av_buffer_make_writable() will + * automatically create a new writable buffer when necessary. + * Of course nothing prevents the calling code from violating this convention, + * however that is safe only when all the existing references are under its + * control. + * + * @note Referencing and unreferencing the buffers is thread-safe and thus + * may be done from multiple threads simultaneously without any need for + * additional locking. + * + * @note Two different references to the same buffer can point to different + * parts of the buffer (i.e. their AVBufferRef.data will not be equal). + */ + +/** + * A reference counted buffer type. It is opaque and is meant to be used through + * references (AVBufferRef). + */ +typedef struct AVBuffer AVBuffer; + +/** + * A reference to a data buffer. + * + * The size of this struct is not a part of the public ABI and it is not meant + * to be allocated directly. + */ +typedef struct AVBufferRef { + AVBuffer *buffer; + + /** + * The data buffer. It is considered writable if and only if + * this is the only reference to the buffer, in which case + * av_buffer_is_writable() returns 1. + */ + uint8_t *data; + /** + * Size of data in bytes. + */ + size_t size; +} AVBufferRef; + +/** + * Allocate an AVBuffer of the given size using av_malloc(). + * + * @return an AVBufferRef of given size or NULL when out of memory + */ +AVBufferRef *av_buffer_alloc(size_t size); + +/** + * Same as av_buffer_alloc(), except the returned buffer will be initialized + * to zero. + */ +AVBufferRef *av_buffer_allocz(size_t size); + +/** + * Always treat the buffer as read-only, even when it has only one + * reference. + */ +#define AV_BUFFER_FLAG_READONLY (1 << 0) + +/** + * Create an AVBuffer from an existing array. + * + * If this function is successful, data is owned by the AVBuffer. The caller may + * only access data through the returned AVBufferRef and references derived from + * it. + * If this function fails, data is left untouched. + * @param data data array + * @param size size of data in bytes + * @param free a callback for freeing this buffer's data + * @param opaque parameter to be got for processing or passed to free + * @param flags a combination of AV_BUFFER_FLAG_* + * + * @return an AVBufferRef referring to data on success, NULL on failure. + */ +AVBufferRef *av_buffer_create(uint8_t *data, size_t size, + void (*free)(void *opaque, uint8_t *data), + void *opaque, int flags); + +/** + * Default free callback, which calls av_free() on the buffer data. + * This function is meant to be passed to av_buffer_create(), not called + * directly. + */ +void av_buffer_default_free(void *opaque, uint8_t *data); + +/** + * Create a new reference to an AVBuffer. + * + * @return a new AVBufferRef referring to the same AVBuffer as buf or NULL on + * failure. + */ +AVBufferRef *av_buffer_ref(const AVBufferRef *buf); + +/** + * Free a given reference and automatically free the buffer if there are no more + * references to it. + * + * @param buf the reference to be freed. The pointer is set to NULL on return. + */ +void av_buffer_unref(AVBufferRef **buf); + +/** + * @return 1 if the caller may write to the data referred to by buf (which is + * true if and only if buf is the only reference to the underlying AVBuffer). + * Return 0 otherwise. + * A positive answer is valid until av_buffer_ref() is called on buf. + */ +int av_buffer_is_writable(const AVBufferRef *buf); + +/** + * @return the opaque parameter set by av_buffer_create. + */ +void *av_buffer_get_opaque(const AVBufferRef *buf); + +int av_buffer_get_ref_count(const AVBufferRef *buf); + +/** + * Create a writable reference from a given buffer reference, avoiding data copy + * if possible. + * + * @param buf buffer reference to make writable. On success, buf is either left + * untouched, or it is unreferenced and a new writable AVBufferRef is + * written in its place. On failure, buf is left untouched. + * @return 0 on success, a negative AVERROR on failure. + */ +int av_buffer_make_writable(AVBufferRef **buf); + +/** + * Reallocate a given buffer. + * + * @param buf a buffer reference to reallocate. On success, buf will be + * unreferenced and a new reference with the required size will be + * written in its place. On failure buf will be left untouched. *buf + * may be NULL, then a new buffer is allocated. + * @param size required new buffer size. + * @return 0 on success, a negative AVERROR on failure. + * + * @note the buffer is actually reallocated with av_realloc() only if it was + * initially allocated through av_buffer_realloc(NULL) and there is only one + * reference to it (i.e. the one passed to this function). In all other cases + * a new buffer is allocated and the data is copied. + */ +int av_buffer_realloc(AVBufferRef **buf, size_t size); + +/** + * Ensure dst refers to the same data as src. + * + * When *dst is already equivalent to src, do nothing. Otherwise unreference dst + * and replace it with a new reference to src. + * + * @param dst Pointer to either a valid buffer reference or NULL. On success, + * this will point to a buffer reference equivalent to src. On + * failure, dst will be left untouched. + * @param src A buffer reference to replace dst with. May be NULL, then this + * function is equivalent to av_buffer_unref(dst). + * @return 0 on success + * AVERROR(ENOMEM) on memory allocation failure. + */ +int av_buffer_replace(AVBufferRef **dst, const AVBufferRef *src); + +/** + * @} + */ + +/** + * @defgroup lavu_bufferpool AVBufferPool + * @ingroup lavu_data + * + * @{ + * AVBufferPool is an API for a lock-free thread-safe pool of AVBuffers. + * + * Frequently allocating and freeing large buffers may be slow. AVBufferPool is + * meant to solve this in cases when the caller needs a set of buffers of the + * same size (the most obvious use case being buffers for raw video or audio + * frames). + * + * At the beginning, the user must call av_buffer_pool_init() to create the + * buffer pool. Then whenever a buffer is needed, call av_buffer_pool_get() to + * get a reference to a new buffer, similar to av_buffer_alloc(). This new + * reference works in all aspects the same way as the one created by + * av_buffer_alloc(). However, when the last reference to this buffer is + * unreferenced, it is returned to the pool instead of being freed and will be + * reused for subsequent av_buffer_pool_get() calls. + * + * When the caller is done with the pool and no longer needs to allocate any new + * buffers, av_buffer_pool_uninit() must be called to mark the pool as freeable. + * Once all the buffers are released, it will automatically be freed. + * + * Allocating and releasing buffers with this API is thread-safe as long as + * either the default alloc callback is used, or the user-supplied one is + * thread-safe. + */ + +/** + * The buffer pool. This structure is opaque and not meant to be accessed + * directly. It is allocated with av_buffer_pool_init() and freed with + * av_buffer_pool_uninit(). + */ +typedef struct AVBufferPool AVBufferPool; + +/** + * Allocate and initialize a buffer pool. + * + * @param size size of each buffer in this pool + * @param alloc a function that will be used to allocate new buffers when the + * pool is empty. May be NULL, then the default allocator will be used + * (av_buffer_alloc()). + * @return newly created buffer pool on success, NULL on error. + */ +AVBufferPool *av_buffer_pool_init(size_t size, AVBufferRef* (*alloc)(size_t size)); + +/** + * Allocate and initialize a buffer pool with a more complex allocator. + * + * @param size size of each buffer in this pool + * @param opaque arbitrary user data used by the allocator + * @param alloc a function that will be used to allocate new buffers when the + * pool is empty. May be NULL, then the default allocator will be + * used (av_buffer_alloc()). + * @param pool_free a function that will be called immediately before the pool + * is freed. I.e. after av_buffer_pool_uninit() is called + * by the caller and all the frames are returned to the pool + * and freed. It is intended to uninitialize the user opaque + * data. May be NULL. + * @return newly created buffer pool on success, NULL on error. + */ +AVBufferPool *av_buffer_pool_init2(size_t size, void *opaque, + AVBufferRef* (*alloc)(void *opaque, size_t size), + void (*pool_free)(void *opaque)); + +/** + * Mark the pool as being available for freeing. It will actually be freed only + * once all the allocated buffers associated with the pool are released. Thus it + * is safe to call this function while some of the allocated buffers are still + * in use. + * + * @param pool pointer to the pool to be freed. It will be set to NULL. + */ +void av_buffer_pool_uninit(AVBufferPool **pool); + +/** + * Allocate a new AVBuffer, reusing an old buffer from the pool when available. + * This function may be called simultaneously from multiple threads. + * + * @return a reference to the new buffer on success, NULL on error. + */ +AVBufferRef *av_buffer_pool_get(AVBufferPool *pool); + +/** + * Query the original opaque parameter of an allocated buffer in the pool. + * + * @param ref a buffer reference to a buffer returned by av_buffer_pool_get. + * @return the opaque parameter set by the buffer allocator function of the + * buffer pool. + * + * @note the opaque parameter of ref is used by the buffer pool implementation, + * therefore you have to use this function to access the original opaque + * parameter of an allocated buffer. + */ +void *av_buffer_pool_buffer_get_opaque(const AVBufferRef *ref); + +/** + * @} + */ + +#endif /* AVUTIL_BUFFER_H */ diff --git a/libs/FFmpeg/include/libavutil/camellia.h b/libs/FFmpeg/include/libavutil/camellia.h new file mode 100644 index 0000000..9678710 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/camellia.h @@ -0,0 +1,70 @@ +/* + * An implementation of the CAMELLIA algorithm as mentioned in RFC3713 + * Copyright (c) 2014 Supraja Meedinti + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_CAMELLIA_H +#define AVUTIL_CAMELLIA_H + +#include + + +/** + * @file + * @brief Public header for libavutil CAMELLIA algorithm + * @defgroup lavu_camellia CAMELLIA + * @ingroup lavu_crypto + * @{ + */ + +extern const int av_camellia_size; + +struct AVCAMELLIA; + +/** + * Allocate an AVCAMELLIA context + * To free the struct: av_free(ptr) + */ +struct AVCAMELLIA *av_camellia_alloc(void); + +/** + * Initialize an AVCAMELLIA context. + * + * @param ctx an AVCAMELLIA context + * @param key a key of 16, 24, 32 bytes used for encryption/decryption + * @param key_bits number of keybits: possible are 128, 192, 256 + */ +int av_camellia_init(struct AVCAMELLIA *ctx, const uint8_t *key, int key_bits); + +/** + * Encrypt or decrypt a buffer using a previously initialized context + * + * @param ctx an AVCAMELLIA context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 16 byte blocks + * @param iv initialization vector for CBC mode, NULL for ECB mode + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_camellia_crypt(struct AVCAMELLIA *ctx, uint8_t *dst, const uint8_t *src, int count, uint8_t* iv, int decrypt); + +/** + * @} + */ +#endif /* AVUTIL_CAMELLIA_H */ diff --git a/libs/FFmpeg/include/libavutil/cast5.h b/libs/FFmpeg/include/libavutil/cast5.h new file mode 100644 index 0000000..ad5b347 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/cast5.h @@ -0,0 +1,80 @@ +/* + * An implementation of the CAST128 algorithm as mentioned in RFC2144 + * Copyright (c) 2014 Supraja Meedinti + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_CAST5_H +#define AVUTIL_CAST5_H + +#include + + +/** + * @file + * @brief Public header for libavutil CAST5 algorithm + * @defgroup lavu_cast5 CAST5 + * @ingroup lavu_crypto + * @{ + */ + +extern const int av_cast5_size; + +struct AVCAST5; + +/** + * Allocate an AVCAST5 context + * To free the struct: av_free(ptr) + */ +struct AVCAST5 *av_cast5_alloc(void); +/** + * Initialize an AVCAST5 context. + * + * @param ctx an AVCAST5 context + * @param key a key of 5,6,...16 bytes used for encryption/decryption + * @param key_bits number of keybits: possible are 40,48,...,128 + * @return 0 on success, less than 0 on failure + */ +int av_cast5_init(struct AVCAST5 *ctx, const uint8_t *key, int key_bits); + +/** + * Encrypt or decrypt a buffer using a previously initialized context, ECB mode only + * + * @param ctx an AVCAST5 context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 8 byte blocks + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_cast5_crypt(struct AVCAST5 *ctx, uint8_t *dst, const uint8_t *src, int count, int decrypt); + +/** + * Encrypt or decrypt a buffer using a previously initialized context + * + * @param ctx an AVCAST5 context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 8 byte blocks + * @param iv initialization vector for CBC mode, NULL for ECB mode + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_cast5_crypt2(struct AVCAST5 *ctx, uint8_t *dst, const uint8_t *src, int count, uint8_t *iv, int decrypt); +/** + * @} + */ +#endif /* AVUTIL_CAST5_H */ diff --git a/libs/FFmpeg/include/libavutil/channel_layout.h b/libs/FFmpeg/include/libavutil/channel_layout.h new file mode 100644 index 0000000..c9c404e --- /dev/null +++ b/libs/FFmpeg/include/libavutil/channel_layout.h @@ -0,0 +1,807 @@ +/* + * Copyright (c) 2006 Michael Niedermayer + * Copyright (c) 2008 Peter Ross + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_CHANNEL_LAYOUT_H +#define AVUTIL_CHANNEL_LAYOUT_H + +#include +#include + +#include "version.h" +#include "attributes.h" + +/** + * @file + * @ingroup lavu_audio_channels + * Public libavutil channel layout APIs header. + */ + + +/** + * @defgroup lavu_audio_channels Audio channels + * @ingroup lavu_audio + * + * Audio channel layout utility functions + * + * @{ + */ + +enum AVChannel { + ///< Invalid channel index + AV_CHAN_NONE = -1, + AV_CHAN_FRONT_LEFT, + AV_CHAN_FRONT_RIGHT, + AV_CHAN_FRONT_CENTER, + AV_CHAN_LOW_FREQUENCY, + AV_CHAN_BACK_LEFT, + AV_CHAN_BACK_RIGHT, + AV_CHAN_FRONT_LEFT_OF_CENTER, + AV_CHAN_FRONT_RIGHT_OF_CENTER, + AV_CHAN_BACK_CENTER, + AV_CHAN_SIDE_LEFT, + AV_CHAN_SIDE_RIGHT, + AV_CHAN_TOP_CENTER, + AV_CHAN_TOP_FRONT_LEFT, + AV_CHAN_TOP_FRONT_CENTER, + AV_CHAN_TOP_FRONT_RIGHT, + AV_CHAN_TOP_BACK_LEFT, + AV_CHAN_TOP_BACK_CENTER, + AV_CHAN_TOP_BACK_RIGHT, + /** Stereo downmix. */ + AV_CHAN_STEREO_LEFT = 29, + /** See above. */ + AV_CHAN_STEREO_RIGHT, + AV_CHAN_WIDE_LEFT, + AV_CHAN_WIDE_RIGHT, + AV_CHAN_SURROUND_DIRECT_LEFT, + AV_CHAN_SURROUND_DIRECT_RIGHT, + AV_CHAN_LOW_FREQUENCY_2, + AV_CHAN_TOP_SIDE_LEFT, + AV_CHAN_TOP_SIDE_RIGHT, + AV_CHAN_BOTTOM_FRONT_CENTER, + AV_CHAN_BOTTOM_FRONT_LEFT, + AV_CHAN_BOTTOM_FRONT_RIGHT, + + /** Channel is empty can be safely skipped. */ + AV_CHAN_UNUSED = 0x200, + + /** Channel contains data, but its position is unknown. */ + AV_CHAN_UNKNOWN = 0x300, + + /** + * Range of channels between AV_CHAN_AMBISONIC_BASE and + * AV_CHAN_AMBISONIC_END represent Ambisonic components using the ACN system. + * + * Given a channel id `` between AV_CHAN_AMBISONIC_BASE and + * AV_CHAN_AMBISONIC_END (inclusive), the ACN index of the channel `` is + * ` = - AV_CHAN_AMBISONIC_BASE`. + * + * @note these values are only used for AV_CHANNEL_ORDER_CUSTOM channel + * orderings, the AV_CHANNEL_ORDER_AMBISONIC ordering orders the channels + * implicitly by their position in the stream. + */ + AV_CHAN_AMBISONIC_BASE = 0x400, + // leave space for 1024 ids, which correspond to maximum order-32 harmonics, + // which should be enough for the foreseeable use cases + AV_CHAN_AMBISONIC_END = 0x7ff, +}; + +enum AVChannelOrder { + /** + * Only the channel count is specified, without any further information + * about the channel order. + */ + AV_CHANNEL_ORDER_UNSPEC, + /** + * The native channel order, i.e. the channels are in the same order in + * which they are defined in the AVChannel enum. This supports up to 63 + * different channels. + */ + AV_CHANNEL_ORDER_NATIVE, + /** + * The channel order does not correspond to any other predefined order and + * is stored as an explicit map. For example, this could be used to support + * layouts with 64 or more channels, or with empty/skipped (AV_CHAN_SILENCE) + * channels at arbitrary positions. + */ + AV_CHANNEL_ORDER_CUSTOM, + /** + * The audio is represented as the decomposition of the sound field into + * spherical harmonics. Each channel corresponds to a single expansion + * component. Channels are ordered according to ACN (Ambisonic Channel + * Number). + * + * The channel with the index n in the stream contains the spherical + * harmonic of degree l and order m given by + * @code{.unparsed} + * l = floor(sqrt(n)), + * m = n - l * (l + 1). + * @endcode + * + * Conversely given a spherical harmonic of degree l and order m, the + * corresponding channel index n is given by + * @code{.unparsed} + * n = l * (l + 1) + m. + * @endcode + * + * Normalization is assumed to be SN3D (Schmidt Semi-Normalization) + * as defined in AmbiX format $ 2.1. + */ + AV_CHANNEL_ORDER_AMBISONIC, +}; + + +/** + * @defgroup channel_masks Audio channel masks + * + * A channel layout is a 64-bits integer with a bit set for every channel. + * The number of bits set must be equal to the number of channels. + * The value 0 means that the channel layout is not known. + * @note this data structure is not powerful enough to handle channels + * combinations that have the same channel multiple times, such as + * dual-mono. + * + * @{ + */ +#define AV_CH_FRONT_LEFT (1ULL << AV_CHAN_FRONT_LEFT ) +#define AV_CH_FRONT_RIGHT (1ULL << AV_CHAN_FRONT_RIGHT ) +#define AV_CH_FRONT_CENTER (1ULL << AV_CHAN_FRONT_CENTER ) +#define AV_CH_LOW_FREQUENCY (1ULL << AV_CHAN_LOW_FREQUENCY ) +#define AV_CH_BACK_LEFT (1ULL << AV_CHAN_BACK_LEFT ) +#define AV_CH_BACK_RIGHT (1ULL << AV_CHAN_BACK_RIGHT ) +#define AV_CH_FRONT_LEFT_OF_CENTER (1ULL << AV_CHAN_FRONT_LEFT_OF_CENTER ) +#define AV_CH_FRONT_RIGHT_OF_CENTER (1ULL << AV_CHAN_FRONT_RIGHT_OF_CENTER) +#define AV_CH_BACK_CENTER (1ULL << AV_CHAN_BACK_CENTER ) +#define AV_CH_SIDE_LEFT (1ULL << AV_CHAN_SIDE_LEFT ) +#define AV_CH_SIDE_RIGHT (1ULL << AV_CHAN_SIDE_RIGHT ) +#define AV_CH_TOP_CENTER (1ULL << AV_CHAN_TOP_CENTER ) +#define AV_CH_TOP_FRONT_LEFT (1ULL << AV_CHAN_TOP_FRONT_LEFT ) +#define AV_CH_TOP_FRONT_CENTER (1ULL << AV_CHAN_TOP_FRONT_CENTER ) +#define AV_CH_TOP_FRONT_RIGHT (1ULL << AV_CHAN_TOP_FRONT_RIGHT ) +#define AV_CH_TOP_BACK_LEFT (1ULL << AV_CHAN_TOP_BACK_LEFT ) +#define AV_CH_TOP_BACK_CENTER (1ULL << AV_CHAN_TOP_BACK_CENTER ) +#define AV_CH_TOP_BACK_RIGHT (1ULL << AV_CHAN_TOP_BACK_RIGHT ) +#define AV_CH_STEREO_LEFT (1ULL << AV_CHAN_STEREO_LEFT ) +#define AV_CH_STEREO_RIGHT (1ULL << AV_CHAN_STEREO_RIGHT ) +#define AV_CH_WIDE_LEFT (1ULL << AV_CHAN_WIDE_LEFT ) +#define AV_CH_WIDE_RIGHT (1ULL << AV_CHAN_WIDE_RIGHT ) +#define AV_CH_SURROUND_DIRECT_LEFT (1ULL << AV_CHAN_SURROUND_DIRECT_LEFT ) +#define AV_CH_SURROUND_DIRECT_RIGHT (1ULL << AV_CHAN_SURROUND_DIRECT_RIGHT) +#define AV_CH_LOW_FREQUENCY_2 (1ULL << AV_CHAN_LOW_FREQUENCY_2 ) +#define AV_CH_TOP_SIDE_LEFT (1ULL << AV_CHAN_TOP_SIDE_LEFT ) +#define AV_CH_TOP_SIDE_RIGHT (1ULL << AV_CHAN_TOP_SIDE_RIGHT ) +#define AV_CH_BOTTOM_FRONT_CENTER (1ULL << AV_CHAN_BOTTOM_FRONT_CENTER ) +#define AV_CH_BOTTOM_FRONT_LEFT (1ULL << AV_CHAN_BOTTOM_FRONT_LEFT ) +#define AV_CH_BOTTOM_FRONT_RIGHT (1ULL << AV_CHAN_BOTTOM_FRONT_RIGHT ) + +#if FF_API_OLD_CHANNEL_LAYOUT +/** Channel mask value used for AVCodecContext.request_channel_layout + to indicate that the user requests the channel order of the decoder output + to be the native codec channel order. + @deprecated channel order is now indicated in a special field in + AVChannelLayout + */ +#define AV_CH_LAYOUT_NATIVE 0x8000000000000000ULL +#endif + +/** + * @} + * @defgroup channel_mask_c Audio channel layouts + * @{ + * */ +#define AV_CH_LAYOUT_MONO (AV_CH_FRONT_CENTER) +#define AV_CH_LAYOUT_STEREO (AV_CH_FRONT_LEFT|AV_CH_FRONT_RIGHT) +#define AV_CH_LAYOUT_2POINT1 (AV_CH_LAYOUT_STEREO|AV_CH_LOW_FREQUENCY) +#define AV_CH_LAYOUT_2_1 (AV_CH_LAYOUT_STEREO|AV_CH_BACK_CENTER) +#define AV_CH_LAYOUT_SURROUND (AV_CH_LAYOUT_STEREO|AV_CH_FRONT_CENTER) +#define AV_CH_LAYOUT_3POINT1 (AV_CH_LAYOUT_SURROUND|AV_CH_LOW_FREQUENCY) +#define AV_CH_LAYOUT_4POINT0 (AV_CH_LAYOUT_SURROUND|AV_CH_BACK_CENTER) +#define AV_CH_LAYOUT_4POINT1 (AV_CH_LAYOUT_4POINT0|AV_CH_LOW_FREQUENCY) +#define AV_CH_LAYOUT_2_2 (AV_CH_LAYOUT_STEREO|AV_CH_SIDE_LEFT|AV_CH_SIDE_RIGHT) +#define AV_CH_LAYOUT_QUAD (AV_CH_LAYOUT_STEREO|AV_CH_BACK_LEFT|AV_CH_BACK_RIGHT) +#define AV_CH_LAYOUT_5POINT0 (AV_CH_LAYOUT_SURROUND|AV_CH_SIDE_LEFT|AV_CH_SIDE_RIGHT) +#define AV_CH_LAYOUT_5POINT1 (AV_CH_LAYOUT_5POINT0|AV_CH_LOW_FREQUENCY) +#define AV_CH_LAYOUT_5POINT0_BACK (AV_CH_LAYOUT_SURROUND|AV_CH_BACK_LEFT|AV_CH_BACK_RIGHT) +#define AV_CH_LAYOUT_5POINT1_BACK (AV_CH_LAYOUT_5POINT0_BACK|AV_CH_LOW_FREQUENCY) +#define AV_CH_LAYOUT_6POINT0 (AV_CH_LAYOUT_5POINT0|AV_CH_BACK_CENTER) +#define AV_CH_LAYOUT_6POINT0_FRONT (AV_CH_LAYOUT_2_2|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER) +#define AV_CH_LAYOUT_HEXAGONAL (AV_CH_LAYOUT_5POINT0_BACK|AV_CH_BACK_CENTER) +#define AV_CH_LAYOUT_3POINT1POINT2 (AV_CH_LAYOUT_3POINT1|AV_CH_TOP_FRONT_LEFT|AV_CH_TOP_FRONT_RIGHT) +#define AV_CH_LAYOUT_6POINT1 (AV_CH_LAYOUT_5POINT1|AV_CH_BACK_CENTER) +#define AV_CH_LAYOUT_6POINT1_BACK (AV_CH_LAYOUT_5POINT1_BACK|AV_CH_BACK_CENTER) +#define AV_CH_LAYOUT_6POINT1_FRONT (AV_CH_LAYOUT_6POINT0_FRONT|AV_CH_LOW_FREQUENCY) +#define AV_CH_LAYOUT_7POINT0 (AV_CH_LAYOUT_5POINT0|AV_CH_BACK_LEFT|AV_CH_BACK_RIGHT) +#define AV_CH_LAYOUT_7POINT0_FRONT (AV_CH_LAYOUT_5POINT0|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER) +#define AV_CH_LAYOUT_7POINT1 (AV_CH_LAYOUT_5POINT1|AV_CH_BACK_LEFT|AV_CH_BACK_RIGHT) +#define AV_CH_LAYOUT_7POINT1_WIDE (AV_CH_LAYOUT_5POINT1|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER) +#define AV_CH_LAYOUT_7POINT1_WIDE_BACK (AV_CH_LAYOUT_5POINT1_BACK|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER) +#define AV_CH_LAYOUT_5POINT1POINT2_BACK (AV_CH_LAYOUT_5POINT1_BACK|AV_CH_TOP_FRONT_LEFT|AV_CH_TOP_FRONT_RIGHT) +#define AV_CH_LAYOUT_OCTAGONAL (AV_CH_LAYOUT_5POINT0|AV_CH_BACK_LEFT|AV_CH_BACK_CENTER|AV_CH_BACK_RIGHT) +#define AV_CH_LAYOUT_CUBE (AV_CH_LAYOUT_QUAD|AV_CH_TOP_FRONT_LEFT|AV_CH_TOP_FRONT_RIGHT|AV_CH_TOP_BACK_LEFT|AV_CH_TOP_BACK_RIGHT) +#define AV_CH_LAYOUT_5POINT1POINT4_BACK (AV_CH_LAYOUT_5POINT1POINT2_BACK|AV_CH_TOP_BACK_LEFT|AV_CH_TOP_BACK_RIGHT) +#define AV_CH_LAYOUT_7POINT1POINT2 (AV_CH_LAYOUT_7POINT1|AV_CH_TOP_FRONT_LEFT|AV_CH_TOP_FRONT_RIGHT) +#define AV_CH_LAYOUT_7POINT1POINT4_BACK (AV_CH_LAYOUT_7POINT1POINT2|AV_CH_TOP_BACK_LEFT|AV_CH_TOP_BACK_RIGHT) +#define AV_CH_LAYOUT_HEXADECAGONAL (AV_CH_LAYOUT_OCTAGONAL|AV_CH_WIDE_LEFT|AV_CH_WIDE_RIGHT|AV_CH_TOP_BACK_LEFT|AV_CH_TOP_BACK_RIGHT|AV_CH_TOP_BACK_CENTER|AV_CH_TOP_FRONT_CENTER|AV_CH_TOP_FRONT_LEFT|AV_CH_TOP_FRONT_RIGHT) +#define AV_CH_LAYOUT_STEREO_DOWNMIX (AV_CH_STEREO_LEFT|AV_CH_STEREO_RIGHT) +#define AV_CH_LAYOUT_22POINT2 (AV_CH_LAYOUT_7POINT1POINT4_BACK|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER|AV_CH_BACK_CENTER|AV_CH_LOW_FREQUENCY_2|AV_CH_TOP_FRONT_CENTER|AV_CH_TOP_CENTER|AV_CH_TOP_SIDE_LEFT|AV_CH_TOP_SIDE_RIGHT|AV_CH_TOP_BACK_CENTER|AV_CH_BOTTOM_FRONT_CENTER|AV_CH_BOTTOM_FRONT_LEFT|AV_CH_BOTTOM_FRONT_RIGHT) + +#define AV_CH_LAYOUT_7POINT1_TOP_BACK AV_CH_LAYOUT_5POINT1POINT2_BACK + +enum AVMatrixEncoding { + AV_MATRIX_ENCODING_NONE, + AV_MATRIX_ENCODING_DOLBY, + AV_MATRIX_ENCODING_DPLII, + AV_MATRIX_ENCODING_DPLIIX, + AV_MATRIX_ENCODING_DPLIIZ, + AV_MATRIX_ENCODING_DOLBYEX, + AV_MATRIX_ENCODING_DOLBYHEADPHONE, + AV_MATRIX_ENCODING_NB +}; + +/** + * @} + */ + +/** + * An AVChannelCustom defines a single channel within a custom order layout + * + * Unlike most structures in FFmpeg, sizeof(AVChannelCustom) is a part of the + * public ABI. + * + * No new fields may be added to it without a major version bump. + */ +typedef struct AVChannelCustom { + enum AVChannel id; + char name[16]; + void *opaque; +} AVChannelCustom; + +/** + * An AVChannelLayout holds information about the channel layout of audio data. + * + * A channel layout here is defined as a set of channels ordered in a specific + * way (unless the channel order is AV_CHANNEL_ORDER_UNSPEC, in which case an + * AVChannelLayout carries only the channel count). + * All orders may be treated as if they were AV_CHANNEL_ORDER_UNSPEC by + * ignoring everything but the channel count, as long as av_channel_layout_check() + * considers they are valid. + * + * Unlike most structures in FFmpeg, sizeof(AVChannelLayout) is a part of the + * public ABI and may be used by the caller. E.g. it may be allocated on stack + * or embedded in caller-defined structs. + * + * AVChannelLayout can be initialized as follows: + * - default initialization with {0}, followed by setting all used fields + * correctly; + * - by assigning one of the predefined AV_CHANNEL_LAYOUT_* initializers; + * - with a constructor function, such as av_channel_layout_default(), + * av_channel_layout_from_mask() or av_channel_layout_from_string(). + * + * The channel layout must be unitialized with av_channel_layout_uninit() + * + * Copying an AVChannelLayout via assigning is forbidden, + * av_channel_layout_copy() must be used instead (and its return value should + * be checked) + * + * No new fields may be added to it without a major version bump, except for + * new elements of the union fitting in sizeof(uint64_t). + */ +typedef struct AVChannelLayout { + /** + * Channel order used in this layout. + * This is a mandatory field. + */ + enum AVChannelOrder order; + + /** + * Number of channels in this layout. Mandatory field. + */ + int nb_channels; + + /** + * Details about which channels are present in this layout. + * For AV_CHANNEL_ORDER_UNSPEC, this field is undefined and must not be + * used. + */ + union { + /** + * This member must be used for AV_CHANNEL_ORDER_NATIVE, and may be used + * for AV_CHANNEL_ORDER_AMBISONIC to signal non-diegetic channels. + * It is a bitmask, where the position of each set bit means that the + * AVChannel with the corresponding value is present. + * + * I.e. when (mask & (1 << AV_CHAN_FOO)) is non-zero, then AV_CHAN_FOO + * is present in the layout. Otherwise it is not present. + * + * @note when a channel layout using a bitmask is constructed or + * modified manually (i.e. not using any of the av_channel_layout_* + * functions), the code doing it must ensure that the number of set bits + * is equal to nb_channels. + */ + uint64_t mask; + /** + * This member must be used when the channel order is + * AV_CHANNEL_ORDER_CUSTOM. It is a nb_channels-sized array, with each + * element signalling the presence of the AVChannel with the + * corresponding value in map[i].id. + * + * I.e. when map[i].id is equal to AV_CHAN_FOO, then AV_CH_FOO is the + * i-th channel in the audio data. + * + * When map[i].id is in the range between AV_CHAN_AMBISONIC_BASE and + * AV_CHAN_AMBISONIC_END (inclusive), the channel contains an ambisonic + * component with ACN index (as defined above) + * n = map[i].id - AV_CHAN_AMBISONIC_BASE. + * + * map[i].name may be filled with a 0-terminated string, in which case + * it will be used for the purpose of identifying the channel with the + * convenience functions below. Otherise it must be zeroed. + */ + AVChannelCustom *map; + } u; + + /** + * For some private data of the user. + */ + void *opaque; +} AVChannelLayout; + +/** + * Macro to define native channel layouts + * + * @note This doesn't use designated initializers for compatibility with C++ 17 and older. + */ +#define AV_CHANNEL_LAYOUT_MASK(nb, m) \ + { /* .order */ AV_CHANNEL_ORDER_NATIVE, \ + /* .nb_channels */ (nb), \ + /* .u.mask */ { m }, \ + /* .opaque */ NULL } + +/** + * @name Common pre-defined channel layouts + * @{ + */ +#define AV_CHANNEL_LAYOUT_MONO AV_CHANNEL_LAYOUT_MASK(1, AV_CH_LAYOUT_MONO) +#define AV_CHANNEL_LAYOUT_STEREO AV_CHANNEL_LAYOUT_MASK(2, AV_CH_LAYOUT_STEREO) +#define AV_CHANNEL_LAYOUT_2POINT1 AV_CHANNEL_LAYOUT_MASK(3, AV_CH_LAYOUT_2POINT1) +#define AV_CHANNEL_LAYOUT_2_1 AV_CHANNEL_LAYOUT_MASK(3, AV_CH_LAYOUT_2_1) +#define AV_CHANNEL_LAYOUT_SURROUND AV_CHANNEL_LAYOUT_MASK(3, AV_CH_LAYOUT_SURROUND) +#define AV_CHANNEL_LAYOUT_3POINT1 AV_CHANNEL_LAYOUT_MASK(4, AV_CH_LAYOUT_3POINT1) +#define AV_CHANNEL_LAYOUT_4POINT0 AV_CHANNEL_LAYOUT_MASK(4, AV_CH_LAYOUT_4POINT0) +#define AV_CHANNEL_LAYOUT_4POINT1 AV_CHANNEL_LAYOUT_MASK(5, AV_CH_LAYOUT_4POINT1) +#define AV_CHANNEL_LAYOUT_2_2 AV_CHANNEL_LAYOUT_MASK(4, AV_CH_LAYOUT_2_2) +#define AV_CHANNEL_LAYOUT_QUAD AV_CHANNEL_LAYOUT_MASK(4, AV_CH_LAYOUT_QUAD) +#define AV_CHANNEL_LAYOUT_5POINT0 AV_CHANNEL_LAYOUT_MASK(5, AV_CH_LAYOUT_5POINT0) +#define AV_CHANNEL_LAYOUT_5POINT1 AV_CHANNEL_LAYOUT_MASK(6, AV_CH_LAYOUT_5POINT1) +#define AV_CHANNEL_LAYOUT_5POINT0_BACK AV_CHANNEL_LAYOUT_MASK(5, AV_CH_LAYOUT_5POINT0_BACK) +#define AV_CHANNEL_LAYOUT_5POINT1_BACK AV_CHANNEL_LAYOUT_MASK(6, AV_CH_LAYOUT_5POINT1_BACK) +#define AV_CHANNEL_LAYOUT_6POINT0 AV_CHANNEL_LAYOUT_MASK(6, AV_CH_LAYOUT_6POINT0) +#define AV_CHANNEL_LAYOUT_6POINT0_FRONT AV_CHANNEL_LAYOUT_MASK(6, AV_CH_LAYOUT_6POINT0_FRONT) +#define AV_CHANNEL_LAYOUT_3POINT1POINT2 AV_CHANNEL_LAYOUT_MASK(6, AV_CH_LAYOUT_3POINT1POINT2) +#define AV_CHANNEL_LAYOUT_HEXAGONAL AV_CHANNEL_LAYOUT_MASK(6, AV_CH_LAYOUT_HEXAGONAL) +#define AV_CHANNEL_LAYOUT_6POINT1 AV_CHANNEL_LAYOUT_MASK(7, AV_CH_LAYOUT_6POINT1) +#define AV_CHANNEL_LAYOUT_6POINT1_BACK AV_CHANNEL_LAYOUT_MASK(7, AV_CH_LAYOUT_6POINT1_BACK) +#define AV_CHANNEL_LAYOUT_6POINT1_FRONT AV_CHANNEL_LAYOUT_MASK(7, AV_CH_LAYOUT_6POINT1_FRONT) +#define AV_CHANNEL_LAYOUT_7POINT0 AV_CHANNEL_LAYOUT_MASK(7, AV_CH_LAYOUT_7POINT0) +#define AV_CHANNEL_LAYOUT_7POINT0_FRONT AV_CHANNEL_LAYOUT_MASK(7, AV_CH_LAYOUT_7POINT0_FRONT) +#define AV_CHANNEL_LAYOUT_7POINT1 AV_CHANNEL_LAYOUT_MASK(8, AV_CH_LAYOUT_7POINT1) +#define AV_CHANNEL_LAYOUT_7POINT1_WIDE AV_CHANNEL_LAYOUT_MASK(8, AV_CH_LAYOUT_7POINT1_WIDE) +#define AV_CHANNEL_LAYOUT_7POINT1_WIDE_BACK AV_CHANNEL_LAYOUT_MASK(8, AV_CH_LAYOUT_7POINT1_WIDE_BACK) +#define AV_CHANNEL_LAYOUT_5POINT1POINT2_BACK AV_CHANNEL_LAYOUT_MASK(8, AV_CH_LAYOUT_5POINT1POINT2_BACK) +#define AV_CHANNEL_LAYOUT_OCTAGONAL AV_CHANNEL_LAYOUT_MASK(8, AV_CH_LAYOUT_OCTAGONAL) +#define AV_CHANNEL_LAYOUT_CUBE AV_CHANNEL_LAYOUT_MASK(8, AV_CH_LAYOUT_CUBE) +#define AV_CHANNEL_LAYOUT_5POINT1POINT4_BACK AV_CHANNEL_LAYOUT_MASK(10, AV_CH_LAYOUT_5POINT1POINT4_BACK) +#define AV_CHANNEL_LAYOUT_7POINT1POINT2 AV_CHANNEL_LAYOUT_MASK(10, AV_CH_LAYOUT_7POINT1POINT2) +#define AV_CHANNEL_LAYOUT_7POINT1POINT4_BACK AV_CHANNEL_LAYOUT_MASK(12, AV_CH_LAYOUT_7POINT1POINT4_BACK) +#define AV_CHANNEL_LAYOUT_HEXADECAGONAL AV_CHANNEL_LAYOUT_MASK(16, AV_CH_LAYOUT_HEXADECAGONAL) +#define AV_CHANNEL_LAYOUT_STEREO_DOWNMIX AV_CHANNEL_LAYOUT_MASK(2, AV_CH_LAYOUT_STEREO_DOWNMIX) +#define AV_CHANNEL_LAYOUT_22POINT2 AV_CHANNEL_LAYOUT_MASK(24, AV_CH_LAYOUT_22POINT2) + +#define AV_CHANNEL_LAYOUT_7POINT1_TOP_BACK AV_CHANNEL_LAYOUT_5POINT1POINT2_BACK + +#define AV_CHANNEL_LAYOUT_AMBISONIC_FIRST_ORDER \ + { /* .order */ AV_CHANNEL_ORDER_AMBISONIC, \ + /* .nb_channels */ 4, \ + /* .u.mask */ { 0 }, \ + /* .opaque */ NULL } +/** @} */ + +struct AVBPrint; + +#if FF_API_OLD_CHANNEL_LAYOUT +/** + * @name Deprecated Functions + * @{ + */ + +/** + * Return a channel layout id that matches name, or 0 if no match is found. + * + * name can be one or several of the following notations, + * separated by '+' or '|': + * - the name of an usual channel layout (mono, stereo, 4.0, quad, 5.0, + * 5.0(side), 5.1, 5.1(side), 7.1, 7.1(wide), downmix); + * - the name of a single channel (FL, FR, FC, LFE, BL, BR, FLC, FRC, BC, + * SL, SR, TC, TFL, TFC, TFR, TBL, TBC, TBR, DL, DR); + * - a number of channels, in decimal, followed by 'c', yielding + * the default channel layout for that number of channels (@see + * av_get_default_channel_layout); + * - a channel layout mask, in hexadecimal starting with "0x" (see the + * AV_CH_* macros). + * + * Example: "stereo+FC" = "2c+FC" = "2c+1c" = "0x7" + * + * @deprecated use av_channel_layout_from_string() + */ +attribute_deprecated +uint64_t av_get_channel_layout(const char *name); + +/** + * Return a channel layout and the number of channels based on the specified name. + * + * This function is similar to (@see av_get_channel_layout), but can also parse + * unknown channel layout specifications. + * + * @param[in] name channel layout specification string + * @param[out] channel_layout parsed channel layout (0 if unknown) + * @param[out] nb_channels number of channels + * + * @return 0 on success, AVERROR(EINVAL) if the parsing fails. + * @deprecated use av_channel_layout_from_string() + */ +attribute_deprecated +int av_get_extended_channel_layout(const char *name, uint64_t* channel_layout, int* nb_channels); + +/** + * Return a description of a channel layout. + * If nb_channels is <= 0, it is guessed from the channel_layout. + * + * @param buf put here the string containing the channel layout + * @param buf_size size in bytes of the buffer + * @param nb_channels number of channels + * @param channel_layout channel layout bitset + * @deprecated use av_channel_layout_describe() + */ +attribute_deprecated +void av_get_channel_layout_string(char *buf, int buf_size, int nb_channels, uint64_t channel_layout); + +/** + * Append a description of a channel layout to a bprint buffer. + * @deprecated use av_channel_layout_describe() + */ +attribute_deprecated +void av_bprint_channel_layout(struct AVBPrint *bp, int nb_channels, uint64_t channel_layout); + +/** + * Return the number of channels in the channel layout. + * @deprecated use AVChannelLayout.nb_channels + */ +attribute_deprecated +int av_get_channel_layout_nb_channels(uint64_t channel_layout); + +/** + * Return default channel layout for a given number of channels. + * + * @deprecated use av_channel_layout_default() + */ +attribute_deprecated +int64_t av_get_default_channel_layout(int nb_channels); + +/** + * Get the index of a channel in channel_layout. + * + * @param channel_layout channel layout bitset + * @param channel a channel layout describing exactly one channel which must be + * present in channel_layout. + * + * @return index of channel in channel_layout on success, a negative AVERROR + * on error. + * + * @deprecated use av_channel_layout_index_from_channel() + */ +attribute_deprecated +int av_get_channel_layout_channel_index(uint64_t channel_layout, + uint64_t channel); + +/** + * Get the channel with the given index in channel_layout. + * @deprecated use av_channel_layout_channel_from_index() + */ +attribute_deprecated +uint64_t av_channel_layout_extract_channel(uint64_t channel_layout, int index); + +/** + * Get the name of a given channel. + * + * @return channel name on success, NULL on error. + * + * @deprecated use av_channel_name() + */ +attribute_deprecated +const char *av_get_channel_name(uint64_t channel); + +/** + * Get the description of a given channel. + * + * @param channel a channel layout with a single channel + * @return channel description on success, NULL on error + * @deprecated use av_channel_description() + */ +attribute_deprecated +const char *av_get_channel_description(uint64_t channel); + +/** + * Get the value and name of a standard channel layout. + * + * @param[in] index index in an internal list, starting at 0 + * @param[out] layout channel layout mask + * @param[out] name name of the layout + * @return 0 if the layout exists, + * <0 if index is beyond the limits + * @deprecated use av_channel_layout_standard() + */ +attribute_deprecated +int av_get_standard_channel_layout(unsigned index, uint64_t *layout, + const char **name); +/** + * @} + */ +#endif + +/** + * Get a human readable string in an abbreviated form describing a given channel. + * This is the inverse function of @ref av_channel_from_string(). + * + * @param buf pre-allocated buffer where to put the generated string + * @param buf_size size in bytes of the buffer. + * @param channel the AVChannel whose name to get + * @return amount of bytes needed to hold the output string, or a negative AVERROR + * on failure. If the returned value is bigger than buf_size, then the + * string was truncated. + */ +int av_channel_name(char *buf, size_t buf_size, enum AVChannel channel); + +/** + * bprint variant of av_channel_name(). + * + * @note the string will be appended to the bprint buffer. + */ +void av_channel_name_bprint(struct AVBPrint *bp, enum AVChannel channel_id); + +/** + * Get a human readable string describing a given channel. + * + * @param buf pre-allocated buffer where to put the generated string + * @param buf_size size in bytes of the buffer. + * @param channel the AVChannel whose description to get + * @return amount of bytes needed to hold the output string, or a negative AVERROR + * on failure. If the returned value is bigger than buf_size, then the + * string was truncated. + */ +int av_channel_description(char *buf, size_t buf_size, enum AVChannel channel); + +/** + * bprint variant of av_channel_description(). + * + * @note the string will be appended to the bprint buffer. + */ +void av_channel_description_bprint(struct AVBPrint *bp, enum AVChannel channel_id); + +/** + * This is the inverse function of @ref av_channel_name(). + * + * @return the channel with the given name + * AV_CHAN_NONE when name does not identify a known channel + */ +enum AVChannel av_channel_from_string(const char *name); + +/** + * Initialize a native channel layout from a bitmask indicating which channels + * are present. + * + * @param channel_layout the layout structure to be initialized + * @param mask bitmask describing the channel layout + * + * @return 0 on success + * AVERROR(EINVAL) for invalid mask values + */ +int av_channel_layout_from_mask(AVChannelLayout *channel_layout, uint64_t mask); + +/** + * Initialize a channel layout from a given string description. + * The input string can be represented by: + * - the formal channel layout name (returned by av_channel_layout_describe()) + * - single or multiple channel names (returned by av_channel_name(), eg. "FL", + * or concatenated with "+", each optionally containing a custom name after + * a "@", eg. "FL@Left+FR@Right+LFE") + * - a decimal or hexadecimal value of a native channel layout (eg. "4" or "0x4") + * - the number of channels with default layout (eg. "4c") + * - the number of unordered channels (eg. "4C" or "4 channels") + * - the ambisonic order followed by optional non-diegetic channels (eg. + * "ambisonic 2+stereo") + * + * @param channel_layout input channel layout + * @param str string describing the channel layout + * @return 0 channel layout was detected, AVERROR_INVALIDATATA otherwise + */ +int av_channel_layout_from_string(AVChannelLayout *channel_layout, + const char *str); + +/** + * Get the default channel layout for a given number of channels. + * + * @param ch_layout the layout structure to be initialized + * @param nb_channels number of channels + */ +void av_channel_layout_default(AVChannelLayout *ch_layout, int nb_channels); + +/** + * Iterate over all standard channel layouts. + * + * @param opaque a pointer where libavutil will store the iteration state. Must + * point to NULL to start the iteration. + * + * @return the standard channel layout or NULL when the iteration is + * finished + */ +const AVChannelLayout *av_channel_layout_standard(void **opaque); + +/** + * Free any allocated data in the channel layout and reset the channel + * count to 0. + * + * @param channel_layout the layout structure to be uninitialized + */ +void av_channel_layout_uninit(AVChannelLayout *channel_layout); + +/** + * Make a copy of a channel layout. This differs from just assigning src to dst + * in that it allocates and copies the map for AV_CHANNEL_ORDER_CUSTOM. + * + * @note the destination channel_layout will be always uninitialized before copy. + * + * @param dst destination channel layout + * @param src source channel layout + * @return 0 on success, a negative AVERROR on error. + */ +int av_channel_layout_copy(AVChannelLayout *dst, const AVChannelLayout *src); + +/** + * Get a human-readable string describing the channel layout properties. + * The string will be in the same format that is accepted by + * @ref av_channel_layout_from_string(), allowing to rebuild the same + * channel layout, except for opaque pointers. + * + * @param channel_layout channel layout to be described + * @param buf pre-allocated buffer where to put the generated string + * @param buf_size size in bytes of the buffer. + * @return amount of bytes needed to hold the output string, or a negative AVERROR + * on failure. If the returned value is bigger than buf_size, then the + * string was truncated. + */ +int av_channel_layout_describe(const AVChannelLayout *channel_layout, + char *buf, size_t buf_size); + +/** + * bprint variant of av_channel_layout_describe(). + * + * @note the string will be appended to the bprint buffer. + * @return 0 on success, or a negative AVERROR value on failure. + */ +int av_channel_layout_describe_bprint(const AVChannelLayout *channel_layout, + struct AVBPrint *bp); + +/** + * Get the channel with the given index in a channel layout. + * + * @param channel_layout input channel layout + * @param idx index of the channel + * @return channel with the index idx in channel_layout on success or + * AV_CHAN_NONE on failure (if idx is not valid or the channel order is + * unspecified) + */ +enum AVChannel +av_channel_layout_channel_from_index(const AVChannelLayout *channel_layout, unsigned int idx); + +/** + * Get the index of a given channel in a channel layout. In case multiple + * channels are found, only the first match will be returned. + * + * @param channel_layout input channel layout + * @param channel the channel whose index to obtain + * @return index of channel in channel_layout on success or a negative number if + * channel is not present in channel_layout. + */ +int av_channel_layout_index_from_channel(const AVChannelLayout *channel_layout, + enum AVChannel channel); + +/** + * Get the index in a channel layout of a channel described by the given string. + * In case multiple channels are found, only the first match will be returned. + * + * This function accepts channel names in the same format as + * @ref av_channel_from_string(). + * + * @param channel_layout input channel layout + * @param name string describing the channel whose index to obtain + * @return a channel index described by the given string, or a negative AVERROR + * value. + */ +int av_channel_layout_index_from_string(const AVChannelLayout *channel_layout, + const char *name); + +/** + * Get a channel described by the given string. + * + * This function accepts channel names in the same format as + * @ref av_channel_from_string(). + * + * @param channel_layout input channel layout + * @param name string describing the channel to obtain + * @return a channel described by the given string in channel_layout on success + * or AV_CHAN_NONE on failure (if the string is not valid or the channel + * order is unspecified) + */ +enum AVChannel +av_channel_layout_channel_from_string(const AVChannelLayout *channel_layout, + const char *name); + +/** + * Find out what channels from a given set are present in a channel layout, + * without regard for their positions. + * + * @param channel_layout input channel layout + * @param mask a combination of AV_CH_* representing a set of channels + * @return a bitfield representing all the channels from mask that are present + * in channel_layout + */ +uint64_t av_channel_layout_subset(const AVChannelLayout *channel_layout, + uint64_t mask); + +/** + * Check whether a channel layout is valid, i.e. can possibly describe audio + * data. + * + * @param channel_layout input channel layout + * @return 1 if channel_layout is valid, 0 otherwise. + */ +int av_channel_layout_check(const AVChannelLayout *channel_layout); + +/** + * Check whether two channel layouts are semantically the same, i.e. the same + * channels are present on the same positions in both. + * + * If one of the channel layouts is AV_CHANNEL_ORDER_UNSPEC, while the other is + * not, they are considered to be unequal. If both are AV_CHANNEL_ORDER_UNSPEC, + * they are considered equal iff the channel counts are the same in both. + * + * @param chl input channel layout + * @param chl1 input channel layout + * @return 0 if chl and chl1 are equal, 1 if they are not equal. A negative + * AVERROR code if one or both are invalid. + */ +int av_channel_layout_compare(const AVChannelLayout *chl, const AVChannelLayout *chl1); + +/** + * @} + */ + +#endif /* AVUTIL_CHANNEL_LAYOUT_H */ diff --git a/libs/FFmpeg/include/libavutil/common.h b/libs/FFmpeg/include/libavutil/common.h new file mode 100644 index 0000000..de2140a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/common.h @@ -0,0 +1,579 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * common internal and external API header + */ + +#ifndef AVUTIL_COMMON_H +#define AVUTIL_COMMON_H + +#if defined(__cplusplus) && !defined(__STDC_CONSTANT_MACROS) && !defined(UINT64_C) +#error missing -D__STDC_CONSTANT_MACROS / #define __STDC_CONSTANT_MACROS +#endif + +#include +#include +#include +#include +#include +#include +#include +#include + +#include "attributes.h" +#include "error.h" +#include "macros.h" + +//rounded division & shift +#define RSHIFT(a,b) ((a) > 0 ? ((a) + ((1<<(b))>>1))>>(b) : ((a) + ((1<<(b))>>1)-1)>>(b)) +/* assume b>0 */ +#define ROUNDED_DIV(a,b) (((a)>=0 ? (a) + ((b)>>1) : (a) - ((b)>>1))/(b)) +/* Fast a/(1<=0 and b>=0 */ +#define AV_CEIL_RSHIFT(a,b) (!av_builtin_constant_p(b) ? -((-(a)) >> (b)) \ + : ((a) + (1<<(b)) - 1) >> (b)) +/* Backwards compat. */ +#define FF_CEIL_RSHIFT AV_CEIL_RSHIFT + +#define FFUDIV(a,b) (((a)>0 ?(a):(a)-(b)+1) / (b)) +#define FFUMOD(a,b) ((a)-(b)*FFUDIV(a,b)) + +/** + * Absolute value, Note, INT_MIN / INT64_MIN result in undefined behavior as they + * are not representable as absolute values of their type. This is the same + * as with *abs() + * @see FFNABS() + */ +#define FFABS(a) ((a) >= 0 ? (a) : (-(a))) +#define FFSIGN(a) ((a) > 0 ? 1 : -1) + +/** + * Negative Absolute value. + * this works for all integers of all types. + * As with many macros, this evaluates its argument twice, it thus must not have + * a sideeffect, that is FFNABS(x++) has undefined behavior. + */ +#define FFNABS(a) ((a) <= 0 ? (a) : (-(a))) + +/** + * Unsigned Absolute value. + * This takes the absolute value of a signed int and returns it as a unsigned. + * This also works with INT_MIN which would otherwise not be representable + * As with many macros, this evaluates its argument twice. + */ +#define FFABSU(a) ((a) <= 0 ? -(unsigned)(a) : (unsigned)(a)) +#define FFABS64U(a) ((a) <= 0 ? -(uint64_t)(a) : (uint64_t)(a)) + +/* misc math functions */ + +#ifdef HAVE_AV_CONFIG_H +# include "config.h" +# include "intmath.h" +#endif + +#ifndef av_ceil_log2 +# define av_ceil_log2 av_ceil_log2_c +#endif +#ifndef av_clip +# define av_clip av_clip_c +#endif +#ifndef av_clip64 +# define av_clip64 av_clip64_c +#endif +#ifndef av_clip_uint8 +# define av_clip_uint8 av_clip_uint8_c +#endif +#ifndef av_clip_int8 +# define av_clip_int8 av_clip_int8_c +#endif +#ifndef av_clip_uint16 +# define av_clip_uint16 av_clip_uint16_c +#endif +#ifndef av_clip_int16 +# define av_clip_int16 av_clip_int16_c +#endif +#ifndef av_clipl_int32 +# define av_clipl_int32 av_clipl_int32_c +#endif +#ifndef av_clip_intp2 +# define av_clip_intp2 av_clip_intp2_c +#endif +#ifndef av_clip_uintp2 +# define av_clip_uintp2 av_clip_uintp2_c +#endif +#ifndef av_mod_uintp2 +# define av_mod_uintp2 av_mod_uintp2_c +#endif +#ifndef av_sat_add32 +# define av_sat_add32 av_sat_add32_c +#endif +#ifndef av_sat_dadd32 +# define av_sat_dadd32 av_sat_dadd32_c +#endif +#ifndef av_sat_sub32 +# define av_sat_sub32 av_sat_sub32_c +#endif +#ifndef av_sat_dsub32 +# define av_sat_dsub32 av_sat_dsub32_c +#endif +#ifndef av_sat_add64 +# define av_sat_add64 av_sat_add64_c +#endif +#ifndef av_sat_sub64 +# define av_sat_sub64 av_sat_sub64_c +#endif +#ifndef av_clipf +# define av_clipf av_clipf_c +#endif +#ifndef av_clipd +# define av_clipd av_clipd_c +#endif +#ifndef av_popcount +# define av_popcount av_popcount_c +#endif +#ifndef av_popcount64 +# define av_popcount64 av_popcount64_c +#endif +#ifndef av_parity +# define av_parity av_parity_c +#endif + +#ifndef av_log2 +av_const int av_log2(unsigned v); +#endif + +#ifndef av_log2_16bit +av_const int av_log2_16bit(unsigned v); +#endif + +/** + * Clip a signed integer value into the amin-amax range. + * @param a value to clip + * @param amin minimum value of the clip range + * @param amax maximum value of the clip range + * @return clipped value + */ +static av_always_inline av_const int av_clip_c(int a, int amin, int amax) +{ +#if defined(HAVE_AV_CONFIG_H) && defined(ASSERT_LEVEL) && ASSERT_LEVEL >= 2 + if (amin > amax) abort(); +#endif + if (a < amin) return amin; + else if (a > amax) return amax; + else return a; +} + +/** + * Clip a signed 64bit integer value into the amin-amax range. + * @param a value to clip + * @param amin minimum value of the clip range + * @param amax maximum value of the clip range + * @return clipped value + */ +static av_always_inline av_const int64_t av_clip64_c(int64_t a, int64_t amin, int64_t amax) +{ +#if defined(HAVE_AV_CONFIG_H) && defined(ASSERT_LEVEL) && ASSERT_LEVEL >= 2 + if (amin > amax) abort(); +#endif + if (a < amin) return amin; + else if (a > amax) return amax; + else return a; +} + +/** + * Clip a signed integer value into the 0-255 range. + * @param a value to clip + * @return clipped value + */ +static av_always_inline av_const uint8_t av_clip_uint8_c(int a) +{ + if (a&(~0xFF)) return (~a)>>31; + else return a; +} + +/** + * Clip a signed integer value into the -128,127 range. + * @param a value to clip + * @return clipped value + */ +static av_always_inline av_const int8_t av_clip_int8_c(int a) +{ + if ((a+0x80U) & ~0xFF) return (a>>31) ^ 0x7F; + else return a; +} + +/** + * Clip a signed integer value into the 0-65535 range. + * @param a value to clip + * @return clipped value + */ +static av_always_inline av_const uint16_t av_clip_uint16_c(int a) +{ + if (a&(~0xFFFF)) return (~a)>>31; + else return a; +} + +/** + * Clip a signed integer value into the -32768,32767 range. + * @param a value to clip + * @return clipped value + */ +static av_always_inline av_const int16_t av_clip_int16_c(int a) +{ + if ((a+0x8000U) & ~0xFFFF) return (a>>31) ^ 0x7FFF; + else return a; +} + +/** + * Clip a signed 64-bit integer value into the -2147483648,2147483647 range. + * @param a value to clip + * @return clipped value + */ +static av_always_inline av_const int32_t av_clipl_int32_c(int64_t a) +{ + if ((a+0x80000000u) & ~UINT64_C(0xFFFFFFFF)) return (int32_t)((a>>63) ^ 0x7FFFFFFF); + else return (int32_t)a; +} + +/** + * Clip a signed integer into the -(2^p),(2^p-1) range. + * @param a value to clip + * @param p bit position to clip at + * @return clipped value + */ +static av_always_inline av_const int av_clip_intp2_c(int a, int p) +{ + if (((unsigned)a + (1 << p)) & ~((2 << p) - 1)) + return (a >> 31) ^ ((1 << p) - 1); + else + return a; +} + +/** + * Clip a signed integer to an unsigned power of two range. + * @param a value to clip + * @param p bit position to clip at + * @return clipped value + */ +static av_always_inline av_const unsigned av_clip_uintp2_c(int a, int p) +{ + if (a & ~((1<> 31 & ((1<= 0) + return INT64_MAX ^ (b >> 63); + return s; +#endif +} + +/** + * Subtract two signed 64-bit values with saturation. + * + * @param a one value + * @param b another value + * @return difference with signed saturation + */ +static av_always_inline int64_t av_sat_sub64_c(int64_t a, int64_t b) { +#if (!defined(__INTEL_COMPILER) && AV_GCC_VERSION_AT_LEAST(5,1)) || AV_HAS_BUILTIN(__builtin_sub_overflow) + int64_t tmp; + return !__builtin_sub_overflow(a, b, &tmp) ? tmp : (tmp < 0 ? INT64_MAX : INT64_MIN); +#else + if (b <= 0 && a >= INT64_MAX + b) + return INT64_MAX; + if (b >= 0 && a <= INT64_MIN + b) + return INT64_MIN; + return a - b; +#endif +} + +/** + * Clip a float value into the amin-amax range. + * If a is nan or -inf amin will be returned. + * If a is +inf amax will be returned. + * @param a value to clip + * @param amin minimum value of the clip range + * @param amax maximum value of the clip range + * @return clipped value + */ +static av_always_inline av_const float av_clipf_c(float a, float amin, float amax) +{ +#if defined(HAVE_AV_CONFIG_H) && defined(ASSERT_LEVEL) && ASSERT_LEVEL >= 2 + if (amin > amax) abort(); +#endif + return FFMIN(FFMAX(a, amin), amax); +} + +/** + * Clip a double value into the amin-amax range. + * If a is nan or -inf amin will be returned. + * If a is +inf amax will be returned. + * @param a value to clip + * @param amin minimum value of the clip range + * @param amax maximum value of the clip range + * @return clipped value + */ +static av_always_inline av_const double av_clipd_c(double a, double amin, double amax) +{ +#if defined(HAVE_AV_CONFIG_H) && defined(ASSERT_LEVEL) && ASSERT_LEVEL >= 2 + if (amin > amax) abort(); +#endif + return FFMIN(FFMAX(a, amin), amax); +} + +/** Compute ceil(log2(x)). + * @param x value used to compute ceil(log2(x)) + * @return computed ceiling of log2(x) + */ +static av_always_inline av_const int av_ceil_log2_c(int x) +{ + return av_log2((x - 1U) << 1); +} + +/** + * Count number of bits set to one in x + * @param x value to count bits of + * @return the number of bits set to one in x + */ +static av_always_inline av_const int av_popcount_c(uint32_t x) +{ + x -= (x >> 1) & 0x55555555; + x = (x & 0x33333333) + ((x >> 2) & 0x33333333); + x = (x + (x >> 4)) & 0x0F0F0F0F; + x += x >> 8; + return (x + (x >> 16)) & 0x3F; +} + +/** + * Count number of bits set to one in x + * @param x value to count bits of + * @return the number of bits set to one in x + */ +static av_always_inline av_const int av_popcount64_c(uint64_t x) +{ + return av_popcount((uint32_t)x) + av_popcount((uint32_t)(x >> 32)); +} + +static av_always_inline av_const int av_parity_c(uint32_t v) +{ + return av_popcount(v) & 1; +} + +/** + * Convert a UTF-8 character (up to 4 bytes) to its 32-bit UCS-4 encoded form. + * + * @param val Output value, must be an lvalue of type uint32_t. + * @param GET_BYTE Expression reading one byte from the input. + * Evaluated up to 7 times (4 for the currently + * assigned Unicode range). With a memory buffer + * input, this could be *ptr++, or if you want to make sure + * that *ptr stops at the end of a NULL terminated string then + * *ptr ? *ptr++ : 0 + * @param ERROR Expression to be evaluated on invalid input, + * typically a goto statement. + * + * @warning ERROR should not contain a loop control statement which + * could interact with the internal while loop, and should force an + * exit from the macro code (e.g. through a goto or a return) in order + * to prevent undefined results. + */ +#define GET_UTF8(val, GET_BYTE, ERROR)\ + val= (GET_BYTE);\ + {\ + uint32_t top = (val & 128) >> 1;\ + if ((val & 0xc0) == 0x80 || val >= 0xFE)\ + {ERROR}\ + while (val & top) {\ + unsigned int tmp = (GET_BYTE) - 128;\ + if(tmp>>6)\ + {ERROR}\ + val= (val<<6) + tmp;\ + top <<= 5;\ + }\ + val &= (top << 1) - 1;\ + } + +/** + * Convert a UTF-16 character (2 or 4 bytes) to its 32-bit UCS-4 encoded form. + * + * @param val Output value, must be an lvalue of type uint32_t. + * @param GET_16BIT Expression returning two bytes of UTF-16 data converted + * to native byte order. Evaluated one or two times. + * @param ERROR Expression to be evaluated on invalid input, + * typically a goto statement. + */ +#define GET_UTF16(val, GET_16BIT, ERROR)\ + val = (GET_16BIT);\ + {\ + unsigned int hi = val - 0xD800;\ + if (hi < 0x800) {\ + val = (GET_16BIT) - 0xDC00;\ + if (val > 0x3FFU || hi > 0x3FFU)\ + {ERROR}\ + val += (hi<<10) + 0x10000;\ + }\ + }\ + +/** + * @def PUT_UTF8(val, tmp, PUT_BYTE) + * Convert a 32-bit Unicode character to its UTF-8 encoded form (up to 4 bytes long). + * @param val is an input-only argument and should be of type uint32_t. It holds + * a UCS-4 encoded Unicode character that is to be converted to UTF-8. If + * val is given as a function it is executed only once. + * @param tmp is a temporary variable and should be of type uint8_t. It + * represents an intermediate value during conversion that is to be + * output by PUT_BYTE. + * @param PUT_BYTE writes the converted UTF-8 bytes to any proper destination. + * It could be a function or a statement, and uses tmp as the input byte. + * For example, PUT_BYTE could be "*output++ = tmp;" PUT_BYTE will be + * executed up to 4 times for values in the valid UTF-8 range and up to + * 7 times in the general case, depending on the length of the converted + * Unicode character. + */ +#define PUT_UTF8(val, tmp, PUT_BYTE)\ + {\ + int bytes, shift;\ + uint32_t in = val;\ + if (in < 0x80) {\ + tmp = in;\ + PUT_BYTE\ + } else {\ + bytes = (av_log2(in) + 4) / 5;\ + shift = (bytes - 1) * 6;\ + tmp = (256 - (256 >> bytes)) | (in >> shift);\ + PUT_BYTE\ + while (shift >= 6) {\ + shift -= 6;\ + tmp = 0x80 | ((in >> shift) & 0x3f);\ + PUT_BYTE\ + }\ + }\ + } + +/** + * @def PUT_UTF16(val, tmp, PUT_16BIT) + * Convert a 32-bit Unicode character to its UTF-16 encoded form (2 or 4 bytes). + * @param val is an input-only argument and should be of type uint32_t. It holds + * a UCS-4 encoded Unicode character that is to be converted to UTF-16. If + * val is given as a function it is executed only once. + * @param tmp is a temporary variable and should be of type uint16_t. It + * represents an intermediate value during conversion that is to be + * output by PUT_16BIT. + * @param PUT_16BIT writes the converted UTF-16 data to any proper destination + * in desired endianness. It could be a function or a statement, and uses tmp + * as the input byte. For example, PUT_BYTE could be "*output++ = tmp;" + * PUT_BYTE will be executed 1 or 2 times depending on input character. + */ +#define PUT_UTF16(val, tmp, PUT_16BIT)\ + {\ + uint32_t in = val;\ + if (in < 0x10000) {\ + tmp = in;\ + PUT_16BIT\ + } else {\ + tmp = 0xD800 | ((in - 0x10000) >> 10);\ + PUT_16BIT\ + tmp = 0xDC00 | ((in - 0x10000) & 0x3FF);\ + PUT_16BIT\ + }\ + }\ + + + +#include "mem.h" + +#ifdef HAVE_AV_CONFIG_H +# include "internal.h" +#endif /* HAVE_AV_CONFIG_H */ + +#endif /* AVUTIL_COMMON_H */ diff --git a/libs/FFmpeg/include/libavutil/cpu.h b/libs/FFmpeg/include/libavutil/cpu.h new file mode 100644 index 0000000..8dff341 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/cpu.h @@ -0,0 +1,137 @@ +/* + * Copyright (c) 2000, 2001, 2002 Fabrice Bellard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_CPU_H +#define AVUTIL_CPU_H + +#include + +#define AV_CPU_FLAG_FORCE 0x80000000 /* force usage of selected flags (OR) */ + + /* lower 16 bits - CPU features */ +#define AV_CPU_FLAG_MMX 0x0001 ///< standard MMX +#define AV_CPU_FLAG_MMXEXT 0x0002 ///< SSE integer functions or AMD MMX ext +#define AV_CPU_FLAG_MMX2 0x0002 ///< SSE integer functions or AMD MMX ext +#define AV_CPU_FLAG_3DNOW 0x0004 ///< AMD 3DNOW +#define AV_CPU_FLAG_SSE 0x0008 ///< SSE functions +#define AV_CPU_FLAG_SSE2 0x0010 ///< PIV SSE2 functions +#define AV_CPU_FLAG_SSE2SLOW 0x40000000 ///< SSE2 supported, but usually not faster + ///< than regular MMX/SSE (e.g. Core1) +#define AV_CPU_FLAG_3DNOWEXT 0x0020 ///< AMD 3DNowExt +#define AV_CPU_FLAG_SSE3 0x0040 ///< Prescott SSE3 functions +#define AV_CPU_FLAG_SSE3SLOW 0x20000000 ///< SSE3 supported, but usually not faster + ///< than regular MMX/SSE (e.g. Core1) +#define AV_CPU_FLAG_SSSE3 0x0080 ///< Conroe SSSE3 functions +#define AV_CPU_FLAG_SSSE3SLOW 0x4000000 ///< SSSE3 supported, but usually not faster +#define AV_CPU_FLAG_ATOM 0x10000000 ///< Atom processor, some SSSE3 instructions are slower +#define AV_CPU_FLAG_SSE4 0x0100 ///< Penryn SSE4.1 functions +#define AV_CPU_FLAG_SSE42 0x0200 ///< Nehalem SSE4.2 functions +#define AV_CPU_FLAG_AESNI 0x80000 ///< Advanced Encryption Standard functions +#define AV_CPU_FLAG_AVX 0x4000 ///< AVX functions: requires OS support even if YMM registers aren't used +#define AV_CPU_FLAG_AVXSLOW 0x8000000 ///< AVX supported, but slow when using YMM registers (e.g. Bulldozer) +#define AV_CPU_FLAG_XOP 0x0400 ///< Bulldozer XOP functions +#define AV_CPU_FLAG_FMA4 0x0800 ///< Bulldozer FMA4 functions +#define AV_CPU_FLAG_CMOV 0x1000 ///< supports cmov instruction +#define AV_CPU_FLAG_AVX2 0x8000 ///< AVX2 functions: requires OS support even if YMM registers aren't used +#define AV_CPU_FLAG_FMA3 0x10000 ///< Haswell FMA3 functions +#define AV_CPU_FLAG_BMI1 0x20000 ///< Bit Manipulation Instruction Set 1 +#define AV_CPU_FLAG_BMI2 0x40000 ///< Bit Manipulation Instruction Set 2 +#define AV_CPU_FLAG_AVX512 0x100000 ///< AVX-512 functions: requires OS support even if YMM/ZMM registers aren't used +#define AV_CPU_FLAG_AVX512ICL 0x200000 ///< F/CD/BW/DQ/VL/VNNI/IFMA/VBMI/VBMI2/VPOPCNTDQ/BITALG/GFNI/VAES/VPCLMULQDQ +#define AV_CPU_FLAG_SLOW_GATHER 0x2000000 ///< CPU has slow gathers. + +#define AV_CPU_FLAG_ALTIVEC 0x0001 ///< standard +#define AV_CPU_FLAG_VSX 0x0002 ///< ISA 2.06 +#define AV_CPU_FLAG_POWER8 0x0004 ///< ISA 2.07 + +#define AV_CPU_FLAG_ARMV5TE (1 << 0) +#define AV_CPU_FLAG_ARMV6 (1 << 1) +#define AV_CPU_FLAG_ARMV6T2 (1 << 2) +#define AV_CPU_FLAG_VFP (1 << 3) +#define AV_CPU_FLAG_VFPV3 (1 << 4) +#define AV_CPU_FLAG_NEON (1 << 5) +#define AV_CPU_FLAG_ARMV8 (1 << 6) +#define AV_CPU_FLAG_VFP_VM (1 << 7) ///< VFPv2 vector mode, deprecated in ARMv7-A and unavailable in various CPUs implementations +#define AV_CPU_FLAG_DOTPROD (1 << 8) +#define AV_CPU_FLAG_I8MM (1 << 9) +#define AV_CPU_FLAG_SETEND (1 <<16) + +#define AV_CPU_FLAG_MMI (1 << 0) +#define AV_CPU_FLAG_MSA (1 << 1) + +//Loongarch SIMD extension. +#define AV_CPU_FLAG_LSX (1 << 0) +#define AV_CPU_FLAG_LASX (1 << 1) + +// RISC-V extensions +#define AV_CPU_FLAG_RVI (1 << 0) ///< I (full GPR bank) +#define AV_CPU_FLAG_RVF (1 << 1) ///< F (single precision FP) +#define AV_CPU_FLAG_RVD (1 << 2) ///< D (double precision FP) +#define AV_CPU_FLAG_RVV_I32 (1 << 3) ///< Vectors of 8/16/32-bit int's */ +#define AV_CPU_FLAG_RVV_F32 (1 << 4) ///< Vectors of float's */ +#define AV_CPU_FLAG_RVV_I64 (1 << 5) ///< Vectors of 64-bit int's */ +#define AV_CPU_FLAG_RVV_F64 (1 << 6) ///< Vectors of double's +#define AV_CPU_FLAG_RVB_BASIC (1 << 7) ///< Basic bit-manipulations +#define AV_CPU_FLAG_RVB_ADDR (1 << 8) ///< Address bit-manipulations + +/** + * Return the flags which specify extensions supported by the CPU. + * The returned value is affected by av_force_cpu_flags() if that was used + * before. So av_get_cpu_flags() can easily be used in an application to + * detect the enabled cpu flags. + */ +int av_get_cpu_flags(void); + +/** + * Disables cpu detection and forces the specified flags. + * -1 is a special case that disables forcing of specific flags. + */ +void av_force_cpu_flags(int flags); + +/** + * Parse CPU caps from a string and update the given AV_CPU_* flags based on that. + * + * @return negative on error. + */ +int av_parse_cpu_caps(unsigned *flags, const char *s); + +/** + * @return the number of logical CPU cores present. + */ +int av_cpu_count(void); + +/** + * Overrides cpu count detection and forces the specified count. + * Count < 1 disables forcing of specific count. + */ +void av_cpu_force_count(int count); + +/** + * Get the maximum data alignment that may be required by FFmpeg. + * + * Note that this is affected by the build configuration and the CPU flags mask, + * so e.g. if the CPU supports AVX, but libavutil has been built with + * --disable-avx or the AV_CPU_FLAG_AVX flag has been disabled through + * av_set_cpu_flags_mask(), then this function will behave as if AVX is not + * present. + */ +size_t av_cpu_max_align(void); + +#endif /* AVUTIL_CPU_H */ diff --git a/libs/FFmpeg/include/libavutil/crc.h b/libs/FFmpeg/include/libavutil/crc.h new file mode 100644 index 0000000..7f59812 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/crc.h @@ -0,0 +1,102 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_crc32 + * Public header for CRC hash function implementation. + */ + +#ifndef AVUTIL_CRC_H +#define AVUTIL_CRC_H + +#include +#include +#include "attributes.h" + +/** + * @defgroup lavu_crc32 CRC + * @ingroup lavu_hash + * CRC (Cyclic Redundancy Check) hash function implementation. + * + * This module supports numerous CRC polynomials, in addition to the most + * widely used CRC-32-IEEE. See @ref AVCRCId for a list of available + * polynomials. + * + * @{ + */ + +typedef uint32_t AVCRC; + +typedef enum { + AV_CRC_8_ATM, + AV_CRC_16_ANSI, + AV_CRC_16_CCITT, + AV_CRC_32_IEEE, + AV_CRC_32_IEEE_LE, /*< reversed bitorder version of AV_CRC_32_IEEE */ + AV_CRC_16_ANSI_LE, /*< reversed bitorder version of AV_CRC_16_ANSI */ + AV_CRC_24_IEEE, + AV_CRC_8_EBU, + AV_CRC_MAX, /*< Not part of public API! Do not use outside libavutil. */ +}AVCRCId; + +/** + * Initialize a CRC table. + * @param ctx must be an array of size sizeof(AVCRC)*257 or sizeof(AVCRC)*1024 + * @param le If 1, the lowest bit represents the coefficient for the highest + * exponent of the corresponding polynomial (both for poly and + * actual CRC). + * If 0, you must swap the CRC parameter and the result of av_crc + * if you need the standard representation (can be simplified in + * most cases to e.g. bswap16): + * av_bswap32(crc << (32-bits)) + * @param bits number of bits for the CRC + * @param poly generator polynomial without the x**bits coefficient, in the + * representation as specified by le + * @param ctx_size size of ctx in bytes + * @return <0 on failure + */ +int av_crc_init(AVCRC *ctx, int le, int bits, uint32_t poly, int ctx_size); + +/** + * Get an initialized standard CRC table. + * @param crc_id ID of a standard CRC + * @return a pointer to the CRC table or NULL on failure + */ +const AVCRC *av_crc_get_table(AVCRCId crc_id); + +/** + * Calculate the CRC of a block. + * @param ctx initialized AVCRC array (see av_crc_init()) + * @param crc CRC of previous blocks if any or initial value for CRC + * @param buffer buffer whose CRC to calculate + * @param length length of the buffer + * @return CRC updated with the data from the given block + * + * @see av_crc_init() "le" parameter + */ +uint32_t av_crc(const AVCRC *ctx, uint32_t crc, + const uint8_t *buffer, size_t length) av_pure; + +/** + * @} + */ + +#endif /* AVUTIL_CRC_H */ diff --git a/libs/FFmpeg/include/libavutil/csp.h b/libs/FFmpeg/include/libavutil/csp.h new file mode 100644 index 0000000..73bce52 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/csp.h @@ -0,0 +1,150 @@ +/* + * Copyright (c) 2015 Kevin Wheatley + * Copyright (c) 2016 Ronald S. Bultje + * Copyright (c) 2023 Leo Izen + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_CSP_H +#define AVUTIL_CSP_H + +#include "pixfmt.h" +#include "rational.h" + +/** + * @file + * Colorspace value utility functions for libavutil. + * @ingroup lavu_math_csp + * @author Ronald S. Bultje + * @author Leo Izen + * @author Kevin Wheatley + */ + +/** + * @defgroup lavu_math_csp Colorspace Utility + * @ingroup lavu_math + * @{ + */ + +/** + * Struct containing luma coefficients to be used for RGB to YUV/YCoCg, or similar + * calculations. + */ +typedef struct AVLumaCoefficients { + AVRational cr, cg, cb; +} AVLumaCoefficients; + +/** + * Struct containing chromaticity x and y values for the standard CIE 1931 + * chromaticity definition. + */ +typedef struct AVCIExy { + AVRational x, y; +} AVCIExy; + +/** + * Struct defining the red, green, and blue primary locations in terms of CIE + * 1931 chromaticity x and y. + */ +typedef struct AVPrimaryCoefficients { + AVCIExy r, g, b; +} AVPrimaryCoefficients; + +/** + * Struct defining white point location in terms of CIE 1931 chromaticity x + * and y. + */ +typedef AVCIExy AVWhitepointCoefficients; + +/** + * Struct that contains both white point location and primaries location, providing + * the complete description of a color gamut. + */ +typedef struct AVColorPrimariesDesc { + AVWhitepointCoefficients wp; + AVPrimaryCoefficients prim; +} AVColorPrimariesDesc; + +/** + * Function pointer representing a double -> double transfer function that performs + * an EOTF transfer inversion. This function outputs linear light. + */ +typedef double (*av_csp_trc_function)(double); + +/** + * Retrieves the Luma coefficients necessary to construct a conversion matrix + * from an enum constant describing the colorspace. + * @param csp An enum constant indicating YUV or similar colorspace. + * @return The Luma coefficients associated with that colorspace, or NULL + * if the constant is unknown to libavutil. + */ +const AVLumaCoefficients *av_csp_luma_coeffs_from_avcsp(enum AVColorSpace csp); + +/** + * Retrieves a complete gamut description from an enum constant describing the + * color primaries. + * @param prm An enum constant indicating primaries + * @return A description of the colorspace gamut associated with that enum + * constant, or NULL if the constant is unknown to libavutil. + */ +const AVColorPrimariesDesc *av_csp_primaries_desc_from_id(enum AVColorPrimaries prm); + +/** + * Detects which enum AVColorPrimaries constant corresponds to the given complete + * gamut description. + * @see enum AVColorPrimaries + * @param prm A description of the colorspace gamut + * @return The enum constant associated with this gamut, or + * AVCOL_PRI_UNSPECIFIED if no clear match can be idenitified. + */ +enum AVColorPrimaries av_csp_primaries_id_from_desc(const AVColorPrimariesDesc *prm); + +/** + * Determine a suitable 'gamma' value to match the supplied + * AVColorTransferCharacteristic. + * + * See Apple Technical Note TN2257 (https://developer.apple.com/library/mac/technotes/tn2257/_index.html) + * + * This function returns the gamma exponent for the OETF. For example, sRGB is approximated + * by gamma 2.2, not by gamma 0.45455. + * + * @return Will return an approximation to the simple gamma function matching + * the supplied Transfer Characteristic, Will return 0.0 for any + * we cannot reasonably match against. + */ +double av_csp_approximate_trc_gamma(enum AVColorTransferCharacteristic trc); + +/** + * Determine the function needed to apply the given + * AVColorTransferCharacteristic to linear input. + * + * The function returned should expect a nominal domain and range of [0.0-1.0] + * values outside of this range maybe valid depending on the chosen + * characteristic function. + * + * @return Will return pointer to the function matching the + * supplied Transfer Characteristic. If unspecified will + * return NULL: + */ +av_csp_trc_function av_csp_trc_func_from_id(enum AVColorTransferCharacteristic trc); + +/** + * @} + */ + +#endif /* AVUTIL_CSP_H */ diff --git a/libs/FFmpeg/include/libavutil/des.h b/libs/FFmpeg/include/libavutil/des.h new file mode 100644 index 0000000..3a3e6fa --- /dev/null +++ b/libs/FFmpeg/include/libavutil/des.h @@ -0,0 +1,81 @@ +/* + * DES encryption/decryption + * Copyright (c) 2007 Reimar Doeffinger + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_DES_H +#define AVUTIL_DES_H + +#include + +/** + * @defgroup lavu_des DES + * @ingroup lavu_crypto + * @{ + */ + +typedef struct AVDES { + uint64_t round_keys[3][16]; + int triple_des; +} AVDES; + +/** + * Allocate an AVDES context. + */ +AVDES *av_des_alloc(void); + +/** + * @brief Initializes an AVDES context. + * + * @param d pointer to a AVDES structure to initialize + * @param key pointer to the key to use + * @param key_bits must be 64 or 192 + * @param decrypt 0 for encryption/CBC-MAC, 1 for decryption + * @return zero on success, negative value otherwise + */ +int av_des_init(struct AVDES *d, const uint8_t *key, int key_bits, int decrypt); + +/** + * @brief Encrypts / decrypts using the DES algorithm. + * + * @param d pointer to the AVDES structure + * @param dst destination array, can be equal to src, must be 8-byte aligned + * @param src source array, can be equal to dst, must be 8-byte aligned, may be NULL + * @param count number of 8 byte blocks + * @param iv initialization vector for CBC mode, if NULL then ECB will be used, + * must be 8-byte aligned + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_des_crypt(struct AVDES *d, uint8_t *dst, const uint8_t *src, int count, uint8_t *iv, int decrypt); + +/** + * @brief Calculates CBC-MAC using the DES algorithm. + * + * @param d pointer to the AVDES structure + * @param dst destination array, can be equal to src, must be 8-byte aligned + * @param src source array, can be equal to dst, must be 8-byte aligned, may be NULL + * @param count number of 8 byte blocks + */ +void av_des_mac(struct AVDES *d, uint8_t *dst, const uint8_t *src, int count); + +/** + * @} + */ + +#endif /* AVUTIL_DES_H */ diff --git a/libs/FFmpeg/include/libavutil/detection_bbox.h b/libs/FFmpeg/include/libavutil/detection_bbox.h new file mode 100644 index 0000000..0119880 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/detection_bbox.h @@ -0,0 +1,108 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_DETECTION_BBOX_H +#define AVUTIL_DETECTION_BBOX_H + +#include "rational.h" +#include "avassert.h" +#include "frame.h" + +typedef struct AVDetectionBBox { + /** + * Distance in pixels from the left/top edge of the frame, + * together with width and height, defining the bounding box. + */ + int x; + int y; + int w; + int h; + +#define AV_DETECTION_BBOX_LABEL_NAME_MAX_SIZE 64 + + /** + * Detect result with confidence + */ + char detect_label[AV_DETECTION_BBOX_LABEL_NAME_MAX_SIZE]; + AVRational detect_confidence; + + /** + * At most 4 classifications based on the detected bounding box. + * For example, we can get max 4 different attributes with 4 different + * DNN models on one bounding box. + * classify_count is zero if no classification. + */ +#define AV_NUM_DETECTION_BBOX_CLASSIFY 4 + uint32_t classify_count; + char classify_labels[AV_NUM_DETECTION_BBOX_CLASSIFY][AV_DETECTION_BBOX_LABEL_NAME_MAX_SIZE]; + AVRational classify_confidences[AV_NUM_DETECTION_BBOX_CLASSIFY]; +} AVDetectionBBox; + +typedef struct AVDetectionBBoxHeader { + /** + * Information about how the bounding box is generated. + * for example, the DNN model name. + */ + char source[256]; + + /** + * Number of bounding boxes in the array. + */ + uint32_t nb_bboxes; + + /** + * Offset in bytes from the beginning of this structure at which + * the array of bounding boxes starts. + */ + size_t bboxes_offset; + + /** + * Size of each bounding box in bytes. + */ + size_t bbox_size; +} AVDetectionBBoxHeader; + +/* + * Get the bounding box at the specified {@code idx}. Must be between 0 and nb_bboxes. + */ +static av_always_inline AVDetectionBBox * +av_get_detection_bbox(const AVDetectionBBoxHeader *header, unsigned int idx) +{ + av_assert0(idx < header->nb_bboxes); + return (AVDetectionBBox *)((uint8_t *)header + header->bboxes_offset + + idx * header->bbox_size); +} + +/** + * Allocates memory for AVDetectionBBoxHeader, plus an array of {@code nb_bboxes} + * AVDetectionBBox, and initializes the variables. + * Can be freed with a normal av_free() call. + * + * @param nb_bboxes number of AVDetectionBBox structures to allocate + * @param out_size if non-NULL, the size in bytes of the resulting data array is + * written here. + */ +AVDetectionBBoxHeader *av_detection_bbox_alloc(uint32_t nb_bboxes, size_t *out_size); + +/** + * Allocates memory for AVDetectionBBoxHeader, plus an array of {@code nb_bboxes} + * AVDetectionBBox, in the given AVFrame {@code frame} as AVFrameSideData of type + * AV_FRAME_DATA_DETECTION_BBOXES and initializes the variables. + */ +AVDetectionBBoxHeader *av_detection_bbox_create_side_data(AVFrame *frame, uint32_t nb_bboxes); +#endif diff --git a/libs/FFmpeg/include/libavutil/dict.h b/libs/FFmpeg/include/libavutil/dict.h new file mode 100644 index 0000000..713c9e3 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/dict.h @@ -0,0 +1,241 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * Public dictionary API. + * @deprecated + * AVDictionary is provided for compatibility with libav. It is both in + * implementation as well as API inefficient. It does not scale and is + * extremely slow with large dictionaries. + * It is recommended that new code uses our tree container from tree.c/h + * where applicable, which uses AVL trees to achieve O(log n) performance. + */ + +#ifndef AVUTIL_DICT_H +#define AVUTIL_DICT_H + +#include + +/** + * @addtogroup lavu_dict AVDictionary + * @ingroup lavu_data + * + * @brief Simple key:value store + * + * @{ + * Dictionaries are used for storing key-value pairs. + * + * - To **create an AVDictionary**, simply pass an address of a NULL + * pointer to av_dict_set(). NULL can be used as an empty dictionary + * wherever a pointer to an AVDictionary is required. + * - To **insert an entry**, use av_dict_set(). + * - Use av_dict_get() to **retrieve an entry**. + * - To **iterate over all entries**, use av_dict_iterate(). + * - In order to **free the dictionary and all its contents**, use av_dict_free(). + * + @code + AVDictionary *d = NULL; // "create" an empty dictionary + AVDictionaryEntry *t = NULL; + + av_dict_set(&d, "foo", "bar", 0); // add an entry + + char *k = av_strdup("key"); // if your strings are already allocated, + char *v = av_strdup("value"); // you can avoid copying them like this + av_dict_set(&d, k, v, AV_DICT_DONT_STRDUP_KEY | AV_DICT_DONT_STRDUP_VAL); + + while ((t = av_dict_iterate(d, t))) { + <....> // iterate over all entries in d + } + av_dict_free(&d); + @endcode + */ + +/** + * @name AVDictionary Flags + * Flags that influence behavior of the matching of keys or insertion to the dictionary. + * @{ + */ +#define AV_DICT_MATCH_CASE 1 /**< Only get an entry with exact-case key match. Only relevant in av_dict_get(). */ +#define AV_DICT_IGNORE_SUFFIX 2 /**< Return first entry in a dictionary whose first part corresponds to the search key, + ignoring the suffix of the found key string. Only relevant in av_dict_get(). */ +#define AV_DICT_DONT_STRDUP_KEY 4 /**< Take ownership of a key that's been + allocated with av_malloc() or another memory allocation function. */ +#define AV_DICT_DONT_STRDUP_VAL 8 /**< Take ownership of a value that's been + allocated with av_malloc() or another memory allocation function. */ +#define AV_DICT_DONT_OVERWRITE 16 /**< Don't overwrite existing entries. */ +#define AV_DICT_APPEND 32 /**< If the entry already exists, append to it. Note that no + delimiter is added, the strings are simply concatenated. */ +#define AV_DICT_MULTIKEY 64 /**< Allow to store several equal keys in the dictionary */ +/** + * @} + */ + +typedef struct AVDictionaryEntry { + char *key; + char *value; +} AVDictionaryEntry; + +typedef struct AVDictionary AVDictionary; + +/** + * Get a dictionary entry with matching key. + * + * The returned entry key or value must not be changed, or it will + * cause undefined behavior. + * + * @param prev Set to the previous matching element to find the next. + * If set to NULL the first matching element is returned. + * @param key Matching key + * @param flags A collection of AV_DICT_* flags controlling how the + * entry is retrieved + * + * @return Found entry or NULL in case no matching entry was found in the dictionary + */ +AVDictionaryEntry *av_dict_get(const AVDictionary *m, const char *key, + const AVDictionaryEntry *prev, int flags); + +/** + * Iterate over a dictionary + * + * Iterates through all entries in the dictionary. + * + * @warning The returned AVDictionaryEntry key/value must not be changed. + * + * @warning As av_dict_set() invalidates all previous entries returned + * by this function, it must not be called while iterating over the dict. + * + * Typical usage: + * @code + * const AVDictionaryEntry *e = NULL; + * while ((e = av_dict_iterate(m, e))) { + * // ... + * } + * @endcode + * + * @param m The dictionary to iterate over + * @param prev Pointer to the previous AVDictionaryEntry, NULL initially + * + * @retval AVDictionaryEntry* The next element in the dictionary + * @retval NULL No more elements in the dictionary + */ +const AVDictionaryEntry *av_dict_iterate(const AVDictionary *m, + const AVDictionaryEntry *prev); + +/** + * Get number of entries in dictionary. + * + * @param m dictionary + * @return number of entries in dictionary + */ +int av_dict_count(const AVDictionary *m); + +/** + * Set the given entry in *pm, overwriting an existing entry. + * + * Note: If AV_DICT_DONT_STRDUP_KEY or AV_DICT_DONT_STRDUP_VAL is set, + * these arguments will be freed on error. + * + * @warning Adding a new entry to a dictionary invalidates all existing entries + * previously returned with av_dict_get() or av_dict_iterate(). + * + * @param pm Pointer to a pointer to a dictionary struct. If *pm is NULL + * a dictionary struct is allocated and put in *pm. + * @param key Entry key to add to *pm (will either be av_strduped or added as a new key depending on flags) + * @param value Entry value to add to *pm (will be av_strduped or added as a new key depending on flags). + * Passing a NULL value will cause an existing entry to be deleted. + * + * @return >= 0 on success otherwise an error code <0 + */ +int av_dict_set(AVDictionary **pm, const char *key, const char *value, int flags); + +/** + * Convenience wrapper for av_dict_set() that converts the value to a string + * and stores it. + * + * Note: If ::AV_DICT_DONT_STRDUP_KEY is set, key will be freed on error. + */ +int av_dict_set_int(AVDictionary **pm, const char *key, int64_t value, int flags); + +/** + * Parse the key/value pairs list and add the parsed entries to a dictionary. + * + * In case of failure, all the successfully set entries are stored in + * *pm. You may need to manually free the created dictionary. + * + * @param key_val_sep A 0-terminated list of characters used to separate + * key from value + * @param pairs_sep A 0-terminated list of characters used to separate + * two pairs from each other + * @param flags Flags to use when adding to the dictionary. + * ::AV_DICT_DONT_STRDUP_KEY and ::AV_DICT_DONT_STRDUP_VAL + * are ignored since the key/value tokens will always + * be duplicated. + * + * @return 0 on success, negative AVERROR code on failure + */ +int av_dict_parse_string(AVDictionary **pm, const char *str, + const char *key_val_sep, const char *pairs_sep, + int flags); + +/** + * Copy entries from one AVDictionary struct into another. + * + * @note Metadata is read using the ::AV_DICT_IGNORE_SUFFIX flag + * + * @param dst Pointer to a pointer to a AVDictionary struct to copy into. If *dst is NULL, + * this function will allocate a struct for you and put it in *dst + * @param src Pointer to the source AVDictionary struct to copy items from. + * @param flags Flags to use when setting entries in *dst + * + * @return 0 on success, negative AVERROR code on failure. If dst was allocated + * by this function, callers should free the associated memory. + */ +int av_dict_copy(AVDictionary **dst, const AVDictionary *src, int flags); + +/** + * Free all the memory allocated for an AVDictionary struct + * and all keys and values. + */ +void av_dict_free(AVDictionary **m); + +/** + * Get dictionary entries as a string. + * + * Create a string containing dictionary's entries. + * Such string may be passed back to av_dict_parse_string(). + * @note String is escaped with backslashes ('\'). + * + * @warning Separators cannot be neither '\\' nor '\0'. They also cannot be the same. + * + * @param[in] m The dictionary + * @param[out] buffer Pointer to buffer that will be allocated with string containg entries. + * Buffer must be freed by the caller when is no longer needed. + * @param[in] key_val_sep Character used to separate key from value + * @param[in] pairs_sep Character used to separate two pairs from each other + * + * @return >= 0 on success, negative on error + */ +int av_dict_get_string(const AVDictionary *m, char **buffer, + const char key_val_sep, const char pairs_sep); + +/** + * @} + */ + +#endif /* AVUTIL_DICT_H */ diff --git a/libs/FFmpeg/include/libavutil/display.h b/libs/FFmpeg/include/libavutil/display.h new file mode 100644 index 0000000..50f2b44 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/display.h @@ -0,0 +1,109 @@ +/* + * Copyright (c) 2014 Vittorio Giovara + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_video_display + * Display matrix + */ + +#ifndef AVUTIL_DISPLAY_H +#define AVUTIL_DISPLAY_H + +#include + +/** + * @defgroup lavu_video_display Display transformation matrix functions + * @ingroup lavu_video + * + * The display transformation matrix specifies an affine transformation that + * should be applied to video frames for correct presentation. It is compatible + * with the matrices stored in the ISO/IEC 14496-12 container format. + * + * The data is a 3x3 matrix represented as a 9-element array: + * + * @code{.unparsed} + * | a b u | + * (a, b, u, c, d, v, x, y, w) -> | c d v | + * | x y w | + * @endcode + * + * All numbers are stored in native endianness, as 16.16 fixed-point values, + * except for u, v and w, which are stored as 2.30 fixed-point values. + * + * The transformation maps a point (p, q) in the source (pre-transformation) + * frame to the point (p', q') in the destination (post-transformation) frame as + * follows: + * + * @code{.unparsed} + * | a b u | + * (p, q, 1) . | c d v | = z * (p', q', 1) + * | x y w | + * @endcode + * + * The transformation can also be more explicitly written in components as + * follows: + * + * @code{.unparsed} + * p' = (a * p + c * q + x) / z; + * q' = (b * p + d * q + y) / z; + * z = u * p + v * q + w + * @endcode + * + * @{ + */ + +/** + * Extract the rotation component of the transformation matrix. + * + * @param matrix the transformation matrix + * @return the angle (in degrees) by which the transformation rotates the frame + * counterclockwise. The angle will be in range [-180.0, 180.0], + * or NaN if the matrix is singular. + * + * @note floating point numbers are inherently inexact, so callers are + * recommended to round the return value to nearest integer before use. + */ +double av_display_rotation_get(const int32_t matrix[9]); + +/** + * Initialize a transformation matrix describing a pure clockwise + * rotation by the specified angle (in degrees). + * + * @param[out] matrix a transformation matrix (will be fully overwritten + * by this function) + * @param angle rotation angle in degrees. + */ +void av_display_rotation_set(int32_t matrix[9], double angle); + +/** + * Flip the input matrix horizontally and/or vertically. + * + * @param[in,out] matrix a transformation matrix + * @param hflip whether the matrix should be flipped horizontally + * @param vflip whether the matrix should be flipped vertically + */ +void av_display_matrix_flip(int32_t matrix[9], int hflip, int vflip); + +/** + * @} + */ + +#endif /* AVUTIL_DISPLAY_H */ diff --git a/libs/FFmpeg/include/libavutil/dovi_meta.h b/libs/FFmpeg/include/libavutil/dovi_meta.h new file mode 100644 index 0000000..3d11e02 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/dovi_meta.h @@ -0,0 +1,236 @@ +/* + * Copyright (c) 2020 Vacing Fang + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * DOVI configuration + */ + + +#ifndef AVUTIL_DOVI_META_H +#define AVUTIL_DOVI_META_H + +#include +#include +#include "rational.h" + +/* + * DOVI configuration + * ref: dolby-vision-bitstreams-within-the-iso-base-media-file-format-v2.1.2 + dolby-vision-bitstreams-in-mpeg-2-transport-stream-multiplex-v1.2 + * @code + * uint8_t dv_version_major, the major version number that the stream complies with + * uint8_t dv_version_minor, the minor version number that the stream complies with + * uint8_t dv_profile, the Dolby Vision profile + * uint8_t dv_level, the Dolby Vision level + * uint8_t rpu_present_flag + * uint8_t el_present_flag + * uint8_t bl_present_flag + * uint8_t dv_bl_signal_compatibility_id + * @endcode + * + * @note The struct must be allocated with av_dovi_alloc() and + * its size is not a part of the public ABI. + */ +typedef struct AVDOVIDecoderConfigurationRecord { + uint8_t dv_version_major; + uint8_t dv_version_minor; + uint8_t dv_profile; + uint8_t dv_level; + uint8_t rpu_present_flag; + uint8_t el_present_flag; + uint8_t bl_present_flag; + uint8_t dv_bl_signal_compatibility_id; +} AVDOVIDecoderConfigurationRecord; + +/** + * Allocate a AVDOVIDecoderConfigurationRecord structure and initialize its + * fields to default values. + * + * @return the newly allocated struct or NULL on failure + */ +AVDOVIDecoderConfigurationRecord *av_dovi_alloc(size_t *size); + +/** + * Dolby Vision RPU data header. + * + * @note sizeof(AVDOVIRpuDataHeader) is not part of the public ABI. + */ +typedef struct AVDOVIRpuDataHeader { + uint8_t rpu_type; + uint16_t rpu_format; + uint8_t vdr_rpu_profile; + uint8_t vdr_rpu_level; + uint8_t chroma_resampling_explicit_filter_flag; + uint8_t coef_data_type; /* informative, lavc always converts to fixed */ + uint8_t coef_log2_denom; + uint8_t vdr_rpu_normalized_idc; + uint8_t bl_video_full_range_flag; + uint8_t bl_bit_depth; /* [8, 16] */ + uint8_t el_bit_depth; /* [8, 16] */ + uint8_t vdr_bit_depth; /* [8, 16] */ + uint8_t spatial_resampling_filter_flag; + uint8_t el_spatial_resampling_filter_flag; + uint8_t disable_residual_flag; +} AVDOVIRpuDataHeader; + +enum AVDOVIMappingMethod { + AV_DOVI_MAPPING_POLYNOMIAL = 0, + AV_DOVI_MAPPING_MMR = 1, +}; + +/** + * Coefficients of a piece-wise function. The pieces of the function span the + * value ranges between two adjacent pivot values. + */ +#define AV_DOVI_MAX_PIECES 8 +typedef struct AVDOVIReshapingCurve { + uint8_t num_pivots; /* [2, 9] */ + uint16_t pivots[AV_DOVI_MAX_PIECES + 1]; /* sorted ascending */ + enum AVDOVIMappingMethod mapping_idc[AV_DOVI_MAX_PIECES]; + /* AV_DOVI_MAPPING_POLYNOMIAL */ + uint8_t poly_order[AV_DOVI_MAX_PIECES]; /* [1, 2] */ + int64_t poly_coef[AV_DOVI_MAX_PIECES][3]; /* x^0, x^1, x^2 */ + /* AV_DOVI_MAPPING_MMR */ + uint8_t mmr_order[AV_DOVI_MAX_PIECES]; /* [1, 3] */ + int64_t mmr_constant[AV_DOVI_MAX_PIECES]; + int64_t mmr_coef[AV_DOVI_MAX_PIECES][3/* order - 1 */][7]; +} AVDOVIReshapingCurve; + +enum AVDOVINLQMethod { + AV_DOVI_NLQ_NONE = -1, + AV_DOVI_NLQ_LINEAR_DZ = 0, +}; + +/** + * Coefficients of the non-linear inverse quantization. For the interpretation + * of these, see ETSI GS CCM 001. + */ +typedef struct AVDOVINLQParams { + uint16_t nlq_offset; + uint64_t vdr_in_max; + /* AV_DOVI_NLQ_LINEAR_DZ */ + uint64_t linear_deadzone_slope; + uint64_t linear_deadzone_threshold; +} AVDOVINLQParams; + +/** + * Dolby Vision RPU data mapping parameters. + * + * @note sizeof(AVDOVIDataMapping) is not part of the public ABI. + */ +typedef struct AVDOVIDataMapping { + uint8_t vdr_rpu_id; + uint8_t mapping_color_space; + uint8_t mapping_chroma_format_idc; + AVDOVIReshapingCurve curves[3]; /* per component */ + + /* Non-linear inverse quantization */ + enum AVDOVINLQMethod nlq_method_idc; + uint32_t num_x_partitions; + uint32_t num_y_partitions; + AVDOVINLQParams nlq[3]; /* per component */ +} AVDOVIDataMapping; + +/** + * Dolby Vision RPU colorspace metadata parameters. + * + * @note sizeof(AVDOVIColorMetadata) is not part of the public ABI. + */ +typedef struct AVDOVIColorMetadata { + uint8_t dm_metadata_id; + uint8_t scene_refresh_flag; + + /** + * Coefficients of the custom Dolby Vision IPT-PQ matrices. These are to be + * used instead of the matrices indicated by the frame's colorspace tags. + * The output of rgb_to_lms_matrix is to be fed into a BT.2020 LMS->RGB + * matrix based on a Hunt-Pointer-Estevez transform, but without any + * crosstalk. (See the definition of the ICtCp colorspace for more + * information.) + */ + AVRational ycc_to_rgb_matrix[9]; /* before PQ linearization */ + AVRational ycc_to_rgb_offset[3]; /* input offset of neutral value */ + AVRational rgb_to_lms_matrix[9]; /* after PQ linearization */ + + /** + * Extra signal metadata (see Dolby patents for more info). + */ + uint16_t signal_eotf; + uint16_t signal_eotf_param0; + uint16_t signal_eotf_param1; + uint32_t signal_eotf_param2; + uint8_t signal_bit_depth; + uint8_t signal_color_space; + uint8_t signal_chroma_format; + uint8_t signal_full_range_flag; /* [0, 3] */ + uint16_t source_min_pq; + uint16_t source_max_pq; + uint16_t source_diagonal; +} AVDOVIColorMetadata; + +/** + * Combined struct representing a combination of header, mapping and color + * metadata, for attaching to frames as side data. + * + * @note The struct must be allocated with av_dovi_metadata_alloc() and + * its size is not a part of the public ABI. + */ + +typedef struct AVDOVIMetadata { + /** + * Offset in bytes from the beginning of this structure at which the + * respective structs start. + */ + size_t header_offset; /* AVDOVIRpuDataHeader */ + size_t mapping_offset; /* AVDOVIDataMapping */ + size_t color_offset; /* AVDOVIColorMetadata */ +} AVDOVIMetadata; + +static av_always_inline AVDOVIRpuDataHeader * +av_dovi_get_header(const AVDOVIMetadata *data) +{ + return (AVDOVIRpuDataHeader *)((uint8_t *) data + data->header_offset); +} + +static av_always_inline AVDOVIDataMapping * +av_dovi_get_mapping(const AVDOVIMetadata *data) +{ + return (AVDOVIDataMapping *)((uint8_t *) data + data->mapping_offset); +} + +static av_always_inline AVDOVIColorMetadata * +av_dovi_get_color(const AVDOVIMetadata *data) +{ + return (AVDOVIColorMetadata *)((uint8_t *) data + data->color_offset); +} + +/** + * Allocate an AVDOVIMetadata structure and initialize its + * fields to default values. + * + * @param size If this parameter is non-NULL, the size in bytes of the + * allocated struct will be written here on success + * + * @return the newly allocated struct or NULL on failure + */ +AVDOVIMetadata *av_dovi_metadata_alloc(size_t *size); + +#endif /* AVUTIL_DOVI_META_H */ diff --git a/libs/FFmpeg/include/libavutil/downmix_info.h b/libs/FFmpeg/include/libavutil/downmix_info.h new file mode 100644 index 0000000..221cf5b --- /dev/null +++ b/libs/FFmpeg/include/libavutil/downmix_info.h @@ -0,0 +1,115 @@ +/* + * Copyright (c) 2014 Tim Walker + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_DOWNMIX_INFO_H +#define AVUTIL_DOWNMIX_INFO_H + +#include "frame.h" + +/** + * @file + * audio downmix medatata + */ + +/** + * @addtogroup lavu_audio + * @{ + */ + +/** + * @defgroup downmix_info Audio downmix metadata + * @{ + */ + +/** + * Possible downmix types. + */ +enum AVDownmixType { + AV_DOWNMIX_TYPE_UNKNOWN, /**< Not indicated. */ + AV_DOWNMIX_TYPE_LORO, /**< Lo/Ro 2-channel downmix (Stereo). */ + AV_DOWNMIX_TYPE_LTRT, /**< Lt/Rt 2-channel downmix, Dolby Surround compatible. */ + AV_DOWNMIX_TYPE_DPLII, /**< Lt/Rt 2-channel downmix, Dolby Pro Logic II compatible. */ + AV_DOWNMIX_TYPE_NB /**< Number of downmix types. Not part of ABI. */ +}; + +/** + * This structure describes optional metadata relevant to a downmix procedure. + * + * All fields are set by the decoder to the value indicated in the audio + * bitstream (if present), or to a "sane" default otherwise. + */ +typedef struct AVDownmixInfo { + /** + * Type of downmix preferred by the mastering engineer. + */ + enum AVDownmixType preferred_downmix_type; + + /** + * Absolute scale factor representing the nominal level of the center + * channel during a regular downmix. + */ + double center_mix_level; + + /** + * Absolute scale factor representing the nominal level of the center + * channel during an Lt/Rt compatible downmix. + */ + double center_mix_level_ltrt; + + /** + * Absolute scale factor representing the nominal level of the surround + * channels during a regular downmix. + */ + double surround_mix_level; + + /** + * Absolute scale factor representing the nominal level of the surround + * channels during an Lt/Rt compatible downmix. + */ + double surround_mix_level_ltrt; + + /** + * Absolute scale factor representing the level at which the LFE data is + * mixed into L/R channels during downmixing. + */ + double lfe_mix_level; +} AVDownmixInfo; + +/** + * Get a frame's AV_FRAME_DATA_DOWNMIX_INFO side data for editing. + * + * If the side data is absent, it is created and added to the frame. + * + * @param frame the frame for which the side data is to be obtained or created + * + * @return the AVDownmixInfo structure to be edited by the caller, or NULL if + * the structure cannot be allocated. + */ +AVDownmixInfo *av_downmix_info_update_side_data(AVFrame *frame); + +/** + * @} + */ + +/** + * @} + */ + +#endif /* AVUTIL_DOWNMIX_INFO_H */ diff --git a/libs/FFmpeg/include/libavutil/encryption_info.h b/libs/FFmpeg/include/libavutil/encryption_info.h new file mode 100644 index 0000000..8fe7ebf --- /dev/null +++ b/libs/FFmpeg/include/libavutil/encryption_info.h @@ -0,0 +1,205 @@ +/** + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_ENCRYPTION_INFO_H +#define AVUTIL_ENCRYPTION_INFO_H + +#include +#include + +typedef struct AVSubsampleEncryptionInfo { + /** The number of bytes that are clear. */ + unsigned int bytes_of_clear_data; + + /** + * The number of bytes that are protected. If using pattern encryption, + * the pattern applies to only the protected bytes; if not using pattern + * encryption, all these bytes are encrypted. + */ + unsigned int bytes_of_protected_data; +} AVSubsampleEncryptionInfo; + +/** + * This describes encryption info for a packet. This contains frame-specific + * info for how to decrypt the packet before passing it to the decoder. + * + * The size of this struct is not part of the public ABI. + */ +typedef struct AVEncryptionInfo { + /** The fourcc encryption scheme, in big-endian byte order. */ + uint32_t scheme; + + /** + * Only used for pattern encryption. This is the number of 16-byte blocks + * that are encrypted. + */ + uint32_t crypt_byte_block; + + /** + * Only used for pattern encryption. This is the number of 16-byte blocks + * that are clear. + */ + uint32_t skip_byte_block; + + /** + * The ID of the key used to encrypt the packet. This should always be + * 16 bytes long, but may be changed in the future. + */ + uint8_t *key_id; + uint32_t key_id_size; + + /** + * The initialization vector. This may have been zero-filled to be the + * correct block size. This should always be 16 bytes long, but may be + * changed in the future. + */ + uint8_t *iv; + uint32_t iv_size; + + /** + * An array of subsample encryption info specifying how parts of the sample + * are encrypted. If there are no subsamples, then the whole sample is + * encrypted. + */ + AVSubsampleEncryptionInfo *subsamples; + uint32_t subsample_count; +} AVEncryptionInfo; + +/** + * This describes info used to initialize an encryption key system. + * + * The size of this struct is not part of the public ABI. + */ +typedef struct AVEncryptionInitInfo { + /** + * A unique identifier for the key system this is for, can be NULL if it + * is not known. This should always be 16 bytes, but may change in the + * future. + */ + uint8_t* system_id; + uint32_t system_id_size; + + /** + * An array of key IDs this initialization data is for. All IDs are the + * same length. Can be NULL if there are no known key IDs. + */ + uint8_t** key_ids; + /** The number of key IDs. */ + uint32_t num_key_ids; + /** + * The number of bytes in each key ID. This should always be 16, but may + * change in the future. + */ + uint32_t key_id_size; + + /** + * Key-system specific initialization data. This data is copied directly + * from the file and the format depends on the specific key system. This + * can be NULL if there is no initialization data; in that case, there + * will be at least one key ID. + */ + uint8_t* data; + uint32_t data_size; + + /** + * An optional pointer to the next initialization info in the list. + */ + struct AVEncryptionInitInfo *next; +} AVEncryptionInitInfo; + +/** + * Allocates an AVEncryptionInfo structure and sub-pointers to hold the given + * number of subsamples. This will allocate pointers for the key ID, IV, + * and subsample entries, set the size members, and zero-initialize the rest. + * + * @param subsample_count The number of subsamples. + * @param key_id_size The number of bytes in the key ID, should be 16. + * @param iv_size The number of bytes in the IV, should be 16. + * + * @return The new AVEncryptionInfo structure, or NULL on error. + */ +AVEncryptionInfo *av_encryption_info_alloc(uint32_t subsample_count, uint32_t key_id_size, uint32_t iv_size); + +/** + * Allocates an AVEncryptionInfo structure with a copy of the given data. + * @return The new AVEncryptionInfo structure, or NULL on error. + */ +AVEncryptionInfo *av_encryption_info_clone(const AVEncryptionInfo *info); + +/** + * Frees the given encryption info object. This MUST NOT be used to free the + * side-data data pointer, that should use normal side-data methods. + */ +void av_encryption_info_free(AVEncryptionInfo *info); + +/** + * Creates a copy of the AVEncryptionInfo that is contained in the given side + * data. The resulting object should be passed to av_encryption_info_free() + * when done. + * + * @return The new AVEncryptionInfo structure, or NULL on error. + */ +AVEncryptionInfo *av_encryption_info_get_side_data(const uint8_t *side_data, size_t side_data_size); + +/** + * Allocates and initializes side data that holds a copy of the given encryption + * info. The resulting pointer should be either freed using av_free or given + * to av_packet_add_side_data(). + * + * @return The new side-data pointer, or NULL. + */ +uint8_t *av_encryption_info_add_side_data( + const AVEncryptionInfo *info, size_t *side_data_size); + + +/** + * Allocates an AVEncryptionInitInfo structure and sub-pointers to hold the + * given sizes. This will allocate pointers and set all the fields. + * + * @return The new AVEncryptionInitInfo structure, or NULL on error. + */ +AVEncryptionInitInfo *av_encryption_init_info_alloc( + uint32_t system_id_size, uint32_t num_key_ids, uint32_t key_id_size, uint32_t data_size); + +/** + * Frees the given encryption init info object. This MUST NOT be used to free + * the side-data data pointer, that should use normal side-data methods. + */ +void av_encryption_init_info_free(AVEncryptionInitInfo* info); + +/** + * Creates a copy of the AVEncryptionInitInfo that is contained in the given + * side data. The resulting object should be passed to + * av_encryption_init_info_free() when done. + * + * @return The new AVEncryptionInitInfo structure, or NULL on error. + */ +AVEncryptionInitInfo *av_encryption_init_info_get_side_data( + const uint8_t* side_data, size_t side_data_size); + +/** + * Allocates and initializes side data that holds a copy of the given encryption + * init info. The resulting pointer should be either freed using av_free or + * given to av_packet_add_side_data(). + * + * @return The new side-data pointer, or NULL. + */ +uint8_t *av_encryption_init_info_add_side_data( + const AVEncryptionInitInfo *info, size_t *side_data_size); + +#endif /* AVUTIL_ENCRYPTION_INFO_H */ diff --git a/libs/FFmpeg/include/libavutil/error.h b/libs/FFmpeg/include/libavutil/error.h new file mode 100644 index 0000000..0d3269a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/error.h @@ -0,0 +1,128 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * error code definitions + */ + +#ifndef AVUTIL_ERROR_H +#define AVUTIL_ERROR_H + +#include +#include + +#include "macros.h" + +/** + * @addtogroup lavu_error + * + * @{ + */ + + +/* error handling */ +#if EDOM > 0 +#define AVERROR(e) (-(e)) ///< Returns a negative error code from a POSIX error code, to return from library functions. +#define AVUNERROR(e) (-(e)) ///< Returns a POSIX error code from a library function error return value. +#else +/* Some platforms have E* and errno already negated. */ +#define AVERROR(e) (e) +#define AVUNERROR(e) (e) +#endif + +#define FFERRTAG(a, b, c, d) (-(int)MKTAG(a, b, c, d)) + +#define AVERROR_BSF_NOT_FOUND FFERRTAG(0xF8,'B','S','F') ///< Bitstream filter not found +#define AVERROR_BUG FFERRTAG( 'B','U','G','!') ///< Internal bug, also see AVERROR_BUG2 +#define AVERROR_BUFFER_TOO_SMALL FFERRTAG( 'B','U','F','S') ///< Buffer too small +#define AVERROR_DECODER_NOT_FOUND FFERRTAG(0xF8,'D','E','C') ///< Decoder not found +#define AVERROR_DEMUXER_NOT_FOUND FFERRTAG(0xF8,'D','E','M') ///< Demuxer not found +#define AVERROR_ENCODER_NOT_FOUND FFERRTAG(0xF8,'E','N','C') ///< Encoder not found +#define AVERROR_EOF FFERRTAG( 'E','O','F',' ') ///< End of file +#define AVERROR_EXIT FFERRTAG( 'E','X','I','T') ///< Immediate exit was requested; the called function should not be restarted +#define AVERROR_EXTERNAL FFERRTAG( 'E','X','T',' ') ///< Generic error in an external library +#define AVERROR_FILTER_NOT_FOUND FFERRTAG(0xF8,'F','I','L') ///< Filter not found +#define AVERROR_INVALIDDATA FFERRTAG( 'I','N','D','A') ///< Invalid data found when processing input +#define AVERROR_MUXER_NOT_FOUND FFERRTAG(0xF8,'M','U','X') ///< Muxer not found +#define AVERROR_OPTION_NOT_FOUND FFERRTAG(0xF8,'O','P','T') ///< Option not found +#define AVERROR_PATCHWELCOME FFERRTAG( 'P','A','W','E') ///< Not yet implemented in FFmpeg, patches welcome +#define AVERROR_PROTOCOL_NOT_FOUND FFERRTAG(0xF8,'P','R','O') ///< Protocol not found + +#define AVERROR_STREAM_NOT_FOUND FFERRTAG(0xF8,'S','T','R') ///< Stream not found +/** + * This is semantically identical to AVERROR_BUG + * it has been introduced in Libav after our AVERROR_BUG and with a modified value. + */ +#define AVERROR_BUG2 FFERRTAG( 'B','U','G',' ') +#define AVERROR_UNKNOWN FFERRTAG( 'U','N','K','N') ///< Unknown error, typically from an external library +#define AVERROR_EXPERIMENTAL (-0x2bb2afa8) ///< Requested feature is flagged experimental. Set strict_std_compliance if you really want to use it. +#define AVERROR_INPUT_CHANGED (-0x636e6701) ///< Input changed between calls. Reconfiguration is required. (can be OR-ed with AVERROR_OUTPUT_CHANGED) +#define AVERROR_OUTPUT_CHANGED (-0x636e6702) ///< Output changed between calls. Reconfiguration is required. (can be OR-ed with AVERROR_INPUT_CHANGED) +/* HTTP & RTSP errors */ +#define AVERROR_HTTP_BAD_REQUEST FFERRTAG(0xF8,'4','0','0') +#define AVERROR_HTTP_UNAUTHORIZED FFERRTAG(0xF8,'4','0','1') +#define AVERROR_HTTP_FORBIDDEN FFERRTAG(0xF8,'4','0','3') +#define AVERROR_HTTP_NOT_FOUND FFERRTAG(0xF8,'4','0','4') +#define AVERROR_HTTP_OTHER_4XX FFERRTAG(0xF8,'4','X','X') +#define AVERROR_HTTP_SERVER_ERROR FFERRTAG(0xF8,'5','X','X') + +#define AV_ERROR_MAX_STRING_SIZE 64 + +/** + * Put a description of the AVERROR code errnum in errbuf. + * In case of failure the global variable errno is set to indicate the + * error. Even in case of failure av_strerror() will print a generic + * error message indicating the errnum provided to errbuf. + * + * @param errnum error code to describe + * @param errbuf buffer to which description is written + * @param errbuf_size the size in bytes of errbuf + * @return 0 on success, a negative value if a description for errnum + * cannot be found + */ +int av_strerror(int errnum, char *errbuf, size_t errbuf_size); + +/** + * Fill the provided buffer with a string containing an error string + * corresponding to the AVERROR code errnum. + * + * @param errbuf a buffer + * @param errbuf_size size in bytes of errbuf + * @param errnum error code to describe + * @return the buffer in input, filled with the error description + * @see av_strerror() + */ +static inline char *av_make_error_string(char *errbuf, size_t errbuf_size, int errnum) +{ + av_strerror(errnum, errbuf, errbuf_size); + return errbuf; +} + +/** + * Convenience macro, the return value should be used only directly in + * function arguments but never stand-alone. + */ +#define av_err2str(errnum) \ + av_make_error_string((char[AV_ERROR_MAX_STRING_SIZE]){0}, AV_ERROR_MAX_STRING_SIZE, errnum) + +/** + * @} + */ + +#endif /* AVUTIL_ERROR_H */ diff --git a/libs/FFmpeg/include/libavutil/eval.h b/libs/FFmpeg/include/libavutil/eval.h new file mode 100644 index 0000000..ee8cffb --- /dev/null +++ b/libs/FFmpeg/include/libavutil/eval.h @@ -0,0 +1,140 @@ +/* + * Copyright (c) 2002 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * simple arithmetic expression evaluator + */ + +#ifndef AVUTIL_EVAL_H +#define AVUTIL_EVAL_H + +typedef struct AVExpr AVExpr; + +/** + * Parse and evaluate an expression. + * Note, this is significantly slower than av_expr_eval(). + * + * @param res a pointer to a double where is put the result value of + * the expression, or NAN in case of error + * @param s expression as a zero terminated string, for example "1+2^3+5*5+sin(2/3)" + * @param const_names NULL terminated array of zero terminated strings of constant identifiers, for example {"PI", "E", 0} + * @param const_values a zero terminated array of values for the identifiers from const_names + * @param func1_names NULL terminated array of zero terminated strings of funcs1 identifiers + * @param funcs1 NULL terminated array of function pointers for functions which take 1 argument + * @param func2_names NULL terminated array of zero terminated strings of funcs2 identifiers + * @param funcs2 NULL terminated array of function pointers for functions which take 2 arguments + * @param opaque a pointer which will be passed to all functions from funcs1 and funcs2 + * @param log_offset log level offset, can be used to silence error messages + * @param log_ctx parent logging context + * @return >= 0 in case of success, a negative value corresponding to an + * AVERROR code otherwise + */ +int av_expr_parse_and_eval(double *res, const char *s, + const char * const *const_names, const double *const_values, + const char * const *func1_names, double (* const *funcs1)(void *, double), + const char * const *func2_names, double (* const *funcs2)(void *, double, double), + void *opaque, int log_offset, void *log_ctx); + +/** + * Parse an expression. + * + * @param expr a pointer where is put an AVExpr containing the parsed + * value in case of successful parsing, or NULL otherwise. + * The pointed to AVExpr must be freed with av_expr_free() by the user + * when it is not needed anymore. + * @param s expression as a zero terminated string, for example "1+2^3+5*5+sin(2/3)" + * @param const_names NULL terminated array of zero terminated strings of constant identifiers, for example {"PI", "E", 0} + * @param func1_names NULL terminated array of zero terminated strings of funcs1 identifiers + * @param funcs1 NULL terminated array of function pointers for functions which take 1 argument + * @param func2_names NULL terminated array of zero terminated strings of funcs2 identifiers + * @param funcs2 NULL terminated array of function pointers for functions which take 2 arguments + * @param log_offset log level offset, can be used to silence error messages + * @param log_ctx parent logging context + * @return >= 0 in case of success, a negative value corresponding to an + * AVERROR code otherwise + */ +int av_expr_parse(AVExpr **expr, const char *s, + const char * const *const_names, + const char * const *func1_names, double (* const *funcs1)(void *, double), + const char * const *func2_names, double (* const *funcs2)(void *, double, double), + int log_offset, void *log_ctx); + +/** + * Evaluate a previously parsed expression. + * + * @param e the AVExpr to evaluate + * @param const_values a zero terminated array of values for the identifiers from av_expr_parse() const_names + * @param opaque a pointer which will be passed to all functions from funcs1 and funcs2 + * @return the value of the expression + */ +double av_expr_eval(AVExpr *e, const double *const_values, void *opaque); + +/** + * Track the presence of variables and their number of occurrences in a parsed expression + * + * @param e the AVExpr to track variables in + * @param counter a zero-initialized array where the count of each variable will be stored + * @param size size of array + * @return 0 on success, a negative value indicates that no expression or array was passed + * or size was zero + */ +int av_expr_count_vars(AVExpr *e, unsigned *counter, int size); + +/** + * Track the presence of user provided functions and their number of occurrences + * in a parsed expression. + * + * @param e the AVExpr to track user provided functions in + * @param counter a zero-initialized array where the count of each function will be stored + * if you passed 5 functions with 2 arguments to av_expr_parse() + * then for arg=2 this will use upto 5 entries. + * @param size size of array + * @param arg number of arguments the counted functions have + * @return 0 on success, a negative value indicates that no expression or array was passed + * or size was zero + */ +int av_expr_count_func(AVExpr *e, unsigned *counter, int size, int arg); + +/** + * Free a parsed expression previously created with av_expr_parse(). + */ +void av_expr_free(AVExpr *e); + +/** + * Parse the string in numstr and return its value as a double. If + * the string is empty, contains only whitespaces, or does not contain + * an initial substring that has the expected syntax for a + * floating-point number, no conversion is performed. In this case, + * returns a value of zero and the value returned in tail is the value + * of numstr. + * + * @param numstr a string representing a number, may contain one of + * the International System number postfixes, for example 'K', 'M', + * 'G'. If 'i' is appended after the postfix, powers of 2 are used + * instead of powers of 10. The 'B' postfix multiplies the value by + * 8, and can be appended after another postfix or used alone. This + * allows using for example 'KB', 'MiB', 'G' and 'B' as postfix. + * @param tail if non-NULL puts here the pointer to the char next + * after the last parsed character + */ +double av_strtod(const char *numstr, char **tail); + +#endif /* AVUTIL_EVAL_H */ diff --git a/libs/FFmpeg/include/libavutil/executor.h b/libs/FFmpeg/include/libavutil/executor.h new file mode 100644 index 0000000..c602bcb --- /dev/null +++ b/libs/FFmpeg/include/libavutil/executor.h @@ -0,0 +1,67 @@ +/* + * Copyright (C) 2023 Nuo Mi + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_EXECUTOR_H +#define AVUTIL_EXECUTOR_H + +typedef struct AVExecutor AVExecutor; +typedef struct AVTask AVTask; + +struct AVTask { + AVTask *next; +}; + +typedef struct AVTaskCallbacks { + void *user_data; + + int local_context_size; + + // return 1 if a's priority > b's priority + int (*priority_higher)(const AVTask *a, const AVTask *b); + + // task is ready for run + int (*ready)(const AVTask *t, void *user_data); + + // run the task + int (*run)(AVTask *t, void *local_context, void *user_data); +} AVTaskCallbacks; + +/** + * Alloc executor + * @param callbacks callback structure for executor + * @param thread_count worker thread number + * @return return the executor + */ +AVExecutor* av_executor_alloc(const AVTaskCallbacks *callbacks, int thread_count); + +/** + * Free executor + * @param e pointer to executor + */ +void av_executor_free(AVExecutor **e); + +/** + * Add task to executor + * @param e pointer to executor + * @param t pointer to task. If NULL, it will wakeup one work thread + */ +void av_executor_execute(AVExecutor *e, AVTask *t); + +#endif //AVUTIL_EXECUTOR_H diff --git a/libs/FFmpeg/include/libavutil/ffversion.h b/libs/FFmpeg/include/libavutil/ffversion.h new file mode 100644 index 0000000..0ce0c68 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/ffversion.h @@ -0,0 +1,5 @@ +/* Automatically generated by version.sh, do not manually edit! */ +#ifndef AVUTIL_FFVERSION_H +#define AVUTIL_FFVERSION_H +#define FFMPEG_VERSION "N-112686-g3f890fbfd9" +#endif /* AVUTIL_FFVERSION_H */ diff --git a/libs/FFmpeg/include/libavutil/fifo.h b/libs/FFmpeg/include/libavutil/fifo.h new file mode 100644 index 0000000..ce3a2ae --- /dev/null +++ b/libs/FFmpeg/include/libavutil/fifo.h @@ -0,0 +1,448 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_fifo + * A generic FIFO API + */ + +#ifndef AVUTIL_FIFO_H +#define AVUTIL_FIFO_H + +#include +#include + +#include "attributes.h" +#include "version.h" + +/** + * @defgroup lavu_fifo AVFifo + * @ingroup lavu_data + * + * @{ + * A generic FIFO API + */ + +typedef struct AVFifo AVFifo; + +/** + * Callback for writing or reading from a FIFO, passed to (and invoked from) the + * av_fifo_*_cb() functions. It may be invoked multiple times from a single + * av_fifo_*_cb() call and may process less data than the maximum size indicated + * by nb_elems. + * + * @param opaque the opaque pointer provided to the av_fifo_*_cb() function + * @param buf the buffer for reading or writing the data, depending on which + * av_fifo_*_cb function is called + * @param nb_elems On entry contains the maximum number of elements that can be + * read from / written into buf. On success, the callback should + * update it to contain the number of elements actually written. + * + * @return 0 on success, a negative error code on failure (will be returned from + * the invoking av_fifo_*_cb() function) + */ +typedef int AVFifoCB(void *opaque, void *buf, size_t *nb_elems); + +/** + * Automatically resize the FIFO on writes, so that the data fits. This + * automatic resizing happens up to a limit that can be modified with + * av_fifo_auto_grow_limit(). + */ +#define AV_FIFO_FLAG_AUTO_GROW (1 << 0) + +/** + * Allocate and initialize an AVFifo with a given element size. + * + * @param elems initial number of elements that can be stored in the FIFO + * @param elem_size Size in bytes of a single element. Further operations on + * the returned FIFO will implicitly use this element size. + * @param flags a combination of AV_FIFO_FLAG_* + * + * @return newly-allocated AVFifo on success, a negative error code on failure + */ +AVFifo *av_fifo_alloc2(size_t elems, size_t elem_size, + unsigned int flags); + +/** + * @return Element size for FIFO operations. This element size is set at + * FIFO allocation and remains constant during its lifetime + */ +size_t av_fifo_elem_size(const AVFifo *f); + +/** + * Set the maximum size (in elements) to which the FIFO can be resized + * automatically. Has no effect unless AV_FIFO_FLAG_AUTO_GROW is used. + */ +void av_fifo_auto_grow_limit(AVFifo *f, size_t max_elems); + +/** + * @return number of elements available for reading from the given FIFO. + */ +size_t av_fifo_can_read(const AVFifo *f); + +/** + * @return Number of elements that can be written into the given FIFO without + * growing it. + * + * In other words, this number of elements or less is guaranteed to fit + * into the FIFO. More data may be written when the + * AV_FIFO_FLAG_AUTO_GROW flag was specified at FIFO creation, but this + * may involve memory allocation, which can fail. + */ +size_t av_fifo_can_write(const AVFifo *f); + +/** + * Enlarge an AVFifo. + * + * On success, the FIFO will be large enough to hold exactly + * inc + av_fifo_can_read() + av_fifo_can_write() + * elements. In case of failure, the old FIFO is kept unchanged. + * + * @param f AVFifo to resize + * @param inc number of elements to allocate for, in addition to the current + * allocated size + * @return a non-negative number on success, a negative error code on failure + */ +int av_fifo_grow2(AVFifo *f, size_t inc); + +/** + * Write data into a FIFO. + * + * In case nb_elems > av_fifo_can_write(f) and the AV_FIFO_FLAG_AUTO_GROW flag + * was not specified at FIFO creation, nothing is written and an error + * is returned. + * + * Calling function is guaranteed to succeed if nb_elems <= av_fifo_can_write(f). + * + * @param f the FIFO buffer + * @param buf Data to be written. nb_elems * av_fifo_elem_size(f) bytes will be + * read from buf on success. + * @param nb_elems number of elements to write into FIFO + * + * @return a non-negative number on success, a negative error code on failure + */ +int av_fifo_write(AVFifo *f, const void *buf, size_t nb_elems); + +/** + * Write data from a user-provided callback into a FIFO. + * + * @param f the FIFO buffer + * @param read_cb Callback supplying the data to the FIFO. May be called + * multiple times. + * @param opaque opaque user data to be provided to read_cb + * @param nb_elems Should point to the maximum number of elements that can be + * written. Will be updated to contain the number of elements + * actually written. + * + * @return non-negative number on success, a negative error code on failure + */ +int av_fifo_write_from_cb(AVFifo *f, AVFifoCB read_cb, + void *opaque, size_t *nb_elems); + +/** + * Read data from a FIFO. + * + * In case nb_elems > av_fifo_can_read(f), nothing is read and an error + * is returned. + * + * @param f the FIFO buffer + * @param buf Buffer to store the data. nb_elems * av_fifo_elem_size(f) bytes + * will be written into buf on success. + * @param nb_elems number of elements to read from FIFO + * + * @return a non-negative number on success, a negative error code on failure + */ +int av_fifo_read(AVFifo *f, void *buf, size_t nb_elems); + +/** + * Feed data from a FIFO into a user-provided callback. + * + * @param f the FIFO buffer + * @param write_cb Callback the data will be supplied to. May be called + * multiple times. + * @param opaque opaque user data to be provided to write_cb + * @param nb_elems Should point to the maximum number of elements that can be + * read. Will be updated to contain the total number of elements + * actually sent to the callback. + * + * @return non-negative number on success, a negative error code on failure + */ +int av_fifo_read_to_cb(AVFifo *f, AVFifoCB write_cb, + void *opaque, size_t *nb_elems); + +/** + * Read data from a FIFO without modifying FIFO state. + * + * Returns an error if an attempt is made to peek to nonexistent elements + * (i.e. if offset + nb_elems is larger than av_fifo_can_read(f)). + * + * @param f the FIFO buffer + * @param buf Buffer to store the data. nb_elems * av_fifo_elem_size(f) bytes + * will be written into buf. + * @param nb_elems number of elements to read from FIFO + * @param offset number of initial elements to skip. + * + * @return a non-negative number on success, a negative error code on failure + */ +int av_fifo_peek(const AVFifo *f, void *buf, size_t nb_elems, size_t offset); + +/** + * Feed data from a FIFO into a user-provided callback. + * + * @param f the FIFO buffer + * @param write_cb Callback the data will be supplied to. May be called + * multiple times. + * @param opaque opaque user data to be provided to write_cb + * @param nb_elems Should point to the maximum number of elements that can be + * read. Will be updated to contain the total number of elements + * actually sent to the callback. + * @param offset number of initial elements to skip; offset + *nb_elems must not + * be larger than av_fifo_can_read(f). + * + * @return a non-negative number on success, a negative error code on failure + */ +int av_fifo_peek_to_cb(const AVFifo *f, AVFifoCB write_cb, void *opaque, + size_t *nb_elems, size_t offset); + +/** + * Discard the specified amount of data from an AVFifo. + * @param size number of elements to discard, MUST NOT be larger than + * av_fifo_can_read(f) + */ +void av_fifo_drain2(AVFifo *f, size_t size); + +/* + * Empty the AVFifo. + * @param f AVFifo to reset + */ +void av_fifo_reset2(AVFifo *f); + +/** + * Free an AVFifo and reset pointer to NULL. + * @param f Pointer to an AVFifo to free. *f == NULL is allowed. + */ +void av_fifo_freep2(AVFifo **f); + + +#if FF_API_FIFO_OLD_API +typedef struct AVFifoBuffer { + uint8_t *buffer; + uint8_t *rptr, *wptr, *end; + uint32_t rndx, wndx; +} AVFifoBuffer; + +/** + * Initialize an AVFifoBuffer. + * @param size of FIFO + * @return AVFifoBuffer or NULL in case of memory allocation failure + * @deprecated use av_fifo_alloc2() + */ +attribute_deprecated +AVFifoBuffer *av_fifo_alloc(unsigned int size); + +/** + * Initialize an AVFifoBuffer. + * @param nmemb number of elements + * @param size size of the single element + * @return AVFifoBuffer or NULL in case of memory allocation failure + * @deprecated use av_fifo_alloc2() + */ +attribute_deprecated +AVFifoBuffer *av_fifo_alloc_array(size_t nmemb, size_t size); + +/** + * Free an AVFifoBuffer. + * @param f AVFifoBuffer to free + * @deprecated use the AVFifo API with av_fifo_freep2() + */ +attribute_deprecated +void av_fifo_free(AVFifoBuffer *f); + +/** + * Free an AVFifoBuffer and reset pointer to NULL. + * @param f AVFifoBuffer to free + * @deprecated use the AVFifo API with av_fifo_freep2() + */ +attribute_deprecated +void av_fifo_freep(AVFifoBuffer **f); + +/** + * Reset the AVFifoBuffer to the state right after av_fifo_alloc, in particular it is emptied. + * @param f AVFifoBuffer to reset + * @deprecated use av_fifo_reset2() with the new AVFifo-API + */ +attribute_deprecated +void av_fifo_reset(AVFifoBuffer *f); + +/** + * Return the amount of data in bytes in the AVFifoBuffer, that is the + * amount of data you can read from it. + * @param f AVFifoBuffer to read from + * @return size + * @deprecated use av_fifo_can_read() with the new AVFifo-API + */ +attribute_deprecated +int av_fifo_size(const AVFifoBuffer *f); + +/** + * Return the amount of space in bytes in the AVFifoBuffer, that is the + * amount of data you can write into it. + * @param f AVFifoBuffer to write into + * @return size + * @deprecated use av_fifo_can_write() with the new AVFifo-API + */ +attribute_deprecated +int av_fifo_space(const AVFifoBuffer *f); + +/** + * Feed data at specific position from an AVFifoBuffer to a user-supplied callback. + * Similar as av_fifo_gereric_read but without discarding data. + * @param f AVFifoBuffer to read from + * @param offset offset from current read position + * @param buf_size number of bytes to read + * @param func generic read function + * @param dest data destination + * + * @return a non-negative number on success, a negative error code on failure + * + * @deprecated use the new AVFifo-API with av_fifo_peek() when func == NULL, + * av_fifo_peek_to_cb() otherwise + */ +attribute_deprecated +int av_fifo_generic_peek_at(AVFifoBuffer *f, void *dest, int offset, int buf_size, void (*func)(void*, void*, int)); + +/** + * Feed data from an AVFifoBuffer to a user-supplied callback. + * Similar as av_fifo_gereric_read but without discarding data. + * @param f AVFifoBuffer to read from + * @param buf_size number of bytes to read + * @param func generic read function + * @param dest data destination + * + * @return a non-negative number on success, a negative error code on failure + * + * @deprecated use the new AVFifo-API with av_fifo_peek() when func == NULL, + * av_fifo_peek_to_cb() otherwise + */ +attribute_deprecated +int av_fifo_generic_peek(AVFifoBuffer *f, void *dest, int buf_size, void (*func)(void*, void*, int)); + +/** + * Feed data from an AVFifoBuffer to a user-supplied callback. + * @param f AVFifoBuffer to read from + * @param buf_size number of bytes to read + * @param func generic read function + * @param dest data destination + * + * @return a non-negative number on success, a negative error code on failure + * + * @deprecated use the new AVFifo-API with av_fifo_read() when func == NULL, + * av_fifo_read_to_cb() otherwise + */ +attribute_deprecated +int av_fifo_generic_read(AVFifoBuffer *f, void *dest, int buf_size, void (*func)(void*, void*, int)); + +/** + * Feed data from a user-supplied callback to an AVFifoBuffer. + * @param f AVFifoBuffer to write to + * @param src data source; non-const since it may be used as a + * modifiable context by the function defined in func + * @param size number of bytes to write + * @param func generic write function; the first parameter is src, + * the second is dest_buf, the third is dest_buf_size. + * func must return the number of bytes written to dest_buf, or <= 0 to + * indicate no more data available to write. + * If func is NULL, src is interpreted as a simple byte array for source data. + * @return the number of bytes written to the FIFO or a negative error code on failure + * + * @deprecated use the new AVFifo-API with av_fifo_write() when func == NULL, + * av_fifo_write_from_cb() otherwise + */ +attribute_deprecated +int av_fifo_generic_write(AVFifoBuffer *f, void *src, int size, int (*func)(void*, void*, int)); + +/** + * Resize an AVFifoBuffer. + * In case of reallocation failure, the old FIFO is kept unchanged. + * + * @param f AVFifoBuffer to resize + * @param size new AVFifoBuffer size in bytes + * @return <0 for failure, >=0 otherwise + * + * @deprecated use the new AVFifo-API with av_fifo_grow2() to increase FIFO size, + * decreasing FIFO size is not supported + */ +attribute_deprecated +int av_fifo_realloc2(AVFifoBuffer *f, unsigned int size); + +/** + * Enlarge an AVFifoBuffer. + * In case of reallocation failure, the old FIFO is kept unchanged. + * The new fifo size may be larger than the requested size. + * + * @param f AVFifoBuffer to resize + * @param additional_space the amount of space in bytes to allocate in addition to av_fifo_size() + * @return <0 for failure, >=0 otherwise + * + * @deprecated use the new AVFifo-API with av_fifo_grow2(); note that unlike + * this function it adds to the allocated size, rather than to the used size + */ +attribute_deprecated +int av_fifo_grow(AVFifoBuffer *f, unsigned int additional_space); + +/** + * Read and discard the specified amount of data from an AVFifoBuffer. + * @param f AVFifoBuffer to read from + * @param size amount of data to read in bytes + * + * @deprecated use the new AVFifo-API with av_fifo_drain2() + */ +attribute_deprecated +void av_fifo_drain(AVFifoBuffer *f, int size); + +#if FF_API_FIFO_PEEK2 +/** + * Return a pointer to the data stored in a FIFO buffer at a certain offset. + * The FIFO buffer is not modified. + * + * @param f AVFifoBuffer to peek at, f must be non-NULL + * @param offs an offset in bytes, its absolute value must be less + * than the used buffer size or the returned pointer will + * point outside to the buffer data. + * The used buffer size can be checked with av_fifo_size(). + * @deprecated use the new AVFifo-API with av_fifo_peek() or av_fifo_peek_to_cb() + */ +attribute_deprecated +static inline uint8_t *av_fifo_peek2(const AVFifoBuffer *f, int offs) +{ + uint8_t *ptr = f->rptr + offs; + if (ptr >= f->end) + ptr = f->buffer + (ptr - f->end); + else if (ptr < f->buffer) + ptr = f->end - (f->buffer - ptr); + return ptr; +} +#endif +#endif + +/** + * @} + */ + +#endif /* AVUTIL_FIFO_H */ diff --git a/libs/FFmpeg/include/libavutil/file.h b/libs/FFmpeg/include/libavutil/file.h new file mode 100644 index 0000000..fc87a9c --- /dev/null +++ b/libs/FFmpeg/include/libavutil/file.h @@ -0,0 +1,80 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_FILE_H +#define AVUTIL_FILE_H + +#include +#include + +#include "version.h" +#include "attributes.h" + +/** + * @file + * Misc file utilities. + */ + +/** + * Read the file with name filename, and put its content in a newly + * allocated buffer or map it with mmap() when available. + * In case of success set *bufptr to the read or mmapped buffer, and + * *size to the size in bytes of the buffer in *bufptr. + * Unlike mmap this function succeeds with zero sized files, in this + * case *bufptr will be set to NULL and *size will be set to 0. + * The returned buffer must be released with av_file_unmap(). + * + * @param filename path to the file + * @param[out] bufptr pointee is set to the mapped or allocated buffer + * @param[out] size pointee is set to the size in bytes of the buffer + * @param log_offset loglevel offset used for logging + * @param log_ctx context used for logging + * @return a non negative number in case of success, a negative value + * corresponding to an AVERROR error code in case of failure + */ +av_warn_unused_result +int av_file_map(const char *filename, uint8_t **bufptr, size_t *size, + int log_offset, void *log_ctx); + +/** + * Unmap or free the buffer bufptr created by av_file_map(). + * + * @param bufptr the buffer previously created with av_file_map() + * @param size size in bytes of bufptr, must be the same as returned + * by av_file_map() + */ +void av_file_unmap(uint8_t *bufptr, size_t size); + +#if FF_API_AV_FOPEN_UTF8 +/** + * Wrapper to work around the lack of mkstemp() on mingw. + * Also, tries to create file in /tmp first, if possible. + * *prefix can be a character constant; *filename will be allocated internally. + * @return file descriptor of opened file (or negative value corresponding to an + * AVERROR code on error) + * and opened file name in **filename. + * @note On very old libcs it is necessary to set a secure umask before + * calling this, av_tempfile() can't call umask itself as it is used in + * libraries and could interfere with the calling application. + * @deprecated as fd numbers cannot be passed saftely between libs on some platforms + */ +attribute_deprecated +int av_tempfile(const char *prefix, char **filename, int log_offset, void *log_ctx); +#endif + +#endif /* AVUTIL_FILE_H */ diff --git a/libs/FFmpeg/include/libavutil/film_grain_params.h b/libs/FFmpeg/include/libavutil/film_grain_params.h new file mode 100644 index 0000000..f3bd0a4 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/film_grain_params.h @@ -0,0 +1,260 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_FILM_GRAIN_PARAMS_H +#define AVUTIL_FILM_GRAIN_PARAMS_H + +#include "frame.h" + +enum AVFilmGrainParamsType { + AV_FILM_GRAIN_PARAMS_NONE = 0, + + /** + * The union is valid when interpreted as AVFilmGrainAOMParams (codec.aom) + */ + AV_FILM_GRAIN_PARAMS_AV1, + + /** + * The union is valid when interpreted as AVFilmGrainH274Params (codec.h274) + */ + AV_FILM_GRAIN_PARAMS_H274, +}; + +/** + * This structure describes how to handle film grain synthesis for AOM codecs. + * + * @note The struct must be allocated as part of AVFilmGrainParams using + * av_film_grain_params_alloc(). Its size is not a part of the public ABI. + */ +typedef struct AVFilmGrainAOMParams { + /** + * Number of points, and the scale and value for each point of the + * piecewise linear scaling function for the uma plane. + */ + int num_y_points; + uint8_t y_points[14][2 /* value, scaling */]; + + /** + * Signals whether to derive the chroma scaling function from the luma. + * Not equivalent to copying the luma values and scales. + */ + int chroma_scaling_from_luma; + + /** + * If chroma_scaling_from_luma is set to 0, signals the chroma scaling + * function parameters. + */ + int num_uv_points[2 /* cb, cr */]; + uint8_t uv_points[2 /* cb, cr */][10][2 /* value, scaling */]; + + /** + * Specifies the shift applied to the chroma components. For AV1, its within + * [8; 11] and determines the range and quantization of the film grain. + */ + int scaling_shift; + + /** + * Specifies the auto-regression lag. + */ + int ar_coeff_lag; + + /** + * Luma auto-regression coefficients. The number of coefficients is given by + * 2 * ar_coeff_lag * (ar_coeff_lag + 1). + */ + int8_t ar_coeffs_y[24]; + + /** + * Chroma auto-regression coefficients. The number of coefficients is given by + * 2 * ar_coeff_lag * (ar_coeff_lag + 1) + !!num_y_points. + */ + int8_t ar_coeffs_uv[2 /* cb, cr */][25]; + + /** + * Specifies the range of the auto-regressive coefficients. Values of 6, + * 7, 8 and so on represent a range of [-2, 2), [-1, 1), [-0.5, 0.5) and + * so on. For AV1 must be between 6 and 9. + */ + int ar_coeff_shift; + + /** + * Signals the down shift applied to the generated gaussian numbers during + * synthesis. + */ + int grain_scale_shift; + + /** + * Specifies the luma/chroma multipliers for the index to the component + * scaling function. + */ + int uv_mult[2 /* cb, cr */]; + int uv_mult_luma[2 /* cb, cr */]; + + /** + * Offset used for component scaling function. For AV1 its a 9-bit value + * with a range [-256, 255] + */ + int uv_offset[2 /* cb, cr */]; + + /** + * Signals whether to overlap film grain blocks. + */ + int overlap_flag; + + /** + * Signals to clip to limited color levels after film grain application. + */ + int limit_output_range; +} AVFilmGrainAOMParams; + +/** + * This structure describes how to handle film grain synthesis for codecs using + * the ITU-T H.274 Versatile suplemental enhancement information message. + * + * @note The struct must be allocated as part of AVFilmGrainParams using + * av_film_grain_params_alloc(). Its size is not a part of the public ABI. + */ +typedef struct AVFilmGrainH274Params { + /** + * Specifies the film grain simulation mode. + * 0 = Frequency filtering, 1 = Auto-regression + */ + int model_id; + + /** + * Specifies the bit depth used for the luma component. + */ + int bit_depth_luma; + + /** + * Specifies the bit depth used for the chroma components. + */ + int bit_depth_chroma; + + enum AVColorRange color_range; + enum AVColorPrimaries color_primaries; + enum AVColorTransferCharacteristic color_trc; + enum AVColorSpace color_space; + + /** + * Specifies the blending mode used to blend the simulated film grain + * with the decoded images. + * + * 0 = Additive, 1 = Multiplicative + */ + int blending_mode_id; + + /** + * Specifies a scale factor used in the film grain characterization equations. + */ + int log2_scale_factor; + + /** + * Indicates if the modelling of film grain for a given component is present. + */ + int component_model_present[3 /* y, cb, cr */]; + + /** + * Specifies the number of intensity intervals for which a specific set of + * model values has been estimated, with a range of [1, 256]. + */ + uint16_t num_intensity_intervals[3 /* y, cb, cr */]; + + /** + * Specifies the number of model values present for each intensity interval + * in which the film grain has been modelled, with a range of [1, 6]. + */ + uint8_t num_model_values[3 /* y, cb, cr */]; + + /** + * Specifies the lower ounds of each intensity interval for whichthe set of + * model values applies for the component. + */ + uint8_t intensity_interval_lower_bound[3 /* y, cb, cr */][256 /* intensity interval */]; + + /** + * Specifies the upper bound of each intensity interval for which the set of + * model values applies for the component. + */ + uint8_t intensity_interval_upper_bound[3 /* y, cb, cr */][256 /* intensity interval */]; + + /** + * Specifies the model values for the component for each intensity interval. + * - When model_id == 0, the following applies: + * For comp_model_value[y], the range of values is [0, 2^bit_depth_luma - 1] + * For comp_model_value[cb..cr], the range of values is [0, 2^bit_depth_chroma - 1] + * - Otherwise, the following applies: + * For comp_model_value[y], the range of values is [-2^(bit_depth_luma - 1), 2^(bit_depth_luma - 1) - 1] + * For comp_model_value[cb..cr], the range of values is [-2^(bit_depth_chroma - 1), 2^(bit_depth_chroma - 1) - 1] + */ + int16_t comp_model_value[3 /* y, cb, cr */][256 /* intensity interval */][6 /* model value */]; +} AVFilmGrainH274Params; + +/** + * This structure describes how to handle film grain synthesis in video + * for specific codecs. Must be present on every frame where film grain is + * meant to be synthesised for correct presentation. + * + * @note The struct must be allocated with av_film_grain_params_alloc() and + * its size is not a part of the public ABI. + */ +typedef struct AVFilmGrainParams { + /** + * Specifies the codec for which this structure is valid. + */ + enum AVFilmGrainParamsType type; + + /** + * Seed to use for the synthesis process, if the codec allows for it. + * + * @note For H.264, this refers to `pic_offset` as defined in + * SMPTE RDD 5-2006. + */ + uint64_t seed; + + /** + * Additional fields may be added both here and in any structure included. + * If a codec's film grain structure differs slightly over another + * codec's, fields within may change meaning depending on the type. + */ + union { + AVFilmGrainAOMParams aom; + AVFilmGrainH274Params h274; + } codec; +} AVFilmGrainParams; + +/** + * Allocate an AVFilmGrainParams structure and set its fields to + * default values. The resulting struct can be freed using av_freep(). + * If size is not NULL it will be set to the number of bytes allocated. + * + * @return An AVFilmGrainParams filled with default values or NULL + * on failure. + */ +AVFilmGrainParams *av_film_grain_params_alloc(size_t *size); + +/** + * Allocate a complete AVFilmGrainParams and add it to the frame. + * + * @param frame The frame which side data is added to. + * + * @return The AVFilmGrainParams structure to be filled by caller. + */ +AVFilmGrainParams *av_film_grain_params_create_side_data(AVFrame *frame); + +#endif /* AVUTIL_FILM_GRAIN_PARAMS_H */ diff --git a/libs/FFmpeg/include/libavutil/frame.h b/libs/FFmpeg/include/libavutil/frame.h new file mode 100644 index 0000000..c0c1b23 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/frame.h @@ -0,0 +1,1056 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_frame + * reference-counted frame API + */ + +#ifndef AVUTIL_FRAME_H +#define AVUTIL_FRAME_H + +#include +#include + +#include "avutil.h" +#include "buffer.h" +#include "channel_layout.h" +#include "dict.h" +#include "rational.h" +#include "samplefmt.h" +#include "pixfmt.h" +#include "version.h" + + +/** + * @defgroup lavu_frame AVFrame + * @ingroup lavu_data + * + * @{ + * AVFrame is an abstraction for reference-counted raw multimedia data. + */ + +enum AVFrameSideDataType { + /** + * The data is the AVPanScan struct defined in libavcodec. + */ + AV_FRAME_DATA_PANSCAN, + /** + * ATSC A53 Part 4 Closed Captions. + * A53 CC bitstream is stored as uint8_t in AVFrameSideData.data. + * The number of bytes of CC data is AVFrameSideData.size. + */ + AV_FRAME_DATA_A53_CC, + /** + * Stereoscopic 3d metadata. + * The data is the AVStereo3D struct defined in libavutil/stereo3d.h. + */ + AV_FRAME_DATA_STEREO3D, + /** + * The data is the AVMatrixEncoding enum defined in libavutil/channel_layout.h. + */ + AV_FRAME_DATA_MATRIXENCODING, + /** + * Metadata relevant to a downmix procedure. + * The data is the AVDownmixInfo struct defined in libavutil/downmix_info.h. + */ + AV_FRAME_DATA_DOWNMIX_INFO, + /** + * ReplayGain information in the form of the AVReplayGain struct. + */ + AV_FRAME_DATA_REPLAYGAIN, + /** + * This side data contains a 3x3 transformation matrix describing an affine + * transformation that needs to be applied to the frame for correct + * presentation. + * + * See libavutil/display.h for a detailed description of the data. + */ + AV_FRAME_DATA_DISPLAYMATRIX, + /** + * Active Format Description data consisting of a single byte as specified + * in ETSI TS 101 154 using AVActiveFormatDescription enum. + */ + AV_FRAME_DATA_AFD, + /** + * Motion vectors exported by some codecs (on demand through the export_mvs + * flag set in the libavcodec AVCodecContext flags2 option). + * The data is the AVMotionVector struct defined in + * libavutil/motion_vector.h. + */ + AV_FRAME_DATA_MOTION_VECTORS, + /** + * Recommmends skipping the specified number of samples. This is exported + * only if the "skip_manual" AVOption is set in libavcodec. + * This has the same format as AV_PKT_DATA_SKIP_SAMPLES. + * @code + * u32le number of samples to skip from start of this packet + * u32le number of samples to skip from end of this packet + * u8 reason for start skip + * u8 reason for end skip (0=padding silence, 1=convergence) + * @endcode + */ + AV_FRAME_DATA_SKIP_SAMPLES, + /** + * This side data must be associated with an audio frame and corresponds to + * enum AVAudioServiceType defined in avcodec.h. + */ + AV_FRAME_DATA_AUDIO_SERVICE_TYPE, + /** + * Mastering display metadata associated with a video frame. The payload is + * an AVMasteringDisplayMetadata type and contains information about the + * mastering display color volume. + */ + AV_FRAME_DATA_MASTERING_DISPLAY_METADATA, + /** + * The GOP timecode in 25 bit timecode format. Data format is 64-bit integer. + * This is set on the first frame of a GOP that has a temporal reference of 0. + */ + AV_FRAME_DATA_GOP_TIMECODE, + + /** + * The data represents the AVSphericalMapping structure defined in + * libavutil/spherical.h. + */ + AV_FRAME_DATA_SPHERICAL, + + /** + * Content light level (based on CTA-861.3). This payload contains data in + * the form of the AVContentLightMetadata struct. + */ + AV_FRAME_DATA_CONTENT_LIGHT_LEVEL, + + /** + * The data contains an ICC profile as an opaque octet buffer following the + * format described by ISO 15076-1 with an optional name defined in the + * metadata key entry "name". + */ + AV_FRAME_DATA_ICC_PROFILE, + + /** + * Timecode which conforms to SMPTE ST 12-1. The data is an array of 4 uint32_t + * where the first uint32_t describes how many (1-3) of the other timecodes are used. + * The timecode format is described in the documentation of av_timecode_get_smpte_from_framenum() + * function in libavutil/timecode.h. + */ + AV_FRAME_DATA_S12M_TIMECODE, + + /** + * HDR dynamic metadata associated with a video frame. The payload is + * an AVDynamicHDRPlus type and contains information for color + * volume transform - application 4 of SMPTE 2094-40:2016 standard. + */ + AV_FRAME_DATA_DYNAMIC_HDR_PLUS, + + /** + * Regions Of Interest, the data is an array of AVRegionOfInterest type, the number of + * array element is implied by AVFrameSideData.size / AVRegionOfInterest.self_size. + */ + AV_FRAME_DATA_REGIONS_OF_INTEREST, + + /** + * Encoding parameters for a video frame, as described by AVVideoEncParams. + */ + AV_FRAME_DATA_VIDEO_ENC_PARAMS, + + /** + * User data unregistered metadata associated with a video frame. + * This is the H.26[45] UDU SEI message, and shouldn't be used for any other purpose + * The data is stored as uint8_t in AVFrameSideData.data which is 16 bytes of + * uuid_iso_iec_11578 followed by AVFrameSideData.size - 16 bytes of user_data_payload_byte. + */ + AV_FRAME_DATA_SEI_UNREGISTERED, + + /** + * Film grain parameters for a frame, described by AVFilmGrainParams. + * Must be present for every frame which should have film grain applied. + */ + AV_FRAME_DATA_FILM_GRAIN_PARAMS, + + /** + * Bounding boxes for object detection and classification, + * as described by AVDetectionBBoxHeader. + */ + AV_FRAME_DATA_DETECTION_BBOXES, + + /** + * Dolby Vision RPU raw data, suitable for passing to x265 + * or other libraries. Array of uint8_t, with NAL emulation + * bytes intact. + */ + AV_FRAME_DATA_DOVI_RPU_BUFFER, + + /** + * Parsed Dolby Vision metadata, suitable for passing to a software + * implementation. The payload is the AVDOVIMetadata struct defined in + * libavutil/dovi_meta.h. + */ + AV_FRAME_DATA_DOVI_METADATA, + + /** + * HDR Vivid dynamic metadata associated with a video frame. The payload is + * an AVDynamicHDRVivid type and contains information for color + * volume transform - CUVA 005.1-2021. + */ + AV_FRAME_DATA_DYNAMIC_HDR_VIVID, + + /** + * Ambient viewing environment metadata, as defined by H.274. + */ + AV_FRAME_DATA_AMBIENT_VIEWING_ENVIRONMENT, + + /** + * Provide encoder-specific hinting information about changed/unchanged + * portions of a frame. It can be used to pass information about which + * macroblocks can be skipped because they didn't change from the + * corresponding ones in the previous frame. This could be useful for + * applications which know this information in advance to speed up + * encoding. + */ + AV_FRAME_DATA_VIDEO_HINT, +}; + +enum AVActiveFormatDescription { + AV_AFD_SAME = 8, + AV_AFD_4_3 = 9, + AV_AFD_16_9 = 10, + AV_AFD_14_9 = 11, + AV_AFD_4_3_SP_14_9 = 13, + AV_AFD_16_9_SP_14_9 = 14, + AV_AFD_SP_4_3 = 15, +}; + + +/** + * Structure to hold side data for an AVFrame. + * + * sizeof(AVFrameSideData) is not a part of the public ABI, so new fields may be added + * to the end with a minor bump. + */ +typedef struct AVFrameSideData { + enum AVFrameSideDataType type; + uint8_t *data; + size_t size; + AVDictionary *metadata; + AVBufferRef *buf; +} AVFrameSideData; + +/** + * Structure describing a single Region Of Interest. + * + * When multiple regions are defined in a single side-data block, they + * should be ordered from most to least important - some encoders are only + * capable of supporting a limited number of distinct regions, so will have + * to truncate the list. + * + * When overlapping regions are defined, the first region containing a given + * area of the frame applies. + */ +typedef struct AVRegionOfInterest { + /** + * Must be set to the size of this data structure (that is, + * sizeof(AVRegionOfInterest)). + */ + uint32_t self_size; + /** + * Distance in pixels from the top edge of the frame to the top and + * bottom edges and from the left edge of the frame to the left and + * right edges of the rectangle defining this region of interest. + * + * The constraints on a region are encoder dependent, so the region + * actually affected may be slightly larger for alignment or other + * reasons. + */ + int top; + int bottom; + int left; + int right; + /** + * Quantisation offset. + * + * Must be in the range -1 to +1. A value of zero indicates no quality + * change. A negative value asks for better quality (less quantisation), + * while a positive value asks for worse quality (greater quantisation). + * + * The range is calibrated so that the extreme values indicate the + * largest possible offset - if the rest of the frame is encoded with the + * worst possible quality, an offset of -1 indicates that this region + * should be encoded with the best possible quality anyway. Intermediate + * values are then interpolated in some codec-dependent way. + * + * For example, in 10-bit H.264 the quantisation parameter varies between + * -12 and 51. A typical qoffset value of -1/10 therefore indicates that + * this region should be encoded with a QP around one-tenth of the full + * range better than the rest of the frame. So, if most of the frame + * were to be encoded with a QP of around 30, this region would get a QP + * of around 24 (an offset of approximately -1/10 * (51 - -12) = -6.3). + * An extreme value of -1 would indicate that this region should be + * encoded with the best possible quality regardless of the treatment of + * the rest of the frame - that is, should be encoded at a QP of -12. + */ + AVRational qoffset; +} AVRegionOfInterest; + +/** + * This structure describes decoded (raw) audio or video data. + * + * AVFrame must be allocated using av_frame_alloc(). Note that this only + * allocates the AVFrame itself, the buffers for the data must be managed + * through other means (see below). + * AVFrame must be freed with av_frame_free(). + * + * AVFrame is typically allocated once and then reused multiple times to hold + * different data (e.g. a single AVFrame to hold frames received from a + * decoder). In such a case, av_frame_unref() will free any references held by + * the frame and reset it to its original clean state before it + * is reused again. + * + * The data described by an AVFrame is usually reference counted through the + * AVBuffer API. The underlying buffer references are stored in AVFrame.buf / + * AVFrame.extended_buf. An AVFrame is considered to be reference counted if at + * least one reference is set, i.e. if AVFrame.buf[0] != NULL. In such a case, + * every single data plane must be contained in one of the buffers in + * AVFrame.buf or AVFrame.extended_buf. + * There may be a single buffer for all the data, or one separate buffer for + * each plane, or anything in between. + * + * sizeof(AVFrame) is not a part of the public ABI, so new fields may be added + * to the end with a minor bump. + * + * Fields can be accessed through AVOptions, the name string used, matches the + * C structure field name for fields accessible through AVOptions. The AVClass + * for AVFrame can be obtained from avcodec_get_frame_class() + */ +typedef struct AVFrame { +#define AV_NUM_DATA_POINTERS 8 + /** + * pointer to the picture/channel planes. + * This might be different from the first allocated byte. For video, + * it could even point to the end of the image data. + * + * All pointers in data and extended_data must point into one of the + * AVBufferRef in buf or extended_buf. + * + * Some decoders access areas outside 0,0 - width,height, please + * see avcodec_align_dimensions2(). Some filters and swscale can read + * up to 16 bytes beyond the planes, if these filters are to be used, + * then 16 extra bytes must be allocated. + * + * NOTE: Pointers not needed by the format MUST be set to NULL. + * + * @attention In case of video, the data[] pointers can point to the + * end of image data in order to reverse line order, when used in + * combination with negative values in the linesize[] array. + */ + uint8_t *data[AV_NUM_DATA_POINTERS]; + + /** + * For video, a positive or negative value, which is typically indicating + * the size in bytes of each picture line, but it can also be: + * - the negative byte size of lines for vertical flipping + * (with data[n] pointing to the end of the data + * - a positive or negative multiple of the byte size as for accessing + * even and odd fields of a frame (possibly flipped) + * + * For audio, only linesize[0] may be set. For planar audio, each channel + * plane must be the same size. + * + * For video the linesizes should be multiples of the CPUs alignment + * preference, this is 16 or 32 for modern desktop CPUs. + * Some code requires such alignment other code can be slower without + * correct alignment, for yet other it makes no difference. + * + * @note The linesize may be larger than the size of usable data -- there + * may be extra padding present for performance reasons. + * + * @attention In case of video, line size values can be negative to achieve + * a vertically inverted iteration over image lines. + */ + int linesize[AV_NUM_DATA_POINTERS]; + + /** + * pointers to the data planes/channels. + * + * For video, this should simply point to data[]. + * + * For planar audio, each channel has a separate data pointer, and + * linesize[0] contains the size of each channel buffer. + * For packed audio, there is just one data pointer, and linesize[0] + * contains the total size of the buffer for all channels. + * + * Note: Both data and extended_data should always be set in a valid frame, + * but for planar audio with more channels that can fit in data, + * extended_data must be used in order to access all channels. + */ + uint8_t **extended_data; + + /** + * @name Video dimensions + * Video frames only. The coded dimensions (in pixels) of the video frame, + * i.e. the size of the rectangle that contains some well-defined values. + * + * @note The part of the frame intended for display/presentation is further + * restricted by the @ref cropping "Cropping rectangle". + * @{ + */ + int width, height; + /** + * @} + */ + + /** + * number of audio samples (per channel) described by this frame + */ + int nb_samples; + + /** + * format of the frame, -1 if unknown or unset + * Values correspond to enum AVPixelFormat for video frames, + * enum AVSampleFormat for audio) + */ + int format; + +#if FF_API_FRAME_KEY + /** + * 1 -> keyframe, 0-> not + * + * @deprecated Use AV_FRAME_FLAG_KEY instead + */ + attribute_deprecated + int key_frame; +#endif + + /** + * Picture type of the frame. + */ + enum AVPictureType pict_type; + + /** + * Sample aspect ratio for the video frame, 0/1 if unknown/unspecified. + */ + AVRational sample_aspect_ratio; + + /** + * Presentation timestamp in time_base units (time when frame should be shown to user). + */ + int64_t pts; + + /** + * DTS copied from the AVPacket that triggered returning this frame. (if frame threading isn't used) + * This is also the Presentation time of this AVFrame calculated from + * only AVPacket.dts values without pts values. + */ + int64_t pkt_dts; + + /** + * Time base for the timestamps in this frame. + * In the future, this field may be set on frames output by decoders or + * filters, but its value will be by default ignored on input to encoders + * or filters. + */ + AVRational time_base; + +#if FF_API_FRAME_PICTURE_NUMBER + /** + * picture number in bitstream order + */ + attribute_deprecated + int coded_picture_number; + /** + * picture number in display order + */ + attribute_deprecated + int display_picture_number; +#endif + + /** + * quality (between 1 (good) and FF_LAMBDA_MAX (bad)) + */ + int quality; + + /** + * Frame owner's private data. + * + * This field may be set by the code that allocates/owns the frame data. + * It is then not touched by any library functions, except: + * - it is copied to other references by av_frame_copy_props() (and hence by + * av_frame_ref()); + * - it is set to NULL when the frame is cleared by av_frame_unref() + * - on the caller's explicit request. E.g. libavcodec encoders/decoders + * will copy this field to/from @ref AVPacket "AVPackets" if the caller sets + * @ref AV_CODEC_FLAG_COPY_OPAQUE. + * + * @see opaque_ref the reference-counted analogue + */ + void *opaque; + + /** + * Number of fields in this frame which should be repeated, i.e. the total + * duration of this frame should be repeat_pict + 2 normal field durations. + * + * For interlaced frames this field may be set to 1, which signals that this + * frame should be presented as 3 fields: beginning with the first field (as + * determined by AV_FRAME_FLAG_TOP_FIELD_FIRST being set or not), followed + * by the second field, and then the first field again. + * + * For progressive frames this field may be set to a multiple of 2, which + * signals that this frame's duration should be (repeat_pict + 2) / 2 + * normal frame durations. + * + * @note This field is computed from MPEG2 repeat_first_field flag and its + * associated flags, H.264 pic_struct from picture timing SEI, and + * their analogues in other codecs. Typically it should only be used when + * higher-layer timing information is not available. + */ + int repeat_pict; + +#if FF_API_INTERLACED_FRAME + /** + * The content of the picture is interlaced. + * + * @deprecated Use AV_FRAME_FLAG_INTERLACED instead + */ + attribute_deprecated + int interlaced_frame; + + /** + * If the content is interlaced, is top field displayed first. + * + * @deprecated Use AV_FRAME_FLAG_TOP_FIELD_FIRST instead + */ + attribute_deprecated + int top_field_first; +#endif + +#if FF_API_PALETTE_HAS_CHANGED + /** + * Tell user application that palette has changed from previous frame. + */ + attribute_deprecated + int palette_has_changed; +#endif + +#if FF_API_REORDERED_OPAQUE + /** + * reordered opaque 64 bits (generally an integer or a double precision float + * PTS but can be anything). + * The user sets AVCodecContext.reordered_opaque to represent the input at + * that time, + * the decoder reorders values as needed and sets AVFrame.reordered_opaque + * to exactly one of the values provided by the user through AVCodecContext.reordered_opaque + * + * @deprecated Use AV_CODEC_FLAG_COPY_OPAQUE instead + */ + attribute_deprecated + int64_t reordered_opaque; +#endif + + /** + * Sample rate of the audio data. + */ + int sample_rate; + +#if FF_API_OLD_CHANNEL_LAYOUT + /** + * Channel layout of the audio data. + * @deprecated use ch_layout instead + */ + attribute_deprecated + uint64_t channel_layout; +#endif + + /** + * AVBuffer references backing the data for this frame. All the pointers in + * data and extended_data must point inside one of the buffers in buf or + * extended_buf. This array must be filled contiguously -- if buf[i] is + * non-NULL then buf[j] must also be non-NULL for all j < i. + * + * There may be at most one AVBuffer per data plane, so for video this array + * always contains all the references. For planar audio with more than + * AV_NUM_DATA_POINTERS channels, there may be more buffers than can fit in + * this array. Then the extra AVBufferRef pointers are stored in the + * extended_buf array. + */ + AVBufferRef *buf[AV_NUM_DATA_POINTERS]; + + /** + * For planar audio which requires more than AV_NUM_DATA_POINTERS + * AVBufferRef pointers, this array will hold all the references which + * cannot fit into AVFrame.buf. + * + * Note that this is different from AVFrame.extended_data, which always + * contains all the pointers. This array only contains the extra pointers, + * which cannot fit into AVFrame.buf. + * + * This array is always allocated using av_malloc() by whoever constructs + * the frame. It is freed in av_frame_unref(). + */ + AVBufferRef **extended_buf; + /** + * Number of elements in extended_buf. + */ + int nb_extended_buf; + + AVFrameSideData **side_data; + int nb_side_data; + +/** + * @defgroup lavu_frame_flags AV_FRAME_FLAGS + * @ingroup lavu_frame + * Flags describing additional frame properties. + * + * @{ + */ + +/** + * The frame data may be corrupted, e.g. due to decoding errors. + */ +#define AV_FRAME_FLAG_CORRUPT (1 << 0) +/** + * A flag to mark frames that are keyframes. + */ +#define AV_FRAME_FLAG_KEY (1 << 1) +/** + * A flag to mark the frames which need to be decoded, but shouldn't be output. + */ +#define AV_FRAME_FLAG_DISCARD (1 << 2) +/** + * A flag to mark frames whose content is interlaced. + */ +#define AV_FRAME_FLAG_INTERLACED (1 << 3) +/** + * A flag to mark frames where the top field is displayed first if the content + * is interlaced. + */ +#define AV_FRAME_FLAG_TOP_FIELD_FIRST (1 << 4) +/** + * @} + */ + + /** + * Frame flags, a combination of @ref lavu_frame_flags + */ + int flags; + + /** + * MPEG vs JPEG YUV range. + * - encoding: Set by user + * - decoding: Set by libavcodec + */ + enum AVColorRange color_range; + + enum AVColorPrimaries color_primaries; + + enum AVColorTransferCharacteristic color_trc; + + /** + * YUV colorspace type. + * - encoding: Set by user + * - decoding: Set by libavcodec + */ + enum AVColorSpace colorspace; + + enum AVChromaLocation chroma_location; + + /** + * frame timestamp estimated using various heuristics, in stream time base + * - encoding: unused + * - decoding: set by libavcodec, read by user. + */ + int64_t best_effort_timestamp; + +#if FF_API_FRAME_PKT + /** + * reordered pos from the last AVPacket that has been input into the decoder + * - encoding: unused + * - decoding: Read by user. + * @deprecated use AV_CODEC_FLAG_COPY_OPAQUE to pass through arbitrary user + * data from packets to frames + */ + attribute_deprecated + int64_t pkt_pos; +#endif + +#if FF_API_PKT_DURATION + /** + * duration of the corresponding packet, expressed in + * AVStream->time_base units, 0 if unknown. + * - encoding: unused + * - decoding: Read by user. + * + * @deprecated use duration instead + */ + attribute_deprecated + int64_t pkt_duration; +#endif + + /** + * metadata. + * - encoding: Set by user. + * - decoding: Set by libavcodec. + */ + AVDictionary *metadata; + + /** + * decode error flags of the frame, set to a combination of + * FF_DECODE_ERROR_xxx flags if the decoder produced a frame, but there + * were errors during the decoding. + * - encoding: unused + * - decoding: set by libavcodec, read by user. + */ + int decode_error_flags; +#define FF_DECODE_ERROR_INVALID_BITSTREAM 1 +#define FF_DECODE_ERROR_MISSING_REFERENCE 2 +#define FF_DECODE_ERROR_CONCEALMENT_ACTIVE 4 +#define FF_DECODE_ERROR_DECODE_SLICES 8 + +#if FF_API_OLD_CHANNEL_LAYOUT + /** + * number of audio channels, only used for audio. + * - encoding: unused + * - decoding: Read by user. + * @deprecated use ch_layout instead + */ + attribute_deprecated + int channels; +#endif + +#if FF_API_FRAME_PKT + /** + * size of the corresponding packet containing the compressed + * frame. + * It is set to a negative value if unknown. + * - encoding: unused + * - decoding: set by libavcodec, read by user. + * @deprecated use AV_CODEC_FLAG_COPY_OPAQUE to pass through arbitrary user + * data from packets to frames + */ + attribute_deprecated + int pkt_size; +#endif + + /** + * For hwaccel-format frames, this should be a reference to the + * AVHWFramesContext describing the frame. + */ + AVBufferRef *hw_frames_ctx; + + /** + * Frame owner's private data. + * + * This field may be set by the code that allocates/owns the frame data. + * It is then not touched by any library functions, except: + * - a new reference to the underlying buffer is propagated by + * av_frame_copy_props() (and hence by av_frame_ref()); + * - it is unreferenced in av_frame_unref(); + * - on the caller's explicit request. E.g. libavcodec encoders/decoders + * will propagate a new reference to/from @ref AVPacket "AVPackets" if the + * caller sets @ref AV_CODEC_FLAG_COPY_OPAQUE. + * + * @see opaque the plain pointer analogue + */ + AVBufferRef *opaque_ref; + + /** + * @anchor cropping + * @name Cropping + * Video frames only. The number of pixels to discard from the the + * top/bottom/left/right border of the frame to obtain the sub-rectangle of + * the frame intended for presentation. + * @{ + */ + size_t crop_top; + size_t crop_bottom; + size_t crop_left; + size_t crop_right; + /** + * @} + */ + + /** + * AVBufferRef for internal use by a single libav* library. + * Must not be used to transfer data between libraries. + * Has to be NULL when ownership of the frame leaves the respective library. + * + * Code outside the FFmpeg libs should never check or change the contents of the buffer ref. + * + * FFmpeg calls av_buffer_unref() on it when the frame is unreferenced. + * av_frame_copy_props() calls create a new reference with av_buffer_ref() + * for the target frame's private_ref field. + */ + AVBufferRef *private_ref; + + /** + * Channel layout of the audio data. + */ + AVChannelLayout ch_layout; + + /** + * Duration of the frame, in the same units as pts. 0 if unknown. + */ + int64_t duration; +} AVFrame; + + +/** + * Allocate an AVFrame and set its fields to default values. The resulting + * struct must be freed using av_frame_free(). + * + * @return An AVFrame filled with default values or NULL on failure. + * + * @note this only allocates the AVFrame itself, not the data buffers. Those + * must be allocated through other means, e.g. with av_frame_get_buffer() or + * manually. + */ +AVFrame *av_frame_alloc(void); + +/** + * Free the frame and any dynamically allocated objects in it, + * e.g. extended_data. If the frame is reference counted, it will be + * unreferenced first. + * + * @param frame frame to be freed. The pointer will be set to NULL. + */ +void av_frame_free(AVFrame **frame); + +/** + * Set up a new reference to the data described by the source frame. + * + * Copy frame properties from src to dst and create a new reference for each + * AVBufferRef from src. + * + * If src is not reference counted, new buffers are allocated and the data is + * copied. + * + * @warning: dst MUST have been either unreferenced with av_frame_unref(dst), + * or newly allocated with av_frame_alloc() before calling this + * function, or undefined behavior will occur. + * + * @return 0 on success, a negative AVERROR on error + */ +int av_frame_ref(AVFrame *dst, const AVFrame *src); + +/** + * Ensure the destination frame refers to the same data described by the source + * frame, either by creating a new reference for each AVBufferRef from src if + * they differ from those in dst, by allocating new buffers and copying data if + * src is not reference counted, or by unrefencing it if src is empty. + * + * Frame properties on dst will be replaced by those from src. + * + * @return 0 on success, a negative AVERROR on error. On error, dst is + * unreferenced. + */ +int av_frame_replace(AVFrame *dst, const AVFrame *src); + +/** + * Create a new frame that references the same data as src. + * + * This is a shortcut for av_frame_alloc()+av_frame_ref(). + * + * @return newly created AVFrame on success, NULL on error. + */ +AVFrame *av_frame_clone(const AVFrame *src); + +/** + * Unreference all the buffers referenced by frame and reset the frame fields. + */ +void av_frame_unref(AVFrame *frame); + +/** + * Move everything contained in src to dst and reset src. + * + * @warning: dst is not unreferenced, but directly overwritten without reading + * or deallocating its contents. Call av_frame_unref(dst) manually + * before calling this function to ensure that no memory is leaked. + */ +void av_frame_move_ref(AVFrame *dst, AVFrame *src); + +/** + * Allocate new buffer(s) for audio or video data. + * + * The following fields must be set on frame before calling this function: + * - format (pixel format for video, sample format for audio) + * - width and height for video + * - nb_samples and ch_layout for audio + * + * This function will fill AVFrame.data and AVFrame.buf arrays and, if + * necessary, allocate and fill AVFrame.extended_data and AVFrame.extended_buf. + * For planar formats, one buffer will be allocated for each plane. + * + * @warning: if frame already has been allocated, calling this function will + * leak memory. In addition, undefined behavior can occur in certain + * cases. + * + * @param frame frame in which to store the new buffers. + * @param align Required buffer size alignment. If equal to 0, alignment will be + * chosen automatically for the current CPU. It is highly + * recommended to pass 0 here unless you know what you are doing. + * + * @return 0 on success, a negative AVERROR on error. + */ +int av_frame_get_buffer(AVFrame *frame, int align); + +/** + * Check if the frame data is writable. + * + * @return A positive value if the frame data is writable (which is true if and + * only if each of the underlying buffers has only one reference, namely the one + * stored in this frame). Return 0 otherwise. + * + * If 1 is returned the answer is valid until av_buffer_ref() is called on any + * of the underlying AVBufferRefs (e.g. through av_frame_ref() or directly). + * + * @see av_frame_make_writable(), av_buffer_is_writable() + */ +int av_frame_is_writable(AVFrame *frame); + +/** + * Ensure that the frame data is writable, avoiding data copy if possible. + * + * Do nothing if the frame is writable, allocate new buffers and copy the data + * if it is not. Non-refcounted frames behave as non-writable, i.e. a copy + * is always made. + * + * @return 0 on success, a negative AVERROR on error. + * + * @see av_frame_is_writable(), av_buffer_is_writable(), + * av_buffer_make_writable() + */ +int av_frame_make_writable(AVFrame *frame); + +/** + * Copy the frame data from src to dst. + * + * This function does not allocate anything, dst must be already initialized and + * allocated with the same parameters as src. + * + * This function only copies the frame data (i.e. the contents of the data / + * extended data arrays), not any other properties. + * + * @return >= 0 on success, a negative AVERROR on error. + */ +int av_frame_copy(AVFrame *dst, const AVFrame *src); + +/** + * Copy only "metadata" fields from src to dst. + * + * Metadata for the purpose of this function are those fields that do not affect + * the data layout in the buffers. E.g. pts, sample rate (for audio) or sample + * aspect ratio (for video), but not width/height or channel layout. + * Side data is also copied. + */ +int av_frame_copy_props(AVFrame *dst, const AVFrame *src); + +/** + * Get the buffer reference a given data plane is stored in. + * + * @param frame the frame to get the plane's buffer from + * @param plane index of the data plane of interest in frame->extended_data. + * + * @return the buffer reference that contains the plane or NULL if the input + * frame is not valid. + */ +AVBufferRef *av_frame_get_plane_buffer(const AVFrame *frame, int plane); + +/** + * Add a new side data to a frame. + * + * @param frame a frame to which the side data should be added + * @param type type of the added side data + * @param size size of the side data + * + * @return newly added side data on success, NULL on error + */ +AVFrameSideData *av_frame_new_side_data(AVFrame *frame, + enum AVFrameSideDataType type, + size_t size); + +/** + * Add a new side data to a frame from an existing AVBufferRef + * + * @param frame a frame to which the side data should be added + * @param type the type of the added side data + * @param buf an AVBufferRef to add as side data. The ownership of + * the reference is transferred to the frame. + * + * @return newly added side data on success, NULL on error. On failure + * the frame is unchanged and the AVBufferRef remains owned by + * the caller. + */ +AVFrameSideData *av_frame_new_side_data_from_buf(AVFrame *frame, + enum AVFrameSideDataType type, + AVBufferRef *buf); + +/** + * @return a pointer to the side data of a given type on success, NULL if there + * is no side data with such type in this frame. + */ +AVFrameSideData *av_frame_get_side_data(const AVFrame *frame, + enum AVFrameSideDataType type); + +/** + * Remove and free all side data instances of the given type. + */ +void av_frame_remove_side_data(AVFrame *frame, enum AVFrameSideDataType type); + + +/** + * Flags for frame cropping. + */ +enum { + /** + * Apply the maximum possible cropping, even if it requires setting the + * AVFrame.data[] entries to unaligned pointers. Passing unaligned data + * to FFmpeg API is generally not allowed, and causes undefined behavior + * (such as crashes). You can pass unaligned data only to FFmpeg APIs that + * are explicitly documented to accept it. Use this flag only if you + * absolutely know what you are doing. + */ + AV_FRAME_CROP_UNALIGNED = 1 << 0, +}; + +/** + * Crop the given video AVFrame according to its crop_left/crop_top/crop_right/ + * crop_bottom fields. If cropping is successful, the function will adjust the + * data pointers and the width/height fields, and set the crop fields to 0. + * + * In all cases, the cropping boundaries will be rounded to the inherent + * alignment of the pixel format. In some cases, such as for opaque hwaccel + * formats, the left/top cropping is ignored. The crop fields are set to 0 even + * if the cropping was rounded or ignored. + * + * @param frame the frame which should be cropped + * @param flags Some combination of AV_FRAME_CROP_* flags, or 0. + * + * @return >= 0 on success, a negative AVERROR on error. If the cropping fields + * were invalid, AVERROR(ERANGE) is returned, and nothing is changed. + */ +int av_frame_apply_cropping(AVFrame *frame, int flags); + +/** + * @return a string identifying the side data type + */ +const char *av_frame_side_data_name(enum AVFrameSideDataType type); + +/** + * @} + */ + +#endif /* AVUTIL_FRAME_H */ diff --git a/libs/FFmpeg/include/libavutil/hash.h b/libs/FFmpeg/include/libavutil/hash.h new file mode 100644 index 0000000..94151de --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hash.h @@ -0,0 +1,264 @@ +/* + * Copyright (C) 2013 Reimar Döffinger + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_hash_generic + * Generic hashing API + */ + +#ifndef AVUTIL_HASH_H +#define AVUTIL_HASH_H + +#include +#include + +/** + * @defgroup lavu_hash Hash Functions + * @ingroup lavu_crypto + * Hash functions useful in multimedia. + * + * Hash functions are widely used in multimedia, from error checking and + * concealment to internal regression testing. libavutil has efficient + * implementations of a variety of hash functions that may be useful for + * FFmpeg and other multimedia applications. + * + * @{ + * + * @defgroup lavu_hash_generic Generic Hashing API + * An abstraction layer for all hash functions supported by libavutil. + * + * If your application needs to support a wide range of different hash + * functions, then the Generic Hashing API is for you. It provides a generic, + * reusable API for @ref lavu_hash "all hash functions" implemented in libavutil. + * If you just need to use one particular hash function, use the @ref lavu_hash + * "individual hash" directly. + * + * @section Sample Code + * + * A basic template for using the Generic Hashing API follows: + * + * @code + * struct AVHashContext *ctx = NULL; + * const char *hash_name = NULL; + * uint8_t *output_buf = NULL; + * + * // Select from a string returned by av_hash_names() + * hash_name = ...; + * + * // Allocate a hash context + * ret = av_hash_alloc(&ctx, hash_name); + * if (ret < 0) + * return ret; + * + * // Initialize the hash context + * av_hash_init(ctx); + * + * // Update the hash context with data + * while (data_left) { + * av_hash_update(ctx, data, size); + * } + * + * // Now we have no more data, so it is time to finalize the hash and get the + * // output. But we need to first allocate an output buffer. Note that you can + * // use any memory allocation function, including malloc(), not just + * // av_malloc(). + * output_buf = av_malloc(av_hash_get_size(ctx)); + * if (!output_buf) + * return AVERROR(ENOMEM); + * + * // Finalize the hash context. + * // You can use any of the av_hash_final*() functions provided, for other + * // output formats. If you do so, be sure to adjust the memory allocation + * // above. See the function documentation below for the exact amount of extra + * // memory needed. + * av_hash_final(ctx, output_buffer); + * + * // Free the context + * av_hash_freep(&ctx); + * @endcode + * + * @section Hash Function-Specific Information + * If the CRC32 hash is selected, the #AV_CRC_32_IEEE polynomial will be + * used. + * + * If the Murmur3 hash is selected, the default seed will be used. See @ref + * lavu_murmur3_seedinfo "Murmur3" for more information. + * + * @{ + */ + +/** + * @example ffhash.c + * This example is a simple command line application that takes one or more + * arguments. It demonstrates a typical use of the hashing API with allocation, + * initialization, updating, and finalizing. + */ + +struct AVHashContext; + +/** + * Allocate a hash context for the algorithm specified by name. + * + * @return >= 0 for success, a negative error code for failure + * + * @note The context is not initialized after a call to this function; you must + * call av_hash_init() to do so. + */ +int av_hash_alloc(struct AVHashContext **ctx, const char *name); + +/** + * Get the names of available hash algorithms. + * + * This function can be used to enumerate the algorithms. + * + * @param[in] i Index of the hash algorithm, starting from 0 + * @return Pointer to a static string or `NULL` if `i` is out of range + */ +const char *av_hash_names(int i); + +/** + * Get the name of the algorithm corresponding to the given hash context. + */ +const char *av_hash_get_name(const struct AVHashContext *ctx); + +/** + * Maximum value that av_hash_get_size() will currently return. + * + * You can use this if you absolutely want or need to use static allocation for + * the output buffer and are fine with not supporting hashes newly added to + * libavutil without recompilation. + * + * @warning + * Adding new hashes with larger sizes, and increasing the macro while doing + * so, will not be considered an ABI change. To prevent your code from + * overflowing a buffer, either dynamically allocate the output buffer with + * av_hash_get_size(), or limit your use of the Hashing API to hashes that are + * already in FFmpeg during the time of compilation. + */ +#define AV_HASH_MAX_SIZE 64 + +/** + * Get the size of the resulting hash value in bytes. + * + * The maximum value this function will currently return is available as macro + * #AV_HASH_MAX_SIZE. + * + * @param[in] ctx Hash context + * @return Size of the hash value in bytes + */ +int av_hash_get_size(const struct AVHashContext *ctx); + +/** + * Initialize or reset a hash context. + * + * @param[in,out] ctx Hash context + */ +void av_hash_init(struct AVHashContext *ctx); + +/** + * Update a hash context with additional data. + * + * @param[in,out] ctx Hash context + * @param[in] src Data to be added to the hash context + * @param[in] len Size of the additional data + */ +void av_hash_update(struct AVHashContext *ctx, const uint8_t *src, size_t len); + +/** + * Finalize a hash context and compute the actual hash value. + * + * The minimum size of `dst` buffer is given by av_hash_get_size() or + * #AV_HASH_MAX_SIZE. The use of the latter macro is discouraged. + * + * It is not safe to update or finalize a hash context again, if it has already + * been finalized. + * + * @param[in,out] ctx Hash context + * @param[out] dst Where the final hash value will be stored + * + * @see av_hash_final_bin() provides an alternative API + */ +void av_hash_final(struct AVHashContext *ctx, uint8_t *dst); + +/** + * Finalize a hash context and store the actual hash value in a buffer. + * + * It is not safe to update or finalize a hash context again, if it has already + * been finalized. + * + * If `size` is smaller than the hash size (given by av_hash_get_size()), the + * hash is truncated; if size is larger, the buffer is padded with 0. + * + * @param[in,out] ctx Hash context + * @param[out] dst Where the final hash value will be stored + * @param[in] size Number of bytes to write to `dst` + */ +void av_hash_final_bin(struct AVHashContext *ctx, uint8_t *dst, int size); + +/** + * Finalize a hash context and store the hexadecimal representation of the + * actual hash value as a string. + * + * It is not safe to update or finalize a hash context again, if it has already + * been finalized. + * + * The string is always 0-terminated. + * + * If `size` is smaller than `2 * hash_size + 1`, where `hash_size` is the + * value returned by av_hash_get_size(), the string will be truncated. + * + * @param[in,out] ctx Hash context + * @param[out] dst Where the string will be stored + * @param[in] size Maximum number of bytes to write to `dst` + */ +void av_hash_final_hex(struct AVHashContext *ctx, uint8_t *dst, int size); + +/** + * Finalize a hash context and store the Base64 representation of the + * actual hash value as a string. + * + * It is not safe to update or finalize a hash context again, if it has already + * been finalized. + * + * The string is always 0-terminated. + * + * If `size` is smaller than AV_BASE64_SIZE(hash_size), where `hash_size` is + * the value returned by av_hash_get_size(), the string will be truncated. + * + * @param[in,out] ctx Hash context + * @param[out] dst Where the final hash value will be stored + * @param[in] size Maximum number of bytes to write to `dst` + */ +void av_hash_final_b64(struct AVHashContext *ctx, uint8_t *dst, int size); + +/** + * Free hash context and set hash context pointer to `NULL`. + * + * @param[in,out] ctx Pointer to hash context + */ +void av_hash_freep(struct AVHashContext **ctx); + +/** + * @} + * @} + */ + +#endif /* AVUTIL_HASH_H */ diff --git a/libs/FFmpeg/include/libavutil/hdr_dynamic_metadata.h b/libs/FFmpeg/include/libavutil/hdr_dynamic_metadata.h new file mode 100644 index 0000000..09e9d8b --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hdr_dynamic_metadata.h @@ -0,0 +1,376 @@ +/* + * Copyright (c) 2018 Mohammad Izadi + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HDR_DYNAMIC_METADATA_H +#define AVUTIL_HDR_DYNAMIC_METADATA_H + +#include "frame.h" +#include "rational.h" + +/** + * Option for overlapping elliptical pixel selectors in an image. + */ +enum AVHDRPlusOverlapProcessOption { + AV_HDR_PLUS_OVERLAP_PROCESS_WEIGHTED_AVERAGING = 0, + AV_HDR_PLUS_OVERLAP_PROCESS_LAYERING = 1, +}; + +/** + * Represents the percentile at a specific percentage in + * a distribution. + */ +typedef struct AVHDRPlusPercentile { + /** + * The percentage value corresponding to a specific percentile linearized + * RGB value in the processing window in the scene. The value shall be in + * the range of 0 to100, inclusive. + */ + uint8_t percentage; + + /** + * The linearized maxRGB value at a specific percentile in the processing + * window in the scene. The value shall be in the range of 0 to 1, inclusive + * and in multiples of 0.00001. + */ + AVRational percentile; +} AVHDRPlusPercentile; + +/** + * Color transform parameters at a processing window in a dynamic metadata for + * SMPTE 2094-40. + */ +typedef struct AVHDRPlusColorTransformParams { + /** + * The relative x coordinate of the top left pixel of the processing + * window. The value shall be in the range of 0 and 1, inclusive and + * in multiples of 1/(width of Picture - 1). The value 1 corresponds + * to the absolute coordinate of width of Picture - 1. The value for + * first processing window shall be 0. + */ + AVRational window_upper_left_corner_x; + + /** + * The relative y coordinate of the top left pixel of the processing + * window. The value shall be in the range of 0 and 1, inclusive and + * in multiples of 1/(height of Picture - 1). The value 1 corresponds + * to the absolute coordinate of height of Picture - 1. The value for + * first processing window shall be 0. + */ + AVRational window_upper_left_corner_y; + + /** + * The relative x coordinate of the bottom right pixel of the processing + * window. The value shall be in the range of 0 and 1, inclusive and + * in multiples of 1/(width of Picture - 1). The value 1 corresponds + * to the absolute coordinate of width of Picture - 1. The value for + * first processing window shall be 1. + */ + AVRational window_lower_right_corner_x; + + /** + * The relative y coordinate of the bottom right pixel of the processing + * window. The value shall be in the range of 0 and 1, inclusive and + * in multiples of 1/(height of Picture - 1). The value 1 corresponds + * to the absolute coordinate of height of Picture - 1. The value for + * first processing window shall be 1. + */ + AVRational window_lower_right_corner_y; + + /** + * The x coordinate of the center position of the concentric internal and + * external ellipses of the elliptical pixel selector in the processing + * window. The value shall be in the range of 0 to (width of Picture - 1), + * inclusive and in multiples of 1 pixel. + */ + uint16_t center_of_ellipse_x; + + /** + * The y coordinate of the center position of the concentric internal and + * external ellipses of the elliptical pixel selector in the processing + * window. The value shall be in the range of 0 to (height of Picture - 1), + * inclusive and in multiples of 1 pixel. + */ + uint16_t center_of_ellipse_y; + + /** + * The clockwise rotation angle in degree of arc with respect to the + * positive direction of the x-axis of the concentric internal and external + * ellipses of the elliptical pixel selector in the processing window. The + * value shall be in the range of 0 to 180, inclusive and in multiples of 1. + */ + uint8_t rotation_angle; + + /** + * The semi-major axis value of the internal ellipse of the elliptical pixel + * selector in amount of pixels in the processing window. The value shall be + * in the range of 1 to 65535, inclusive and in multiples of 1 pixel. + */ + uint16_t semimajor_axis_internal_ellipse; + + /** + * The semi-major axis value of the external ellipse of the elliptical pixel + * selector in amount of pixels in the processing window. The value + * shall not be less than semimajor_axis_internal_ellipse of the current + * processing window. The value shall be in the range of 1 to 65535, + * inclusive and in multiples of 1 pixel. + */ + uint16_t semimajor_axis_external_ellipse; + + /** + * The semi-minor axis value of the external ellipse of the elliptical pixel + * selector in amount of pixels in the processing window. The value shall be + * in the range of 1 to 65535, inclusive and in multiples of 1 pixel. + */ + uint16_t semiminor_axis_external_ellipse; + + /** + * Overlap process option indicates one of the two methods of combining + * rendered pixels in the processing window in an image with at least one + * elliptical pixel selector. For overlapping elliptical pixel selectors + * in an image, overlap_process_option shall have the same value. + */ + enum AVHDRPlusOverlapProcessOption overlap_process_option; + + /** + * The maximum of the color components of linearized RGB values in the + * processing window in the scene. The values should be in the range of 0 to + * 1, inclusive and in multiples of 0.00001. maxscl[ 0 ], maxscl[ 1 ], and + * maxscl[ 2 ] are corresponding to R, G, B color components respectively. + */ + AVRational maxscl[3]; + + /** + * The average of linearized maxRGB values in the processing window in the + * scene. The value should be in the range of 0 to 1, inclusive and in + * multiples of 0.00001. + */ + AVRational average_maxrgb; + + /** + * The number of linearized maxRGB values at given percentiles in the + * processing window in the scene. The maximum value shall be 15. + */ + uint8_t num_distribution_maxrgb_percentiles; + + /** + * The linearized maxRGB values at given percentiles in the + * processing window in the scene. + */ + AVHDRPlusPercentile distribution_maxrgb[15]; + + /** + * The fraction of selected pixels in the image that contains the brightest + * pixel in the scene. The value shall be in the range of 0 to 1, inclusive + * and in multiples of 0.001. + */ + AVRational fraction_bright_pixels; + + /** + * This flag indicates that the metadata for the tone mapping function in + * the processing window is present (for value of 1). + */ + uint8_t tone_mapping_flag; + + /** + * The x coordinate of the separation point between the linear part and the + * curved part of the tone mapping function. The value shall be in the range + * of 0 to 1, excluding 0 and in multiples of 1/4095. + */ + AVRational knee_point_x; + + /** + * The y coordinate of the separation point between the linear part and the + * curved part of the tone mapping function. The value shall be in the range + * of 0 to 1, excluding 0 and in multiples of 1/4095. + */ + AVRational knee_point_y; + + /** + * The number of the intermediate anchor parameters of the tone mapping + * function in the processing window. The maximum value shall be 15. + */ + uint8_t num_bezier_curve_anchors; + + /** + * The intermediate anchor parameters of the tone mapping function in the + * processing window in the scene. The values should be in the range of 0 + * to 1, inclusive and in multiples of 1/1023. + */ + AVRational bezier_curve_anchors[15]; + + /** + * This flag shall be equal to 0 in bitstreams conforming to this version of + * this Specification. Other values are reserved for future use. + */ + uint8_t color_saturation_mapping_flag; + + /** + * The color saturation gain in the processing window in the scene. The + * value shall be in the range of 0 to 63/8, inclusive and in multiples of + * 1/8. The default value shall be 1. + */ + AVRational color_saturation_weight; +} AVHDRPlusColorTransformParams; + +/** + * This struct represents dynamic metadata for color volume transform - + * application 4 of SMPTE 2094-40:2016 standard. + * + * To be used as payload of a AVFrameSideData or AVPacketSideData with the + * appropriate type. + * + * @note The struct should be allocated with + * av_dynamic_hdr_plus_alloc() and its size is not a part of + * the public ABI. + */ +typedef struct AVDynamicHDRPlus { + /** + * Country code by Rec. ITU-T T.35 Annex A. The value shall be 0xB5. + */ + uint8_t itu_t_t35_country_code; + + /** + * Application version in the application defining document in ST-2094 + * suite. The value shall be set to 0. + */ + uint8_t application_version; + + /** + * The number of processing windows. The value shall be in the range + * of 1 to 3, inclusive. + */ + uint8_t num_windows; + + /** + * The color transform parameters for every processing window. + */ + AVHDRPlusColorTransformParams params[3]; + + /** + * The nominal maximum display luminance of the targeted system display, + * in units of 0.0001 candelas per square metre. The value shall be in + * the range of 0 to 10000, inclusive. + */ + AVRational targeted_system_display_maximum_luminance; + + /** + * This flag shall be equal to 0 in bit streams conforming to this version + * of this Specification. The value 1 is reserved for future use. + */ + uint8_t targeted_system_display_actual_peak_luminance_flag; + + /** + * The number of rows in the targeted system_display_actual_peak_luminance + * array. The value shall be in the range of 2 to 25, inclusive. + */ + uint8_t num_rows_targeted_system_display_actual_peak_luminance; + + /** + * The number of columns in the + * targeted_system_display_actual_peak_luminance array. The value shall be + * in the range of 2 to 25, inclusive. + */ + uint8_t num_cols_targeted_system_display_actual_peak_luminance; + + /** + * The normalized actual peak luminance of the targeted system display. The + * values should be in the range of 0 to 1, inclusive and in multiples of + * 1/15. + */ + AVRational targeted_system_display_actual_peak_luminance[25][25]; + + /** + * This flag shall be equal to 0 in bitstreams conforming to this version of + * this Specification. The value 1 is reserved for future use. + */ + uint8_t mastering_display_actual_peak_luminance_flag; + + /** + * The number of rows in the mastering_display_actual_peak_luminance array. + * The value shall be in the range of 2 to 25, inclusive. + */ + uint8_t num_rows_mastering_display_actual_peak_luminance; + + /** + * The number of columns in the mastering_display_actual_peak_luminance + * array. The value shall be in the range of 2 to 25, inclusive. + */ + uint8_t num_cols_mastering_display_actual_peak_luminance; + + /** + * The normalized actual peak luminance of the mastering display used for + * mastering the image essence. The values should be in the range of 0 to 1, + * inclusive and in multiples of 1/15. + */ + AVRational mastering_display_actual_peak_luminance[25][25]; +} AVDynamicHDRPlus; + +/** + * Allocate an AVDynamicHDRPlus structure and set its fields to + * default values. The resulting struct can be freed using av_freep(). + * + * @return An AVDynamicHDRPlus filled with default values or NULL + * on failure. + */ +AVDynamicHDRPlus *av_dynamic_hdr_plus_alloc(size_t *size); + +/** + * Allocate a complete AVDynamicHDRPlus and add it to the frame. + * @param frame The frame which side data is added to. + * + * @return The AVDynamicHDRPlus structure to be filled by caller or NULL + * on failure. + */ +AVDynamicHDRPlus *av_dynamic_hdr_plus_create_side_data(AVFrame *frame); + +/** + * Parse the user data registered ITU-T T.35 to AVbuffer (AVDynamicHDRPlus). + * The T.35 buffer must begin with the application mode, skipping the + * country code, terminal provider codes, and application identifier. + * @param s A pointer containing the decoded AVDynamicHDRPlus structure. + * @param data The byte array containing the raw ITU-T T.35 data. + * @param size Size of the data array in bytes. + * + * @return >= 0 on success. Otherwise, returns the appropriate AVERROR. + */ +int av_dynamic_hdr_plus_from_t35(AVDynamicHDRPlus *s, const uint8_t *data, + size_t size); + +#define AV_HDR_PLUS_MAX_PAYLOAD_SIZE 907 + +/** + * Serialize dynamic HDR10+ metadata to a user data registered ITU-T T.35 buffer, + * excluding the first 48 bytes of the header, and beginning with the application mode. + * @param s A pointer containing the decoded AVDynamicHDRPlus structure. + * @param data[in,out] A pointer to pointer to a byte buffer to be filled with the + * serialized metadata. + * If *data is NULL, a buffer be will be allocated and a pointer to + * it stored in its place. The caller assumes ownership of the buffer. + * May be NULL, in which case the function will only store the + * required buffer size in *size. + * @param size[in,out] A pointer to a size to be set to the returned buffer's size. + * If *data is not NULL, *size must contain the size of the input + * buffer. May be NULL only if *data is NULL. + * + * @return >= 0 on success. Otherwise, returns the appropriate AVERROR. + */ +int av_dynamic_hdr_plus_to_t35(const AVDynamicHDRPlus *s, uint8_t **data, size_t *size); + +#endif /* AVUTIL_HDR_DYNAMIC_METADATA_H */ diff --git a/libs/FFmpeg/include/libavutil/hdr_dynamic_vivid_metadata.h b/libs/FFmpeg/include/libavutil/hdr_dynamic_vivid_metadata.h new file mode 100644 index 0000000..4524a81 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hdr_dynamic_vivid_metadata.h @@ -0,0 +1,346 @@ +/* + * Copyright (c) 2021 Limin Wang + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HDR_DYNAMIC_VIVID_METADATA_H +#define AVUTIL_HDR_DYNAMIC_VIVID_METADATA_H + +#include "frame.h" +#include "rational.h" + +/** + * HDR Vivid three spline params. + */ +typedef struct AVHDRVivid3SplineParams { + /** + * The mode of three Spline. the value shall be in the range + * of 0 to 3, inclusive. + */ + int th_mode; + + /** + * three_Spline_TH_enable_MB is in the range of 0.0 to 1.0, inclusive + * and in multiples of 1.0/255. + * + */ + AVRational th_enable_mb; + + /** + * 3Spline_TH_enable of three Spline. + * The value shall be in the range of 0.0 to 1.0, inclusive. + * and in multiples of 1.0/4095. + */ + AVRational th_enable; + + /** + * 3Spline_TH_Delta1 of three Spline. + * The value shall be in the range of 0.0 to 0.25, inclusive, + * and in multiples of 0.25/1023. + */ + AVRational th_delta1; + + /** + * 3Spline_TH_Delta2 of three Spline. + * The value shall be in the range of 0.0 to 0.25, inclusive, + * and in multiples of 0.25/1023. + */ + AVRational th_delta2; + + /** + * 3Spline_enable_Strength of three Spline. + * The value shall be in the range of 0.0 to 1.0, inclusive, + * and in multiples of 1.0/255. + */ + AVRational enable_strength; +} AVHDRVivid3SplineParams; + +/** + * Color tone mapping parameters at a processing window in a dynamic metadata for + * CUVA 005.1:2021. + */ +typedef struct AVHDRVividColorToneMappingParams { + /** + * The nominal maximum display luminance of the targeted system display, + * in multiples of 1.0/4095 candelas per square metre. The value shall be in + * the range of 0.0 to 1.0, inclusive. + */ + AVRational targeted_system_display_maximum_luminance; + + /** + * This flag indicates that transfer the base paramter(for value of 1) + */ + int base_enable_flag; + + /** + * base_param_m_p in the base parameter, + * in multiples of 1.0/16383. The value shall be in + * the range of 0.0 to 1.0, inclusive. + */ + AVRational base_param_m_p; + + /** + * base_param_m_m in the base parameter, + * in multiples of 1.0/10. The value shall be in + * the range of 0.0 to 6.3, inclusive. + */ + AVRational base_param_m_m; + + /** + * base_param_m_a in the base parameter, + * in multiples of 1.0/1023. The value shall be in + * the range of 0.0 to 1.0 inclusive. + */ + AVRational base_param_m_a; + + /** + * base_param_m_b in the base parameter, + * in multiples of 1/1023. The value shall be in + * the range of 0.0 to 1.0, inclusive. + */ + AVRational base_param_m_b; + + /** + * base_param_m_n in the base parameter, + * in multiples of 1.0/10. The value shall be in + * the range of 0.0 to 6.3, inclusive. + */ + AVRational base_param_m_n; + + /** + * indicates k1_0 in the base parameter, + * base_param_k1 <= 1: k1_0 = base_param_k1 + * base_param_k1 > 1: reserved + */ + int base_param_k1; + + /** + * indicates k2_0 in the base parameter, + * base_param_k2 <= 1: k2_0 = base_param_k2 + * base_param_k2 > 1: reserved + */ + int base_param_k2; + + /** + * indicates k3_0 in the base parameter, + * base_param_k3 == 1: k3_0 = base_param_k3 + * base_param_k3 == 2: k3_0 = maximum_maxrgb + * base_param_k3 > 2: reserved + */ + int base_param_k3; + + /** + * This flag indicates that delta mode of base paramter(for value of 1) + */ + int base_param_Delta_enable_mode; + + /** + * base_param_Delta in the base parameter, + * in multiples of 1.0/127. The value shall be in + * the range of 0.0 to 1.0, inclusive. + */ + AVRational base_param_Delta; + + /** + * indicates 3Spline_enable_flag in the base parameter, + * This flag indicates that transfer three Spline of base paramter(for value of 1) + */ + int three_Spline_enable_flag; + + /** + * The number of three Spline. The value shall be in the range + * of 1 to 2, inclusive. + */ + int three_Spline_num; + +#if FF_API_HDR_VIVID_THREE_SPLINE + /** + * The mode of three Spline. the value shall be in the range + * of 0 to 3, inclusive. + * @deprecated Use three_spline instead + */ + attribute_deprecated + int three_Spline_TH_mode; + + /** + * three_Spline_TH_enable_MB is in the range of 0.0 to 1.0, inclusive + * and in multiples of 1.0/255. + * @deprecated Use three_spline instead + */ + attribute_deprecated + AVRational three_Spline_TH_enable_MB; + + /** + * 3Spline_TH_enable of three Spline. + * The value shall be in the range of 0.0 to 1.0, inclusive. + * and in multiples of 1.0/4095. + * @deprecated Use three_spline instead + */ + attribute_deprecated + AVRational three_Spline_TH_enable; + + /** + * 3Spline_TH_Delta1 of three Spline. + * The value shall be in the range of 0.0 to 0.25, inclusive, + * and in multiples of 0.25/1023. + * @deprecated Use three_spline instead + */ + attribute_deprecated + AVRational three_Spline_TH_Delta1; + + /** + * 3Spline_TH_Delta2 of three Spline. + * The value shall be in the range of 0.0 to 0.25, inclusive, + * and in multiples of 0.25/1023. + * @deprecated Use three_spline instead + */ + attribute_deprecated + AVRational three_Spline_TH_Delta2; + + /** + * 3Spline_enable_Strength of three Spline. + * The value shall be in the range of 0.0 to 1.0, inclusive, + * and in multiples of 1.0/255. + * @deprecated Use three_spline instead + */ + attribute_deprecated + AVRational three_Spline_enable_Strength; +#endif + + AVHDRVivid3SplineParams three_spline[2]; +} AVHDRVividColorToneMappingParams; + + +/** + * Color transform parameters at a processing window in a dynamic metadata for + * CUVA 005.1:2021. + */ +typedef struct AVHDRVividColorTransformParams { + /** + * Indicates the minimum brightness of the displayed content. + * The values should be in the range of 0.0 to 1.0, + * inclusive and in multiples of 1/4095. + */ + AVRational minimum_maxrgb; + + /** + * Indicates the average brightness of the displayed content. + * The values should be in the range of 0.0 to 1.0, + * inclusive and in multiples of 1/4095. + */ + AVRational average_maxrgb; + + /** + * Indicates the variance brightness of the displayed content. + * The values should be in the range of 0.0 to 1.0, + * inclusive and in multiples of 1/4095. + */ + AVRational variance_maxrgb; + + /** + * Indicates the maximum brightness of the displayed content. + * The values should be in the range of 0.0 to 1.0, inclusive + * and in multiples of 1/4095. + */ + AVRational maximum_maxrgb; + + /** + * This flag indicates that the metadata for the tone mapping function in + * the processing window is present (for value of 1). + */ + int tone_mapping_mode_flag; + + /** + * The number of tone mapping param. The value shall be in the range + * of 1 to 2, inclusive. + */ + int tone_mapping_param_num; + + /** + * The color tone mapping parameters. + */ + AVHDRVividColorToneMappingParams tm_params[2]; + + /** + * This flag indicates that the metadata for the color saturation mapping in + * the processing window is present (for value of 1). + */ + int color_saturation_mapping_flag; + + /** + * The number of color saturation param. The value shall be in the range + * of 0 to 7, inclusive. + */ + int color_saturation_num; + + /** + * Indicates the color correction strength parameter. + * The values should be in the range of 0.0 to 2.0, inclusive + * and in multiples of 1/128. + */ + AVRational color_saturation_gain[8]; +} AVHDRVividColorTransformParams; + +/** + * This struct represents dynamic metadata for color volume transform - + * CUVA 005.1:2021 standard + * + * To be used as payload of a AVFrameSideData or AVPacketSideData with the + * appropriate type. + * + * @note The struct should be allocated with + * av_dynamic_hdr_vivid_alloc() and its size is not a part of + * the public ABI. + */ +typedef struct AVDynamicHDRVivid { + /** + * The system start code. The value shall be set to 0x01. + */ + uint8_t system_start_code; + + /** + * The number of processing windows. The value shall be set to 0x01 + * if the system_start_code is 0x01. + */ + uint8_t num_windows; + + /** + * The color transform parameters for every processing window. + */ + AVHDRVividColorTransformParams params[3]; +} AVDynamicHDRVivid; + +/** + * Allocate an AVDynamicHDRVivid structure and set its fields to + * default values. The resulting struct can be freed using av_freep(). + * + * @return An AVDynamicHDRVivid filled with default values or NULL + * on failure. + */ +AVDynamicHDRVivid *av_dynamic_hdr_vivid_alloc(size_t *size); + +/** + * Allocate a complete AVDynamicHDRVivid and add it to the frame. + * @param frame The frame which side data is added to. + * + * @return The AVDynamicHDRVivid structure to be filled by caller or NULL + * on failure. + */ +AVDynamicHDRVivid *av_dynamic_hdr_vivid_create_side_data(AVFrame *frame); + +#endif /* AVUTIL_HDR_DYNAMIC_VIVID_METADATA_H */ diff --git a/libs/FFmpeg/include/libavutil/hmac.h b/libs/FFmpeg/include/libavutil/hmac.h new file mode 100644 index 0000000..ca4da6a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hmac.h @@ -0,0 +1,99 @@ +/* + * Copyright (C) 2012 Martin Storsjo + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HMAC_H +#define AVUTIL_HMAC_H + +#include + +/** + * @defgroup lavu_hmac HMAC + * @ingroup lavu_crypto + * @{ + */ + +enum AVHMACType { + AV_HMAC_MD5, + AV_HMAC_SHA1, + AV_HMAC_SHA224, + AV_HMAC_SHA256, + AV_HMAC_SHA384, + AV_HMAC_SHA512, +}; + +typedef struct AVHMAC AVHMAC; + +/** + * Allocate an AVHMAC context. + * @param type The hash function used for the HMAC. + */ +AVHMAC *av_hmac_alloc(enum AVHMACType type); + +/** + * Free an AVHMAC context. + * @param ctx The context to free, may be NULL + */ +void av_hmac_free(AVHMAC *ctx); + +/** + * Initialize an AVHMAC context with an authentication key. + * @param ctx The HMAC context + * @param key The authentication key + * @param keylen The length of the key, in bytes + */ +void av_hmac_init(AVHMAC *ctx, const uint8_t *key, unsigned int keylen); + +/** + * Hash data with the HMAC. + * @param ctx The HMAC context + * @param data The data to hash + * @param len The length of the data, in bytes + */ +void av_hmac_update(AVHMAC *ctx, const uint8_t *data, unsigned int len); + +/** + * Finish hashing and output the HMAC digest. + * @param ctx The HMAC context + * @param out The output buffer to write the digest into + * @param outlen The length of the out buffer, in bytes + * @return The number of bytes written to out, or a negative error code. + */ +int av_hmac_final(AVHMAC *ctx, uint8_t *out, unsigned int outlen); + +/** + * Hash an array of data with a key. + * @param ctx The HMAC context + * @param data The data to hash + * @param len The length of the data, in bytes + * @param key The authentication key + * @param keylen The length of the key, in bytes + * @param out The output buffer to write the digest into + * @param outlen The length of the out buffer, in bytes + * @return The number of bytes written to out, or a negative error code. + */ +int av_hmac_calc(AVHMAC *ctx, const uint8_t *data, unsigned int len, + const uint8_t *key, unsigned int keylen, + uint8_t *out, unsigned int outlen); + +/** + * @} + */ + +#endif /* AVUTIL_HMAC_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext.h b/libs/FFmpeg/include/libavutil/hwcontext.h new file mode 100644 index 0000000..7ff08c8 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext.h @@ -0,0 +1,610 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_H +#define AVUTIL_HWCONTEXT_H + +#include "buffer.h" +#include "frame.h" +#include "log.h" +#include "pixfmt.h" + +enum AVHWDeviceType { + AV_HWDEVICE_TYPE_NONE, + AV_HWDEVICE_TYPE_VDPAU, + AV_HWDEVICE_TYPE_CUDA, + AV_HWDEVICE_TYPE_VAAPI, + AV_HWDEVICE_TYPE_DXVA2, + AV_HWDEVICE_TYPE_QSV, + AV_HWDEVICE_TYPE_VIDEOTOOLBOX, + AV_HWDEVICE_TYPE_D3D11VA, + AV_HWDEVICE_TYPE_DRM, + AV_HWDEVICE_TYPE_OPENCL, + AV_HWDEVICE_TYPE_MEDIACODEC, + AV_HWDEVICE_TYPE_VULKAN, +}; + +typedef struct AVHWDeviceInternal AVHWDeviceInternal; + +/** + * This struct aggregates all the (hardware/vendor-specific) "high-level" state, + * i.e. state that is not tied to a concrete processing configuration. + * E.g., in an API that supports hardware-accelerated encoding and decoding, + * this struct will (if possible) wrap the state that is common to both encoding + * and decoding and from which specific instances of encoders or decoders can be + * derived. + * + * This struct is reference-counted with the AVBuffer mechanism. The + * av_hwdevice_ctx_alloc() constructor yields a reference, whose data field + * points to the actual AVHWDeviceContext. Further objects derived from + * AVHWDeviceContext (such as AVHWFramesContext, describing a frame pool with + * specific properties) will hold an internal reference to it. After all the + * references are released, the AVHWDeviceContext itself will be freed, + * optionally invoking a user-specified callback for uninitializing the hardware + * state. + */ +typedef struct AVHWDeviceContext { + /** + * A class for logging. Set by av_hwdevice_ctx_alloc(). + */ + const AVClass *av_class; + + /** + * Private data used internally by libavutil. Must not be accessed in any + * way by the caller. + */ + AVHWDeviceInternal *internal; + + /** + * This field identifies the underlying API used for hardware access. + * + * This field is set when this struct is allocated and never changed + * afterwards. + */ + enum AVHWDeviceType type; + + /** + * The format-specific data, allocated and freed by libavutil along with + * this context. + * + * Should be cast by the user to the format-specific context defined in the + * corresponding header (hwcontext_*.h) and filled as described in the + * documentation before calling av_hwdevice_ctx_init(). + * + * After calling av_hwdevice_ctx_init() this struct should not be modified + * by the caller. + */ + void *hwctx; + + /** + * This field may be set by the caller before calling av_hwdevice_ctx_init(). + * + * If non-NULL, this callback will be called when the last reference to + * this context is unreferenced, immediately before it is freed. + * + * @note when other objects (e.g an AVHWFramesContext) are derived from this + * struct, this callback will be invoked after all such child objects + * are fully uninitialized and their respective destructors invoked. + */ + void (*free)(struct AVHWDeviceContext *ctx); + + /** + * Arbitrary user data, to be used e.g. by the free() callback. + */ + void *user_opaque; +} AVHWDeviceContext; + +typedef struct AVHWFramesInternal AVHWFramesInternal; + +/** + * This struct describes a set or pool of "hardware" frames (i.e. those with + * data not located in normal system memory). All the frames in the pool are + * assumed to be allocated in the same way and interchangeable. + * + * This struct is reference-counted with the AVBuffer mechanism and tied to a + * given AVHWDeviceContext instance. The av_hwframe_ctx_alloc() constructor + * yields a reference, whose data field points to the actual AVHWFramesContext + * struct. + */ +typedef struct AVHWFramesContext { + /** + * A class for logging. + */ + const AVClass *av_class; + + /** + * Private data used internally by libavutil. Must not be accessed in any + * way by the caller. + */ + AVHWFramesInternal *internal; + + /** + * A reference to the parent AVHWDeviceContext. This reference is owned and + * managed by the enclosing AVHWFramesContext, but the caller may derive + * additional references from it. + */ + AVBufferRef *device_ref; + + /** + * The parent AVHWDeviceContext. This is simply a pointer to + * device_ref->data provided for convenience. + * + * Set by libavutil in av_hwframe_ctx_init(). + */ + AVHWDeviceContext *device_ctx; + + /** + * The format-specific data, allocated and freed automatically along with + * this context. + * + * Should be cast by the user to the format-specific context defined in the + * corresponding header (hwframe_*.h) and filled as described in the + * documentation before calling av_hwframe_ctx_init(). + * + * After any frames using this context are created, the contents of this + * struct should not be modified by the caller. + */ + void *hwctx; + + /** + * This field may be set by the caller before calling av_hwframe_ctx_init(). + * + * If non-NULL, this callback will be called when the last reference to + * this context is unreferenced, immediately before it is freed. + */ + void (*free)(struct AVHWFramesContext *ctx); + + /** + * Arbitrary user data, to be used e.g. by the free() callback. + */ + void *user_opaque; + + /** + * A pool from which the frames are allocated by av_hwframe_get_buffer(). + * This field may be set by the caller before calling av_hwframe_ctx_init(). + * The buffers returned by calling av_buffer_pool_get() on this pool must + * have the properties described in the documentation in the corresponding hw + * type's header (hwcontext_*.h). The pool will be freed strictly before + * this struct's free() callback is invoked. + * + * This field may be NULL, then libavutil will attempt to allocate a pool + * internally. Note that certain device types enforce pools allocated at + * fixed size (frame count), which cannot be extended dynamically. In such a + * case, initial_pool_size must be set appropriately. + */ + AVBufferPool *pool; + + /** + * Initial size of the frame pool. If a device type does not support + * dynamically resizing the pool, then this is also the maximum pool size. + * + * May be set by the caller before calling av_hwframe_ctx_init(). Must be + * set if pool is NULL and the device type does not support dynamic pools. + */ + int initial_pool_size; + + /** + * The pixel format identifying the underlying HW surface type. + * + * Must be a hwaccel format, i.e. the corresponding descriptor must have the + * AV_PIX_FMT_FLAG_HWACCEL flag set. + * + * Must be set by the user before calling av_hwframe_ctx_init(). + */ + enum AVPixelFormat format; + + /** + * The pixel format identifying the actual data layout of the hardware + * frames. + * + * Must be set by the caller before calling av_hwframe_ctx_init(). + * + * @note when the underlying API does not provide the exact data layout, but + * only the colorspace/bit depth, this field should be set to the fully + * planar version of that format (e.g. for 8-bit 420 YUV it should be + * AV_PIX_FMT_YUV420P, not AV_PIX_FMT_NV12 or anything else). + */ + enum AVPixelFormat sw_format; + + /** + * The allocated dimensions of the frames in this pool. + * + * Must be set by the user before calling av_hwframe_ctx_init(). + */ + int width, height; +} AVHWFramesContext; + +/** + * Look up an AVHWDeviceType by name. + * + * @param name String name of the device type (case-insensitive). + * @return The type from enum AVHWDeviceType, or AV_HWDEVICE_TYPE_NONE if + * not found. + */ +enum AVHWDeviceType av_hwdevice_find_type_by_name(const char *name); + +/** Get the string name of an AVHWDeviceType. + * + * @param type Type from enum AVHWDeviceType. + * @return Pointer to a static string containing the name, or NULL if the type + * is not valid. + */ +const char *av_hwdevice_get_type_name(enum AVHWDeviceType type); + +/** + * Iterate over supported device types. + * + * @param prev AV_HWDEVICE_TYPE_NONE initially, then the previous type + * returned by this function in subsequent iterations. + * @return The next usable device type from enum AVHWDeviceType, or + * AV_HWDEVICE_TYPE_NONE if there are no more. + */ +enum AVHWDeviceType av_hwdevice_iterate_types(enum AVHWDeviceType prev); + +/** + * Allocate an AVHWDeviceContext for a given hardware type. + * + * @param type the type of the hardware device to allocate. + * @return a reference to the newly created AVHWDeviceContext on success or NULL + * on failure. + */ +AVBufferRef *av_hwdevice_ctx_alloc(enum AVHWDeviceType type); + +/** + * Finalize the device context before use. This function must be called after + * the context is filled with all the required information and before it is + * used in any way. + * + * @param ref a reference to the AVHWDeviceContext + * @return 0 on success, a negative AVERROR code on failure + */ +int av_hwdevice_ctx_init(AVBufferRef *ref); + +/** + * Open a device of the specified type and create an AVHWDeviceContext for it. + * + * This is a convenience function intended to cover the simple cases. Callers + * who need to fine-tune device creation/management should open the device + * manually and then wrap it in an AVHWDeviceContext using + * av_hwdevice_ctx_alloc()/av_hwdevice_ctx_init(). + * + * The returned context is already initialized and ready for use, the caller + * should not call av_hwdevice_ctx_init() on it. The user_opaque/free fields of + * the created AVHWDeviceContext are set by this function and should not be + * touched by the caller. + * + * @param device_ctx On success, a reference to the newly-created device context + * will be written here. The reference is owned by the caller + * and must be released with av_buffer_unref() when no longer + * needed. On failure, NULL will be written to this pointer. + * @param type The type of the device to create. + * @param device A type-specific string identifying the device to open. + * @param opts A dictionary of additional (type-specific) options to use in + * opening the device. The dictionary remains owned by the caller. + * @param flags currently unused + * + * @return 0 on success, a negative AVERROR code on failure. + */ +int av_hwdevice_ctx_create(AVBufferRef **device_ctx, enum AVHWDeviceType type, + const char *device, AVDictionary *opts, int flags); + +/** + * Create a new device of the specified type from an existing device. + * + * If the source device is a device of the target type or was originally + * derived from such a device (possibly through one or more intermediate + * devices of other types), then this will return a reference to the + * existing device of the same type as is requested. + * + * Otherwise, it will attempt to derive a new device from the given source + * device. If direct derivation to the new type is not implemented, it will + * attempt the same derivation from each ancestor of the source device in + * turn looking for an implemented derivation method. + * + * @param dst_ctx On success, a reference to the newly-created + * AVHWDeviceContext. + * @param type The type of the new device to create. + * @param src_ctx A reference to an existing AVHWDeviceContext which will be + * used to create the new device. + * @param flags Currently unused; should be set to zero. + * @return Zero on success, a negative AVERROR code on failure. + */ +int av_hwdevice_ctx_create_derived(AVBufferRef **dst_ctx, + enum AVHWDeviceType type, + AVBufferRef *src_ctx, int flags); + +/** + * Create a new device of the specified type from an existing device. + * + * This function performs the same action as av_hwdevice_ctx_create_derived, + * however, it is able to set options for the new device to be derived. + * + * @param dst_ctx On success, a reference to the newly-created + * AVHWDeviceContext. + * @param type The type of the new device to create. + * @param src_ctx A reference to an existing AVHWDeviceContext which will be + * used to create the new device. + * @param options Options for the new device to create, same format as in + * av_hwdevice_ctx_create. + * @param flags Currently unused; should be set to zero. + * @return Zero on success, a negative AVERROR code on failure. + */ +int av_hwdevice_ctx_create_derived_opts(AVBufferRef **dst_ctx, + enum AVHWDeviceType type, + AVBufferRef *src_ctx, + AVDictionary *options, int flags); + +/** + * Allocate an AVHWFramesContext tied to a given device context. + * + * @param device_ctx a reference to a AVHWDeviceContext. This function will make + * a new reference for internal use, the one passed to the + * function remains owned by the caller. + * @return a reference to the newly created AVHWFramesContext on success or NULL + * on failure. + */ +AVBufferRef *av_hwframe_ctx_alloc(AVBufferRef *device_ctx); + +/** + * Finalize the context before use. This function must be called after the + * context is filled with all the required information and before it is attached + * to any frames. + * + * @param ref a reference to the AVHWFramesContext + * @return 0 on success, a negative AVERROR code on failure + */ +int av_hwframe_ctx_init(AVBufferRef *ref); + +/** + * Allocate a new frame attached to the given AVHWFramesContext. + * + * @param hwframe_ctx a reference to an AVHWFramesContext + * @param frame an empty (freshly allocated or unreffed) frame to be filled with + * newly allocated buffers. + * @param flags currently unused, should be set to zero + * @return 0 on success, a negative AVERROR code on failure + */ +int av_hwframe_get_buffer(AVBufferRef *hwframe_ctx, AVFrame *frame, int flags); + +/** + * Copy data to or from a hw surface. At least one of dst/src must have an + * AVHWFramesContext attached. + * + * If src has an AVHWFramesContext attached, then the format of dst (if set) + * must use one of the formats returned by av_hwframe_transfer_get_formats(src, + * AV_HWFRAME_TRANSFER_DIRECTION_FROM). + * If dst has an AVHWFramesContext attached, then the format of src must use one + * of the formats returned by av_hwframe_transfer_get_formats(dst, + * AV_HWFRAME_TRANSFER_DIRECTION_TO) + * + * dst may be "clean" (i.e. with data/buf pointers unset), in which case the + * data buffers will be allocated by this function using av_frame_get_buffer(). + * If dst->format is set, then this format will be used, otherwise (when + * dst->format is AV_PIX_FMT_NONE) the first acceptable format will be chosen. + * + * The two frames must have matching allocated dimensions (i.e. equal to + * AVHWFramesContext.width/height), since not all device types support + * transferring a sub-rectangle of the whole surface. The display dimensions + * (i.e. AVFrame.width/height) may be smaller than the allocated dimensions, but + * also have to be equal for both frames. When the display dimensions are + * smaller than the allocated dimensions, the content of the padding in the + * destination frame is unspecified. + * + * @param dst the destination frame. dst is not touched on failure. + * @param src the source frame. + * @param flags currently unused, should be set to zero + * @return 0 on success, a negative AVERROR error code on failure. + */ +int av_hwframe_transfer_data(AVFrame *dst, const AVFrame *src, int flags); + +enum AVHWFrameTransferDirection { + /** + * Transfer the data from the queried hw frame. + */ + AV_HWFRAME_TRANSFER_DIRECTION_FROM, + + /** + * Transfer the data to the queried hw frame. + */ + AV_HWFRAME_TRANSFER_DIRECTION_TO, +}; + +/** + * Get a list of possible source or target formats usable in + * av_hwframe_transfer_data(). + * + * @param hwframe_ctx the frame context to obtain the information for + * @param dir the direction of the transfer + * @param formats the pointer to the output format list will be written here. + * The list is terminated with AV_PIX_FMT_NONE and must be freed + * by the caller when no longer needed using av_free(). + * If this function returns successfully, the format list will + * have at least one item (not counting the terminator). + * On failure, the contents of this pointer are unspecified. + * @param flags currently unused, should be set to zero + * @return 0 on success, a negative AVERROR code on failure. + */ +int av_hwframe_transfer_get_formats(AVBufferRef *hwframe_ctx, + enum AVHWFrameTransferDirection dir, + enum AVPixelFormat **formats, int flags); + + +/** + * This struct describes the constraints on hardware frames attached to + * a given device with a hardware-specific configuration. This is returned + * by av_hwdevice_get_hwframe_constraints() and must be freed by + * av_hwframe_constraints_free() after use. + */ +typedef struct AVHWFramesConstraints { + /** + * A list of possible values for format in the hw_frames_ctx, + * terminated by AV_PIX_FMT_NONE. This member will always be filled. + */ + enum AVPixelFormat *valid_hw_formats; + + /** + * A list of possible values for sw_format in the hw_frames_ctx, + * terminated by AV_PIX_FMT_NONE. Can be NULL if this information is + * not known. + */ + enum AVPixelFormat *valid_sw_formats; + + /** + * The minimum size of frames in this hw_frames_ctx. + * (Zero if not known.) + */ + int min_width; + int min_height; + + /** + * The maximum size of frames in this hw_frames_ctx. + * (INT_MAX if not known / no limit.) + */ + int max_width; + int max_height; +} AVHWFramesConstraints; + +/** + * Allocate a HW-specific configuration structure for a given HW device. + * After use, the user must free all members as required by the specific + * hardware structure being used, then free the structure itself with + * av_free(). + * + * @param device_ctx a reference to the associated AVHWDeviceContext. + * @return The newly created HW-specific configuration structure on + * success or NULL on failure. + */ +void *av_hwdevice_hwconfig_alloc(AVBufferRef *device_ctx); + +/** + * Get the constraints on HW frames given a device and the HW-specific + * configuration to be used with that device. If no HW-specific + * configuration is provided, returns the maximum possible capabilities + * of the device. + * + * @param ref a reference to the associated AVHWDeviceContext. + * @param hwconfig a filled HW-specific configuration structure, or NULL + * to return the maximum possible capabilities of the device. + * @return AVHWFramesConstraints structure describing the constraints + * on the device, or NULL if not available. + */ +AVHWFramesConstraints *av_hwdevice_get_hwframe_constraints(AVBufferRef *ref, + const void *hwconfig); + +/** + * Free an AVHWFrameConstraints structure. + * + * @param constraints The (filled or unfilled) AVHWFrameConstraints structure. + */ +void av_hwframe_constraints_free(AVHWFramesConstraints **constraints); + + +/** + * Flags to apply to frame mappings. + */ +enum { + /** + * The mapping must be readable. + */ + AV_HWFRAME_MAP_READ = 1 << 0, + /** + * The mapping must be writeable. + */ + AV_HWFRAME_MAP_WRITE = 1 << 1, + /** + * The mapped frame will be overwritten completely in subsequent + * operations, so the current frame data need not be loaded. Any values + * which are not overwritten are unspecified. + */ + AV_HWFRAME_MAP_OVERWRITE = 1 << 2, + /** + * The mapping must be direct. That is, there must not be any copying in + * the map or unmap steps. Note that performance of direct mappings may + * be much lower than normal memory. + */ + AV_HWFRAME_MAP_DIRECT = 1 << 3, +}; + +/** + * Map a hardware frame. + * + * This has a number of different possible effects, depending on the format + * and origin of the src and dst frames. On input, src should be a usable + * frame with valid buffers and dst should be blank (typically as just created + * by av_frame_alloc()). src should have an associated hwframe context, and + * dst may optionally have a format and associated hwframe context. + * + * If src was created by mapping a frame from the hwframe context of dst, + * then this function undoes the mapping - dst is replaced by a reference to + * the frame that src was originally mapped from. + * + * If both src and dst have an associated hwframe context, then this function + * attempts to map the src frame from its hardware context to that of dst and + * then fill dst with appropriate data to be usable there. This will only be + * possible if the hwframe contexts and associated devices are compatible - + * given compatible devices, av_hwframe_ctx_create_derived() can be used to + * create a hwframe context for dst in which mapping should be possible. + * + * If src has a hwframe context but dst does not, then the src frame is + * mapped to normal memory and should thereafter be usable as a normal frame. + * If the format is set on dst, then the mapping will attempt to create dst + * with that format and fail if it is not possible. If format is unset (is + * AV_PIX_FMT_NONE) then dst will be mapped with whatever the most appropriate + * format to use is (probably the sw_format of the src hwframe context). + * + * A return value of AVERROR(ENOSYS) indicates that the mapping is not + * possible with the given arguments and hwframe setup, while other return + * values indicate that it failed somehow. + * + * On failure, the destination frame will be left blank, except for the + * hw_frames_ctx/format fields thay may have been set by the caller - those will + * be preserved as they were. + * + * @param dst Destination frame, to contain the mapping. + * @param src Source frame, to be mapped. + * @param flags Some combination of AV_HWFRAME_MAP_* flags. + * @return Zero on success, negative AVERROR code on failure. + */ +int av_hwframe_map(AVFrame *dst, const AVFrame *src, int flags); + + +/** + * Create and initialise an AVHWFramesContext as a mapping of another existing + * AVHWFramesContext on a different device. + * + * av_hwframe_ctx_init() should not be called after this. + * + * @param derived_frame_ctx On success, a reference to the newly created + * AVHWFramesContext. + * @param format The AVPixelFormat for the derived context. + * @param derived_device_ctx A reference to the device to create the new + * AVHWFramesContext on. + * @param source_frame_ctx A reference to an existing AVHWFramesContext + * which will be mapped to the derived context. + * @param flags Some combination of AV_HWFRAME_MAP_* flags, defining the + * mapping parameters to apply to frames which are allocated + * in the derived device. + * @return Zero on success, negative AVERROR code on failure. + */ +int av_hwframe_ctx_create_derived(AVBufferRef **derived_frame_ctx, + enum AVPixelFormat format, + AVBufferRef *derived_device_ctx, + AVBufferRef *source_frame_ctx, + int flags); + +#endif /* AVUTIL_HWCONTEXT_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_cuda.h b/libs/FFmpeg/include/libavutil/hwcontext_cuda.h new file mode 100644 index 0000000..cbad434 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_cuda.h @@ -0,0 +1,74 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + + +#ifndef AVUTIL_HWCONTEXT_CUDA_H +#define AVUTIL_HWCONTEXT_CUDA_H + +#ifndef CUDA_VERSION +#include +#endif + +#include "pixfmt.h" + +/** + * @file + * An API-specific header for AV_HWDEVICE_TYPE_CUDA. + * + * This API supports dynamic frame pools. AVHWFramesContext.pool must return + * AVBufferRefs whose data pointer is a CUdeviceptr. + */ + +typedef struct AVCUDADeviceContextInternal AVCUDADeviceContextInternal; + +/** + * This struct is allocated as AVHWDeviceContext.hwctx + */ +typedef struct AVCUDADeviceContext { + CUcontext cuda_ctx; + CUstream stream; + AVCUDADeviceContextInternal *internal; +} AVCUDADeviceContext; + +/** + * AVHWFramesContext.hwctx is currently not used + */ + +/** + * @defgroup hwcontext_cuda Device context creation flags + * + * Flags for av_hwdevice_ctx_create. + * + * @{ + */ + +/** + * Use primary device context instead of creating a new one. + */ +#define AV_CUDA_USE_PRIMARY_CONTEXT (1 << 0) + +/** + * Use current device context instead of creating a new one. + */ +#define AV_CUDA_USE_CURRENT_CONTEXT (1 << 1) + +/** + * @} + */ + +#endif /* AVUTIL_HWCONTEXT_CUDA_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_d3d11va.h b/libs/FFmpeg/include/libavutil/hwcontext_d3d11va.h new file mode 100644 index 0000000..77d2d72 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_d3d11va.h @@ -0,0 +1,178 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_D3D11VA_H +#define AVUTIL_HWCONTEXT_D3D11VA_H + +/** + * @file + * An API-specific header for AV_HWDEVICE_TYPE_D3D11VA. + * + * The default pool implementation will be fixed-size if initial_pool_size is + * set (and allocate elements from an array texture). Otherwise it will allocate + * individual textures. Be aware that decoding requires a single array texture. + * + * Using sw_format==AV_PIX_FMT_YUV420P has special semantics, and maps to + * DXGI_FORMAT_420_OPAQUE. av_hwframe_transfer_data() is not supported for + * this format. Refer to MSDN for details. + * + * av_hwdevice_ctx_create() for this device type supports a key named "debug" + * for the AVDictionary entry. If this is set to any value, the device creation + * code will try to load various supported D3D debugging layers. + */ + +#include +#include + +/** + * This struct is allocated as AVHWDeviceContext.hwctx + */ +typedef struct AVD3D11VADeviceContext { + /** + * Device used for texture creation and access. This can also be used to + * set the libavcodec decoding device. + * + * Must be set by the user. This is the only mandatory field - the other + * device context fields are set from this and are available for convenience. + * + * Deallocating the AVHWDeviceContext will always release this interface, + * and it does not matter whether it was user-allocated. + */ + ID3D11Device *device; + + /** + * If unset, this will be set from the device field on init. + * + * Deallocating the AVHWDeviceContext will always release this interface, + * and it does not matter whether it was user-allocated. + */ + ID3D11DeviceContext *device_context; + + /** + * If unset, this will be set from the device field on init. + * + * Deallocating the AVHWDeviceContext will always release this interface, + * and it does not matter whether it was user-allocated. + */ + ID3D11VideoDevice *video_device; + + /** + * If unset, this will be set from the device_context field on init. + * + * Deallocating the AVHWDeviceContext will always release this interface, + * and it does not matter whether it was user-allocated. + */ + ID3D11VideoContext *video_context; + + /** + * Callbacks for locking. They protect accesses to device_context and + * video_context calls. They also protect access to the internal staging + * texture (for av_hwframe_transfer_data() calls). They do NOT protect + * access to hwcontext or decoder state in general. + * + * If unset on init, the hwcontext implementation will set them to use an + * internal mutex. + * + * The underlying lock must be recursive. lock_ctx is for free use by the + * locking implementation. + */ + void (*lock)(void *lock_ctx); + void (*unlock)(void *lock_ctx); + void *lock_ctx; +} AVD3D11VADeviceContext; + +/** + * D3D11 frame descriptor for pool allocation. + * + * In user-allocated pools, AVHWFramesContext.pool must return AVBufferRefs + * with the data pointer pointing at an object of this type describing the + * planes of the frame. + * + * This has no use outside of custom allocation, and AVFrame AVBufferRef do not + * necessarily point to an instance of this struct. + */ +typedef struct AVD3D11FrameDescriptor { + /** + * The texture in which the frame is located. The reference count is + * managed by the AVBufferRef, and destroying the reference will release + * the interface. + * + * Normally stored in AVFrame.data[0]. + */ + ID3D11Texture2D *texture; + + /** + * The index into the array texture element representing the frame, or 0 + * if the texture is not an array texture. + * + * Normally stored in AVFrame.data[1] (cast from intptr_t). + */ + intptr_t index; +} AVD3D11FrameDescriptor; + +/** + * This struct is allocated as AVHWFramesContext.hwctx + */ +typedef struct AVD3D11VAFramesContext { + /** + * The canonical texture used for pool allocation. If this is set to NULL + * on init, the hwframes implementation will allocate and set an array + * texture if initial_pool_size > 0. + * + * The only situation when the API user should set this is: + * - the user wants to do manual pool allocation (setting + * AVHWFramesContext.pool), instead of letting AVHWFramesContext + * allocate the pool + * - of an array texture + * - and wants it to use it for decoding + * - this has to be done before calling av_hwframe_ctx_init() + * + * Deallocating the AVHWFramesContext will always release this interface, + * and it does not matter whether it was user-allocated. + * + * This is in particular used by the libavcodec D3D11VA hwaccel, which + * requires a single array texture. It will create ID3D11VideoDecoderOutputView + * objects for each array texture element on decoder initialization. + */ + ID3D11Texture2D *texture; + + /** + * D3D11_TEXTURE2D_DESC.BindFlags used for texture creation. The user must + * at least set D3D11_BIND_DECODER if the frames context is to be used for + * video decoding. + * This field is ignored/invalid if a user-allocated texture is provided. + */ + UINT BindFlags; + + /** + * D3D11_TEXTURE2D_DESC.MiscFlags used for texture creation. + * This field is ignored/invalid if a user-allocated texture is provided. + */ + UINT MiscFlags; + + /** + * In case if texture structure member above is not NULL contains the same texture + * pointer for all elements and different indexes into the array texture. + * In case if texture structure member above is NULL, all elements contains + * pointers to separate non-array textures and 0 indexes. + * This field is ignored/invalid if a user-allocated texture is provided. + */ + AVD3D11FrameDescriptor *texture_infos; +} AVD3D11VAFramesContext; + +#endif /* AVUTIL_HWCONTEXT_D3D11VA_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_drm.h b/libs/FFmpeg/include/libavutil/hwcontext_drm.h new file mode 100644 index 0000000..42709f2 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_drm.h @@ -0,0 +1,169 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_DRM_H +#define AVUTIL_HWCONTEXT_DRM_H + +#include +#include + +/** + * @file + * API-specific header for AV_HWDEVICE_TYPE_DRM. + * + * Internal frame allocation is not currently supported - all frames + * must be allocated by the user. Thus AVHWFramesContext is always + * NULL, though this may change if support for frame allocation is + * added in future. + */ + +enum { + /** + * The maximum number of layers/planes in a DRM frame. + */ + AV_DRM_MAX_PLANES = 4 +}; + +/** + * DRM object descriptor. + * + * Describes a single DRM object, addressing it as a PRIME file + * descriptor. + */ +typedef struct AVDRMObjectDescriptor { + /** + * DRM PRIME fd for the object. + */ + int fd; + /** + * Total size of the object. + * + * (This includes any parts not which do not contain image data.) + */ + size_t size; + /** + * Format modifier applied to the object (DRM_FORMAT_MOD_*). + * + * If the format modifier is unknown then this should be set to + * DRM_FORMAT_MOD_INVALID. + */ + uint64_t format_modifier; +} AVDRMObjectDescriptor; + +/** + * DRM plane descriptor. + * + * Describes a single plane of a layer, which is contained within + * a single object. + */ +typedef struct AVDRMPlaneDescriptor { + /** + * Index of the object containing this plane in the objects + * array of the enclosing frame descriptor. + */ + int object_index; + /** + * Offset within that object of this plane. + */ + ptrdiff_t offset; + /** + * Pitch (linesize) of this plane. + */ + ptrdiff_t pitch; +} AVDRMPlaneDescriptor; + +/** + * DRM layer descriptor. + * + * Describes a single layer within a frame. This has the structure + * defined by its format, and will contain one or more planes. + */ +typedef struct AVDRMLayerDescriptor { + /** + * Format of the layer (DRM_FORMAT_*). + */ + uint32_t format; + /** + * Number of planes in the layer. + * + * This must match the number of planes required by format. + */ + int nb_planes; + /** + * Array of planes in this layer. + */ + AVDRMPlaneDescriptor planes[AV_DRM_MAX_PLANES]; +} AVDRMLayerDescriptor; + +/** + * DRM frame descriptor. + * + * This is used as the data pointer for AV_PIX_FMT_DRM_PRIME frames. + * It is also used by user-allocated frame pools - allocating in + * AVHWFramesContext.pool must return AVBufferRefs which contain + * an object of this type. + * + * The fields of this structure should be set such it can be + * imported directly by EGL using the EGL_EXT_image_dma_buf_import + * and EGL_EXT_image_dma_buf_import_modifiers extensions. + * (Note that the exact layout of a particular format may vary between + * platforms - we only specify that the same platform should be able + * to import it.) + * + * The total number of planes must not exceed AV_DRM_MAX_PLANES, and + * the order of the planes by increasing layer index followed by + * increasing plane index must be the same as the order which would + * be used for the data pointers in the equivalent software format. + */ +typedef struct AVDRMFrameDescriptor { + /** + * Number of DRM objects making up this frame. + */ + int nb_objects; + /** + * Array of objects making up the frame. + */ + AVDRMObjectDescriptor objects[AV_DRM_MAX_PLANES]; + /** + * Number of layers in the frame. + */ + int nb_layers; + /** + * Array of layers in the frame. + */ + AVDRMLayerDescriptor layers[AV_DRM_MAX_PLANES]; +} AVDRMFrameDescriptor; + +/** + * DRM device. + * + * Allocated as AVHWDeviceContext.hwctx. + */ +typedef struct AVDRMDeviceContext { + /** + * File descriptor of DRM device. + * + * This is used as the device to create frames on, and may also be + * used in some derivation and mapping operations. + * + * If no device is required, set to -1. + */ + int fd; +} AVDRMDeviceContext; + +#endif /* AVUTIL_HWCONTEXT_DRM_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_dxva2.h b/libs/FFmpeg/include/libavutil/hwcontext_dxva2.h new file mode 100644 index 0000000..e1b79bc --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_dxva2.h @@ -0,0 +1,75 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + + +#ifndef AVUTIL_HWCONTEXT_DXVA2_H +#define AVUTIL_HWCONTEXT_DXVA2_H + +/** + * @file + * An API-specific header for AV_HWDEVICE_TYPE_DXVA2. + * + * Only fixed-size pools are supported. + * + * For user-allocated pools, AVHWFramesContext.pool must return AVBufferRefs + * with the data pointer set to a pointer to IDirect3DSurface9. + */ + +#include +#include + +/** + * This struct is allocated as AVHWDeviceContext.hwctx + */ +typedef struct AVDXVA2DeviceContext { + IDirect3DDeviceManager9 *devmgr; +} AVDXVA2DeviceContext; + +/** + * This struct is allocated as AVHWFramesContext.hwctx + */ +typedef struct AVDXVA2FramesContext { + /** + * The surface type (e.g. DXVA2_VideoProcessorRenderTarget or + * DXVA2_VideoDecoderRenderTarget). Must be set by the caller. + */ + DWORD surface_type; + + /** + * The surface pool. When an external pool is not provided by the caller, + * this will be managed (allocated and filled on init, freed on uninit) by + * libavutil. + */ + IDirect3DSurface9 **surfaces; + int nb_surfaces; + + /** + * Certain drivers require the decoder to be destroyed before the surfaces. + * To allow internally managed pools to work properly in such cases, this + * field is provided. + * + * If it is non-NULL, libavutil will call IDirectXVideoDecoder_Release() on + * it just before the internal surface pool is freed. + * + * This is for convenience only. Some code uses other methods to manage the + * decoder reference. + */ + IDirectXVideoDecoder *decoder_to_release; +} AVDXVA2FramesContext; + +#endif /* AVUTIL_HWCONTEXT_DXVA2_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_mediacodec.h b/libs/FFmpeg/include/libavutil/hwcontext_mediacodec.h new file mode 100644 index 0000000..fc0263c --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_mediacodec.h @@ -0,0 +1,61 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_MEDIACODEC_H +#define AVUTIL_HWCONTEXT_MEDIACODEC_H + +/** + * MediaCodec details. + * + * Allocated as AVHWDeviceContext.hwctx + */ +typedef struct AVMediaCodecDeviceContext { + /** + * android/view/Surface handle, to be filled by the user. + * + * This is the default surface used by decoders on this device. + */ + void *surface; + + /** + * Pointer to ANativeWindow. + * + * It both surface and native_window is NULL, try to create it + * automatically if create_window is true and OS support + * createPersistentInputSurface. + * + * It can be used as output surface for decoder and input surface for + * encoder. + */ + void *native_window; + + /** + * Enable createPersistentInputSurface automatically. + * + * Disabled by default. + * + * It can be enabled by setting this flag directly, or by setting + * AVDictionary of av_hwdevice_ctx_create(), with "create_window" as key. + * The second method is useful for ffmpeg cmdline, e.g., we can enable it + * via: + * -init_hw_device mediacodec=mediacodec,create_window=1 + */ + int create_window; +} AVMediaCodecDeviceContext; + +#endif /* AVUTIL_HWCONTEXT_MEDIACODEC_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_opencl.h b/libs/FFmpeg/include/libavutil/hwcontext_opencl.h new file mode 100644 index 0000000..ef54486 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_opencl.h @@ -0,0 +1,100 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_OPENCL_H +#define AVUTIL_HWCONTEXT_OPENCL_H + +#ifdef __APPLE__ +#include +#else +#include +#endif + +#include "frame.h" + +/** + * @file + * API-specific header for AV_HWDEVICE_TYPE_OPENCL. + * + * Pools allocated internally are always dynamic, and are primarily intended + * to be used in OpenCL-only cases. If interoperation is required, it is + * typically required to allocate frames in the other API and then map the + * frames context to OpenCL with av_hwframe_ctx_create_derived(). + */ + +/** + * OpenCL frame descriptor for pool allocation. + * + * In user-allocated pools, AVHWFramesContext.pool must return AVBufferRefs + * with the data pointer pointing at an object of this type describing the + * planes of the frame. + */ +typedef struct AVOpenCLFrameDescriptor { + /** + * Number of planes in the frame. + */ + int nb_planes; + /** + * OpenCL image2d objects for each plane of the frame. + */ + cl_mem planes[AV_NUM_DATA_POINTERS]; +} AVOpenCLFrameDescriptor; + +/** + * OpenCL device details. + * + * Allocated as AVHWDeviceContext.hwctx + */ +typedef struct AVOpenCLDeviceContext { + /** + * The primary device ID of the device. If multiple OpenCL devices + * are associated with the context then this is the one which will + * be used for all operations internal to FFmpeg. + */ + cl_device_id device_id; + /** + * The OpenCL context which will contain all operations and frames on + * this device. + */ + cl_context context; + /** + * The default command queue for this device, which will be used by all + * frames contexts which do not have their own command queue. If not + * intialised by the user, a default queue will be created on the + * primary device. + */ + cl_command_queue command_queue; +} AVOpenCLDeviceContext; + +/** + * OpenCL-specific data associated with a frame pool. + * + * Allocated as AVHWFramesContext.hwctx. + */ +typedef struct AVOpenCLFramesContext { + /** + * The command queue used for internal asynchronous operations on this + * device (av_hwframe_transfer_data(), av_hwframe_map()). + * + * If this is not set, the command queue from the associated device is + * used instead. + */ + cl_command_queue command_queue; +} AVOpenCLFramesContext; + +#endif /* AVUTIL_HWCONTEXT_OPENCL_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_qsv.h b/libs/FFmpeg/include/libavutil/hwcontext_qsv.h new file mode 100644 index 0000000..e2dba8a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_qsv.h @@ -0,0 +1,64 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_QSV_H +#define AVUTIL_HWCONTEXT_QSV_H + +#include + +/** + * @file + * An API-specific header for AV_HWDEVICE_TYPE_QSV. + * + * This API does not support dynamic frame pools. AVHWFramesContext.pool must + * contain AVBufferRefs whose data pointer points to an mfxFrameSurface1 struct. + */ + +/** + * This struct is allocated as AVHWDeviceContext.hwctx + */ +typedef struct AVQSVDeviceContext { + mfxSession session; + /** + * The mfxLoader handle used for mfxSession creation + * + * This field is only available for oneVPL user. For non-oneVPL user, this + * field must be set to NULL. + * + * Filled by the user before calling av_hwdevice_ctx_init() and should be + * cast to mfxLoader handle. Deallocating the AVHWDeviceContext will always + * release this interface. + */ + void *loader; +} AVQSVDeviceContext; + +/** + * This struct is allocated as AVHWFramesContext.hwctx + */ +typedef struct AVQSVFramesContext { + mfxFrameSurface1 *surfaces; + int nb_surfaces; + + /** + * A combination of MFX_MEMTYPE_* describing the frame pool. + */ + int frame_type; +} AVQSVFramesContext; + +#endif /* AVUTIL_HWCONTEXT_QSV_H */ + diff --git a/libs/FFmpeg/include/libavutil/hwcontext_vaapi.h b/libs/FFmpeg/include/libavutil/hwcontext_vaapi.h new file mode 100644 index 0000000..0b2e071 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_vaapi.h @@ -0,0 +1,117 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_VAAPI_H +#define AVUTIL_HWCONTEXT_VAAPI_H + +#include + +/** + * @file + * API-specific header for AV_HWDEVICE_TYPE_VAAPI. + * + * Dynamic frame pools are supported, but note that any pool used as a render + * target is required to be of fixed size in order to be be usable as an + * argument to vaCreateContext(). + * + * For user-allocated pools, AVHWFramesContext.pool must return AVBufferRefs + * with the data pointer set to a VASurfaceID. + */ + +enum { + /** + * The quirks field has been set by the user and should not be detected + * automatically by av_hwdevice_ctx_init(). + */ + AV_VAAPI_DRIVER_QUIRK_USER_SET = (1 << 0), + /** + * The driver does not destroy parameter buffers when they are used by + * vaRenderPicture(). Additional code will be required to destroy them + * separately afterwards. + */ + AV_VAAPI_DRIVER_QUIRK_RENDER_PARAM_BUFFERS = (1 << 1), + + /** + * The driver does not support the VASurfaceAttribMemoryType attribute, + * so the surface allocation code will not try to use it. + */ + AV_VAAPI_DRIVER_QUIRK_ATTRIB_MEMTYPE = (1 << 2), + + /** + * The driver does not support surface attributes at all. + * The surface allocation code will never pass them to surface allocation, + * and the results of the vaQuerySurfaceAttributes() call will be faked. + */ + AV_VAAPI_DRIVER_QUIRK_SURFACE_ATTRIBUTES = (1 << 3), +}; + +/** + * VAAPI connection details. + * + * Allocated as AVHWDeviceContext.hwctx + */ +typedef struct AVVAAPIDeviceContext { + /** + * The VADisplay handle, to be filled by the user. + */ + VADisplay display; + /** + * Driver quirks to apply - this is filled by av_hwdevice_ctx_init(), + * with reference to a table of known drivers, unless the + * AV_VAAPI_DRIVER_QUIRK_USER_SET bit is already present. The user + * may need to refer to this field when performing any later + * operations using VAAPI with the same VADisplay. + */ + unsigned int driver_quirks; +} AVVAAPIDeviceContext; + +/** + * VAAPI-specific data associated with a frame pool. + * + * Allocated as AVHWFramesContext.hwctx. + */ +typedef struct AVVAAPIFramesContext { + /** + * Set by the user to apply surface attributes to all surfaces in + * the frame pool. If null, default settings are used. + */ + VASurfaceAttrib *attributes; + int nb_attributes; + /** + * The surfaces IDs of all surfaces in the pool after creation. + * Only valid if AVHWFramesContext.initial_pool_size was positive. + * These are intended to be used as the render_targets arguments to + * vaCreateContext(). + */ + VASurfaceID *surface_ids; + int nb_surfaces; +} AVVAAPIFramesContext; + +/** + * VAAPI hardware pipeline configuration details. + * + * Allocated with av_hwdevice_hwconfig_alloc(). + */ +typedef struct AVVAAPIHWConfig { + /** + * ID of a VAAPI pipeline configuration. + */ + VAConfigID config_id; +} AVVAAPIHWConfig; + +#endif /* AVUTIL_HWCONTEXT_VAAPI_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_vdpau.h b/libs/FFmpeg/include/libavutil/hwcontext_vdpau.h new file mode 100644 index 0000000..1b7ea1e --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_vdpau.h @@ -0,0 +1,44 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_VDPAU_H +#define AVUTIL_HWCONTEXT_VDPAU_H + +#include + +/** + * @file + * An API-specific header for AV_HWDEVICE_TYPE_VDPAU. + * + * This API supports dynamic frame pools. AVHWFramesContext.pool must return + * AVBufferRefs whose data pointer is a VdpVideoSurface. + */ + +/** + * This struct is allocated as AVHWDeviceContext.hwctx + */ +typedef struct AVVDPAUDeviceContext { + VdpDevice device; + VdpGetProcAddress *get_proc_address; +} AVVDPAUDeviceContext; + +/** + * AVHWFramesContext.hwctx is currently not used + */ + +#endif /* AVUTIL_HWCONTEXT_VDPAU_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_videotoolbox.h b/libs/FFmpeg/include/libavutil/hwcontext_videotoolbox.h new file mode 100644 index 0000000..25dde85 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_videotoolbox.h @@ -0,0 +1,96 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_VIDEOTOOLBOX_H +#define AVUTIL_HWCONTEXT_VIDEOTOOLBOX_H + +#include + +#include + +#include "frame.h" +#include "pixfmt.h" + +/** + * @file + * An API-specific header for AV_HWDEVICE_TYPE_VIDEOTOOLBOX. + * + * This API supports frame allocation using a native CVPixelBufferPool + * instead of an AVBufferPool. + * + * If the API user sets a custom pool, AVHWFramesContext.pool must return + * AVBufferRefs whose data pointer is a CVImageBufferRef or CVPixelBufferRef. + * Note that the underlying CVPixelBuffer could be retained by OS frameworks + * depending on application usage, so it is preferable to let CoreVideo manage + * the pool using the default implementation. + * + * Currently AVHWDeviceContext.hwctx and AVHWFramesContext.hwctx are always + * NULL. + */ + +/** + * Convert a VideoToolbox (actually CoreVideo) format to AVPixelFormat. + * Returns AV_PIX_FMT_NONE if no known equivalent was found. + */ +enum AVPixelFormat av_map_videotoolbox_format_to_pixfmt(uint32_t cv_fmt); + +/** + * Convert an AVPixelFormat to a VideoToolbox (actually CoreVideo) format. + * Returns 0 if no known equivalent was found. + */ +uint32_t av_map_videotoolbox_format_from_pixfmt(enum AVPixelFormat pix_fmt); + +/** + * Same as av_map_videotoolbox_format_from_pixfmt function, but can map and + * return full range pixel formats via a flag. + */ +uint32_t av_map_videotoolbox_format_from_pixfmt2(enum AVPixelFormat pix_fmt, bool full_range); + +/** + * Convert an AVChromaLocation to a VideoToolbox/CoreVideo chroma location string. + * Returns 0 if no known equivalent was found. + */ +CFStringRef av_map_videotoolbox_chroma_loc_from_av(enum AVChromaLocation loc); + +/** + * Convert an AVColorSpace to a VideoToolbox/CoreVideo color matrix string. + * Returns 0 if no known equivalent was found. + */ +CFStringRef av_map_videotoolbox_color_matrix_from_av(enum AVColorSpace space); + +/** + * Convert an AVColorPrimaries to a VideoToolbox/CoreVideo color primaries string. + * Returns 0 if no known equivalent was found. + */ +CFStringRef av_map_videotoolbox_color_primaries_from_av(enum AVColorPrimaries pri); + +/** + * Convert an AVColorTransferCharacteristic to a VideoToolbox/CoreVideo color transfer + * function string. + * Returns 0 if no known equivalent was found. + */ +CFStringRef av_map_videotoolbox_color_trc_from_av(enum AVColorTransferCharacteristic trc); + +/** + * Update a CVPixelBufferRef's metadata to based on an AVFrame. + * Returns 0 if no known equivalent was found. + */ +int av_vt_pixbuf_set_attachments(void *log_ctx, + CVPixelBufferRef pixbuf, const struct AVFrame *src); + +#endif /* AVUTIL_HWCONTEXT_VIDEOTOOLBOX_H */ diff --git a/libs/FFmpeg/include/libavutil/hwcontext_vulkan.h b/libs/FFmpeg/include/libavutil/hwcontext_vulkan.h new file mode 100644 index 0000000..895794c --- /dev/null +++ b/libs/FFmpeg/include/libavutil/hwcontext_vulkan.h @@ -0,0 +1,345 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_HWCONTEXT_VULKAN_H +#define AVUTIL_HWCONTEXT_VULKAN_H + +#if defined(_WIN32) && !defined(VK_USE_PLATFORM_WIN32_KHR) +#define VK_USE_PLATFORM_WIN32_KHR +#endif +#include + +#include "pixfmt.h" +#include "frame.h" + +typedef struct AVVkFrame AVVkFrame; + +/** + * @file + * API-specific header for AV_HWDEVICE_TYPE_VULKAN. + * + * For user-allocated pools, AVHWFramesContext.pool must return AVBufferRefs + * with the data pointer set to an AVVkFrame. + */ + +/** + * Main Vulkan context, allocated as AVHWDeviceContext.hwctx. + * All of these can be set before init to change what the context uses + */ +typedef struct AVVulkanDeviceContext { + /** + * Custom memory allocator, else NULL + */ + const VkAllocationCallbacks *alloc; + + /** + * Pointer to the instance-provided vkGetInstanceProcAddr loading function. + * If NULL, will pick either libvulkan or libvolk, depending on libavutil's + * compilation settings, and set this field. + */ + PFN_vkGetInstanceProcAddr get_proc_addr; + + /** + * Vulkan instance. Must be at least version 1.3. + */ + VkInstance inst; + + /** + * Physical device + */ + VkPhysicalDevice phys_dev; + + /** + * Active device + */ + VkDevice act_dev; + + /** + * This structure should be set to the set of features that present and enabled + * during device creation. When a device is created by FFmpeg, it will default to + * enabling all that are present of the shaderImageGatherExtended, + * fragmentStoresAndAtomics, shaderInt64 and vertexPipelineStoresAndAtomics features. + */ + VkPhysicalDeviceFeatures2 device_features; + + /** + * Enabled instance extensions. + * If supplying your own device context, set this to an array of strings, with + * each entry containing the specified Vulkan extension string to enable. + * Duplicates are possible and accepted. + * If no extensions are enabled, set these fields to NULL, and 0 respectively. + */ + const char * const *enabled_inst_extensions; + int nb_enabled_inst_extensions; + + /** + * Enabled device extensions. By default, VK_KHR_external_memory_fd, + * VK_EXT_external_memory_dma_buf, VK_EXT_image_drm_format_modifier, + * VK_KHR_external_semaphore_fd and VK_EXT_external_memory_host are enabled if found. + * If supplying your own device context, these fields takes the same format as + * the above fields, with the same conditions that duplicates are possible + * and accepted, and that NULL and 0 respectively means no extensions are enabled. + */ + const char * const *enabled_dev_extensions; + int nb_enabled_dev_extensions; + + /** + * Queue family index for graphics operations, and the number of queues + * enabled for it. If unavaiable, will be set to -1. Not required. + * av_hwdevice_create() will attempt to find a dedicated queue for each + * queue family, or pick the one with the least unrelated flags set. + * Queue indices here may overlap if a queue has to share capabilities. + */ + int queue_family_index; + int nb_graphics_queues; + + /** + * Queue family index for transfer operations and the number of queues + * enabled. Required. + */ + int queue_family_tx_index; + int nb_tx_queues; + + /** + * Queue family index for compute operations and the number of queues + * enabled. Required. + */ + int queue_family_comp_index; + int nb_comp_queues; + + /** + * Queue family index for video encode ops, and the amount of queues enabled. + * If the device doesn't support such, queue_family_encode_index will be -1. + * Not required. + */ + int queue_family_encode_index; + int nb_encode_queues; + + /** + * Queue family index for video decode ops, and the amount of queues enabled. + * If the device doesn't support such, queue_family_decode_index will be -1. + * Not required. + */ + int queue_family_decode_index; + int nb_decode_queues; + + /** + * Locks a queue, preventing other threads from submitting any command + * buffers to this queue. + * If set to NULL, will be set to lavu-internal functions that utilize a + * mutex. + */ + void (*lock_queue)(struct AVHWDeviceContext *ctx, uint32_t queue_family, uint32_t index); + + /** + * Similar to lock_queue(), unlocks a queue. Must only be called after locking. + */ + void (*unlock_queue)(struct AVHWDeviceContext *ctx, uint32_t queue_family, uint32_t index); +} AVVulkanDeviceContext; + +/** + * Defines the behaviour of frame allocation. + */ +typedef enum AVVkFrameFlags { + /* Unless this flag is set, autodetected flags will be OR'd based on the + * device and tiling during av_hwframe_ctx_init(). */ + AV_VK_FRAME_FLAG_NONE = (1ULL << 0), + +#if FF_API_VULKAN_CONTIGUOUS_MEMORY + /* DEPRECATED: does nothing. Replaced by multiplane images. */ + AV_VK_FRAME_FLAG_CONTIGUOUS_MEMORY = (1ULL << 1), +#endif + + /* Disables multiplane images. + * This is required to export/import images from CUDA. */ + AV_VK_FRAME_FLAG_DISABLE_MULTIPLANE = (1ULL << 2), +} AVVkFrameFlags; + +/** + * Allocated as AVHWFramesContext.hwctx, used to set pool-specific options + */ +typedef struct AVVulkanFramesContext { + /** + * Controls the tiling of allocated frames. + * If left as VK_IMAGE_TILING_OPTIMAL (0), will use optimal tiling. + * Can be set to VK_IMAGE_TILING_LINEAR to force linear images, + * or VK_IMAGE_TILING_DRM_FORMAT_MODIFIER_EXT to force DMABUF-backed + * images. + * @note Imported frames from other APIs ignore this. + */ + VkImageTiling tiling; + + /** + * Defines extra usage of output frames. If non-zero, all flags MUST be + * supported by the VkFormat. Otherwise, will use supported flags amongst: + * - VK_IMAGE_USAGE_SAMPLED_BIT + * - VK_IMAGE_USAGE_STORAGE_BIT + * - VK_IMAGE_USAGE_TRANSFER_SRC_BIT + * - VK_IMAGE_USAGE_TRANSFER_DST_BIT + */ + VkImageUsageFlagBits usage; + + /** + * Extension data for image creation. + * If DRM tiling is used, a VkImageDrmFormatModifierListCreateInfoEXT structure + * can be added to specify the exact modifier to use. + * + * Additional structures may be added at av_hwframe_ctx_init() time, + * which will be freed automatically on uninit(), so users must only free + * any structures they've allocated themselves. + */ + void *create_pnext; + + /** + * Extension data for memory allocation. Must have as many entries as + * the number of planes of the sw_format. + * This will be chained to VkExportMemoryAllocateInfo, which is used + * to make all pool images exportable to other APIs if the necessary + * extensions are present in enabled_dev_extensions. + */ + void *alloc_pnext[AV_NUM_DATA_POINTERS]; + + /** + * A combination of AVVkFrameFlags. Unless AV_VK_FRAME_FLAG_NONE is set, + * autodetected flags will be OR'd based on the device and tiling during + * av_hwframe_ctx_init(). + */ + AVVkFrameFlags flags; + + /** + * Flags to set during image creation. If unset, defaults to + * VK_IMAGE_CREATE_ALIAS_BIT. + */ + VkImageCreateFlags img_flags; + + /** + * Vulkan format for each image. MUST be compatible with the pixel format. + * If unset, will be automatically set. + * There are at most two compatible formats for a frame - a multiplane + * format, and a single-plane multi-image format. + */ + VkFormat format[AV_NUM_DATA_POINTERS]; + + /** + * Number of layers each image will have. + */ + int nb_layers; + + /** + * Locks a frame, preventing other threads from changing frame properties. + * Users SHOULD only ever lock just before command submission in order + * to get accurate frame properties, and unlock immediately after command + * submission without waiting for it to finish. + * + * If unset, will be set to lavu-internal functions that utilize a mutex. + */ + void (*lock_frame)(struct AVHWFramesContext *fc, AVVkFrame *vkf); + + /** + * Similar to lock_frame(), unlocks a frame. Must only be called after locking. + */ + void (*unlock_frame)(struct AVHWFramesContext *fc, AVVkFrame *vkf); +} AVVulkanFramesContext; + +/* + * Frame structure. + * + * @note the size of this structure is not part of the ABI, to allocate + * you must use @av_vk_frame_alloc(). + */ +struct AVVkFrame { + /** + * Vulkan images to which the memory is bound to. + * May be one for multiplane formats, or multiple. + */ + VkImage img[AV_NUM_DATA_POINTERS]; + + /** + * Tiling for the frame. + */ + VkImageTiling tiling; + + /** + * Memory backing the images. Either one, or as many as there are planes + * in the sw_format. + * In case of having multiple VkImages, but one memory, the offset field + * will indicate the bound offset for each image. + */ + VkDeviceMemory mem[AV_NUM_DATA_POINTERS]; + size_t size[AV_NUM_DATA_POINTERS]; + + /** + * OR'd flags for all memory allocated + */ + VkMemoryPropertyFlagBits flags; + + /** + * Updated after every barrier. One per VkImage. + */ + VkAccessFlagBits access[AV_NUM_DATA_POINTERS]; + VkImageLayout layout[AV_NUM_DATA_POINTERS]; + + /** + * Synchronization timeline semaphores, one for each VkImage. + * Must not be freed manually. Must be waited on at every submission using + * the value in sem_value, and must be signalled at every submission, + * using an incremented value. + */ + VkSemaphore sem[AV_NUM_DATA_POINTERS]; + + /** + * Up to date semaphore value at which each image becomes accessible. + * One per VkImage. + * Clients must wait on this value when submitting a command queue, + * and increment it when signalling. + */ + uint64_t sem_value[AV_NUM_DATA_POINTERS]; + + /** + * Internal data. + */ + struct AVVkFrameInternal *internal; + + /** + * Describes the binding offset of each image to the VkDeviceMemory. + * One per VkImage. + */ + ptrdiff_t offset[AV_NUM_DATA_POINTERS]; + + /** + * Queue family of the images. Must be VK_QUEUE_FAMILY_IGNORED if + * the image was allocated with the CONCURRENT concurrency option. + * One per VkImage. + */ + uint32_t queue_family[AV_NUM_DATA_POINTERS]; +}; + +/** + * Allocates a single AVVkFrame and initializes everything as 0. + * @note Must be freed via av_free() + */ +AVVkFrame *av_vk_frame_alloc(void); + +/** + * Returns the optimal per-plane Vulkan format for a given sw_format, + * one for each plane. + * Returns NULL on unsupported formats. + */ +const VkFormat *av_vkfmt_from_pixfmt(enum AVPixelFormat p); + +#endif /* AVUTIL_HWCONTEXT_VULKAN_H */ diff --git a/libs/FFmpeg/include/libavutil/imgutils.h b/libs/FFmpeg/include/libavutil/imgutils.h new file mode 100644 index 0000000..fa3bb10 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/imgutils.h @@ -0,0 +1,347 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_IMGUTILS_H +#define AVUTIL_IMGUTILS_H + +/** + * @file + * misc image utilities + * + * @addtogroup lavu_picture + * @{ + */ + +#include +#include +#include "pixdesc.h" +#include "pixfmt.h" +#include "rational.h" + +/** + * Compute the max pixel step for each plane of an image with a + * format described by pixdesc. + * + * The pixel step is the distance in bytes between the first byte of + * the group of bytes which describe a pixel component and the first + * byte of the successive group in the same plane for the same + * component. + * + * @param max_pixsteps an array which is filled with the max pixel step + * for each plane. Since a plane may contain different pixel + * components, the computed max_pixsteps[plane] is relative to the + * component in the plane with the max pixel step. + * @param max_pixstep_comps an array which is filled with the component + * for each plane which has the max pixel step. May be NULL. + * @param pixdesc the AVPixFmtDescriptor for the image, describing its format + */ +void av_image_fill_max_pixsteps(int max_pixsteps[4], int max_pixstep_comps[4], + const AVPixFmtDescriptor *pixdesc); + +/** + * Compute the size of an image line with format pix_fmt and width + * width for the plane plane. + * + * @return the computed size in bytes + */ +int av_image_get_linesize(enum AVPixelFormat pix_fmt, int width, int plane); + +/** + * Fill plane linesizes for an image with pixel format pix_fmt and + * width width. + * + * @param linesizes array to be filled with the linesize for each plane + * @param pix_fmt the AVPixelFormat of the image + * @param width width of the image in pixels + * @return >= 0 in case of success, a negative error code otherwise + */ +int av_image_fill_linesizes(int linesizes[4], enum AVPixelFormat pix_fmt, int width); + +/** + * Fill plane sizes for an image with pixel format pix_fmt and height height. + * + * @param size the array to be filled with the size of each image plane + * @param pix_fmt the AVPixelFormat of the image + * @param height height of the image in pixels + * @param linesizes the array containing the linesize for each + * plane, should be filled by av_image_fill_linesizes() + * @return >= 0 in case of success, a negative error code otherwise + * + * @note The linesize parameters have the type ptrdiff_t here, while they are + * int for av_image_fill_linesizes(). + */ +int av_image_fill_plane_sizes(size_t size[4], enum AVPixelFormat pix_fmt, + int height, const ptrdiff_t linesizes[4]); + +/** + * Fill plane data pointers for an image with pixel format pix_fmt and + * height height. + * + * @param data pointers array to be filled with the pointer for each image plane + * @param pix_fmt the AVPixelFormat of the image + * @param height height of the image in pixels + * @param ptr the pointer to a buffer which will contain the image + * @param linesizes the array containing the linesize for each + * plane, should be filled by av_image_fill_linesizes() + * @return the size in bytes required for the image buffer, a negative + * error code in case of failure + */ +int av_image_fill_pointers(uint8_t *data[4], enum AVPixelFormat pix_fmt, int height, + uint8_t *ptr, const int linesizes[4]); + +/** + * Allocate an image with size w and h and pixel format pix_fmt, and + * fill pointers and linesizes accordingly. + * The allocated image buffer has to be freed by using + * av_freep(&pointers[0]). + * + * @param pointers array to be filled with the pointer for each image plane + * @param linesizes the array filled with the linesize for each plane + * @param w width of the image in pixels + * @param h height of the image in pixels + * @param pix_fmt the AVPixelFormat of the image + * @param align the value to use for buffer size alignment + * @return the size in bytes required for the image buffer, a negative + * error code in case of failure + */ +int av_image_alloc(uint8_t *pointers[4], int linesizes[4], + int w, int h, enum AVPixelFormat pix_fmt, int align); + +/** + * Copy image plane from src to dst. + * That is, copy "height" number of lines of "bytewidth" bytes each. + * The first byte of each successive line is separated by *_linesize + * bytes. + * + * bytewidth must be contained by both absolute values of dst_linesize + * and src_linesize, otherwise the function behavior is undefined. + * + * @param dst destination plane to copy to + * @param dst_linesize linesize for the image plane in dst + * @param src source plane to copy from + * @param src_linesize linesize for the image plane in src + * @param height height (number of lines) of the plane + */ +void av_image_copy_plane(uint8_t *dst, int dst_linesize, + const uint8_t *src, int src_linesize, + int bytewidth, int height); + +/** + * Copy image data located in uncacheable (e.g. GPU mapped) memory. Where + * available, this function will use special functionality for reading from such + * memory, which may result in greatly improved performance compared to plain + * av_image_copy_plane(). + * + * bytewidth must be contained by both absolute values of dst_linesize + * and src_linesize, otherwise the function behavior is undefined. + * + * @note The linesize parameters have the type ptrdiff_t here, while they are + * int for av_image_copy_plane(). + * @note On x86, the linesizes currently need to be aligned to the cacheline + * size (i.e. 64) to get improved performance. + */ +void av_image_copy_plane_uc_from(uint8_t *dst, ptrdiff_t dst_linesize, + const uint8_t *src, ptrdiff_t src_linesize, + ptrdiff_t bytewidth, int height); + +/** + * Copy image in src_data to dst_data. + * + * @param dst_data destination image data buffer to copy to + * @param dst_linesizes linesizes for the image in dst_data + * @param src_data source image data buffer to copy from + * @param src_linesizes linesizes for the image in src_data + * @param pix_fmt the AVPixelFormat of the image + * @param width width of the image in pixels + * @param height height of the image in pixels + */ +void av_image_copy(uint8_t * const dst_data[4], const int dst_linesizes[4], + const uint8_t * const src_data[4], const int src_linesizes[4], + enum AVPixelFormat pix_fmt, int width, int height); + +/** + * Wrapper around av_image_copy() to workaround the limitation + * that the conversion from uint8_t * const * to const uint8_t * const * + * is not performed automatically in C. + * @see av_image_copy() + */ +static inline +void av_image_copy2(uint8_t * const dst_data[4], const int dst_linesizes[4], + uint8_t * const src_data[4], const int src_linesizes[4], + enum AVPixelFormat pix_fmt, int width, int height) +{ + av_image_copy(dst_data, dst_linesizes, + (const uint8_t * const *)src_data, src_linesizes, + pix_fmt, width, height); +} + +/** + * Copy image data located in uncacheable (e.g. GPU mapped) memory. Where + * available, this function will use special functionality for reading from such + * memory, which may result in greatly improved performance compared to plain + * av_image_copy(). + * + * The data pointers and the linesizes must be aligned to the maximum required + * by the CPU architecture. + * + * @note The linesize parameters have the type ptrdiff_t here, while they are + * int for av_image_copy(). + * @note On x86, the linesizes currently need to be aligned to the cacheline + * size (i.e. 64) to get improved performance. + */ +void av_image_copy_uc_from(uint8_t * const dst_data[4], const ptrdiff_t dst_linesizes[4], + const uint8_t * const src_data[4], const ptrdiff_t src_linesizes[4], + enum AVPixelFormat pix_fmt, int width, int height); + +/** + * Setup the data pointers and linesizes based on the specified image + * parameters and the provided array. + * + * The fields of the given image are filled in by using the src + * address which points to the image data buffer. Depending on the + * specified pixel format, one or multiple image data pointers and + * line sizes will be set. If a planar format is specified, several + * pointers will be set pointing to the different picture planes and + * the line sizes of the different planes will be stored in the + * lines_sizes array. Call with src == NULL to get the required + * size for the src buffer. + * + * To allocate the buffer and fill in the dst_data and dst_linesize in + * one call, use av_image_alloc(). + * + * @param dst_data data pointers to be filled in + * @param dst_linesize linesizes for the image in dst_data to be filled in + * @param src buffer which will contain or contains the actual image data, can be NULL + * @param pix_fmt the pixel format of the image + * @param width the width of the image in pixels + * @param height the height of the image in pixels + * @param align the value used in src for linesize alignment + * @return the size in bytes required for src, a negative error code + * in case of failure + */ +int av_image_fill_arrays(uint8_t *dst_data[4], int dst_linesize[4], + const uint8_t *src, + enum AVPixelFormat pix_fmt, int width, int height, int align); + +/** + * Return the size in bytes of the amount of data required to store an + * image with the given parameters. + * + * @param pix_fmt the pixel format of the image + * @param width the width of the image in pixels + * @param height the height of the image in pixels + * @param align the assumed linesize alignment + * @return the buffer size in bytes, a negative error code in case of failure + */ +int av_image_get_buffer_size(enum AVPixelFormat pix_fmt, int width, int height, int align); + +/** + * Copy image data from an image into a buffer. + * + * av_image_get_buffer_size() can be used to compute the required size + * for the buffer to fill. + * + * @param dst a buffer into which picture data will be copied + * @param dst_size the size in bytes of dst + * @param src_data pointers containing the source image data + * @param src_linesize linesizes for the image in src_data + * @param pix_fmt the pixel format of the source image + * @param width the width of the source image in pixels + * @param height the height of the source image in pixels + * @param align the assumed linesize alignment for dst + * @return the number of bytes written to dst, or a negative value + * (error code) on error + */ +int av_image_copy_to_buffer(uint8_t *dst, int dst_size, + const uint8_t * const src_data[4], const int src_linesize[4], + enum AVPixelFormat pix_fmt, int width, int height, int align); + +/** + * Check if the given dimension of an image is valid, meaning that all + * bytes of the image can be addressed with a signed int. + * + * @param w the width of the picture + * @param h the height of the picture + * @param log_offset the offset to sum to the log level for logging with log_ctx + * @param log_ctx the parent logging context, it may be NULL + * @return >= 0 if valid, a negative error code otherwise + */ +int av_image_check_size(unsigned int w, unsigned int h, int log_offset, void *log_ctx); + +/** + * Check if the given dimension of an image is valid, meaning that all + * bytes of a plane of an image with the specified pix_fmt can be addressed + * with a signed int. + * + * @param w the width of the picture + * @param h the height of the picture + * @param max_pixels the maximum number of pixels the user wants to accept + * @param pix_fmt the pixel format, can be AV_PIX_FMT_NONE if unknown. + * @param log_offset the offset to sum to the log level for logging with log_ctx + * @param log_ctx the parent logging context, it may be NULL + * @return >= 0 if valid, a negative error code otherwise + */ +int av_image_check_size2(unsigned int w, unsigned int h, int64_t max_pixels, enum AVPixelFormat pix_fmt, int log_offset, void *log_ctx); + +/** + * Check if the given sample aspect ratio of an image is valid. + * + * It is considered invalid if the denominator is 0 or if applying the ratio + * to the image size would make the smaller dimension less than 1. If the + * sar numerator is 0, it is considered unknown and will return as valid. + * + * @param w width of the image + * @param h height of the image + * @param sar sample aspect ratio of the image + * @return 0 if valid, a negative AVERROR code otherwise + */ +int av_image_check_sar(unsigned int w, unsigned int h, AVRational sar); + +/** + * Overwrite the image data with black. This is suitable for filling a + * sub-rectangle of an image, meaning the padding between the right most pixel + * and the left most pixel on the next line will not be overwritten. For some + * formats, the image size might be rounded up due to inherent alignment. + * + * If the pixel format has alpha, the alpha is cleared to opaque. + * + * This can return an error if the pixel format is not supported. Normally, all + * non-hwaccel pixel formats should be supported. + * + * Passing NULL for dst_data is allowed. Then the function returns whether the + * operation would have succeeded. (It can return an error if the pix_fmt is + * not supported.) + * + * @param dst_data data pointers to destination image + * @param dst_linesize linesizes for the destination image + * @param pix_fmt the pixel format of the image + * @param range the color range of the image (important for colorspaces such as YUV) + * @param width the width of the image in pixels + * @param height the height of the image in pixels + * @return 0 if the image data was cleared, a negative AVERROR code otherwise + */ +int av_image_fill_black(uint8_t * const dst_data[4], const ptrdiff_t dst_linesize[4], + enum AVPixelFormat pix_fmt, enum AVColorRange range, + int width, int height); + +/** + * @} + */ + + +#endif /* AVUTIL_IMGUTILS_H */ diff --git a/libs/FFmpeg/include/libavutil/intfloat.h b/libs/FFmpeg/include/libavutil/intfloat.h new file mode 100644 index 0000000..fe3d7ec --- /dev/null +++ b/libs/FFmpeg/include/libavutil/intfloat.h @@ -0,0 +1,77 @@ +/* + * Copyright (c) 2011 Mans Rullgard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_INTFLOAT_H +#define AVUTIL_INTFLOAT_H + +#include +#include "attributes.h" + +union av_intfloat32 { + uint32_t i; + float f; +}; + +union av_intfloat64 { + uint64_t i; + double f; +}; + +/** + * Reinterpret a 32-bit integer as a float. + */ +static av_always_inline float av_int2float(uint32_t i) +{ + union av_intfloat32 v; + v.i = i; + return v.f; +} + +/** + * Reinterpret a float as a 32-bit integer. + */ +static av_always_inline uint32_t av_float2int(float f) +{ + union av_intfloat32 v; + v.f = f; + return v.i; +} + +/** + * Reinterpret a 64-bit integer as a double. + */ +static av_always_inline double av_int2double(uint64_t i) +{ + union av_intfloat64 v; + v.i = i; + return v.f; +} + +/** + * Reinterpret a double as a 64-bit integer. + */ +static av_always_inline uint64_t av_double2int(double f) +{ + union av_intfloat64 v; + v.f = f; + return v.i; +} + +#endif /* AVUTIL_INTFLOAT_H */ diff --git a/libs/FFmpeg/include/libavutil/intreadwrite.h b/libs/FFmpeg/include/libavutil/intreadwrite.h new file mode 100644 index 0000000..21df788 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/intreadwrite.h @@ -0,0 +1,642 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_INTREADWRITE_H +#define AVUTIL_INTREADWRITE_H + +#include +#include "libavutil/avconfig.h" +#include "attributes.h" +#include "bswap.h" + +typedef union { + uint64_t u64; + uint32_t u32[2]; + uint16_t u16[4]; + uint8_t u8 [8]; + double f64; + float f32[2]; +} av_alias av_alias64; + +typedef union { + uint32_t u32; + uint16_t u16[2]; + uint8_t u8 [4]; + float f32; +} av_alias av_alias32; + +typedef union { + uint16_t u16; + uint8_t u8 [2]; +} av_alias av_alias16; + +/* + * Arch-specific headers can provide any combination of + * AV_[RW][BLN](16|24|32|48|64) and AV_(COPY|SWAP|ZERO)(64|128) macros. + * Preprocessor symbols must be defined, even if these are implemented + * as inline functions. + * + * R/W means read/write, B/L/N means big/little/native endianness. + * The following macros require aligned access, compared to their + * unaligned variants: AV_(COPY|SWAP|ZERO)(64|128), AV_[RW]N[8-64]A. + * Incorrect usage may range from abysmal performance to crash + * depending on the platform. + * + * The unaligned variants are AV_[RW][BLN][8-64] and AV_COPY*U. + */ + +#ifdef HAVE_AV_CONFIG_H + +#include "config.h" + +#if ARCH_ARM +# include "arm/intreadwrite.h" +#elif ARCH_AVR32 +# include "avr32/intreadwrite.h" +#elif ARCH_MIPS +# include "mips/intreadwrite.h" +#elif ARCH_PPC +# include "ppc/intreadwrite.h" +#elif ARCH_X86 +# include "x86/intreadwrite.h" +#endif + +#endif /* HAVE_AV_CONFIG_H */ + +/* + * Map AV_RNXX <-> AV_R[BL]XX for all variants provided by per-arch headers. + */ + +#if AV_HAVE_BIGENDIAN + +# if defined(AV_RN16) && !defined(AV_RB16) +# define AV_RB16(p) AV_RN16(p) +# elif !defined(AV_RN16) && defined(AV_RB16) +# define AV_RN16(p) AV_RB16(p) +# endif + +# if defined(AV_WN16) && !defined(AV_WB16) +# define AV_WB16(p, v) AV_WN16(p, v) +# elif !defined(AV_WN16) && defined(AV_WB16) +# define AV_WN16(p, v) AV_WB16(p, v) +# endif + +# if defined(AV_RN24) && !defined(AV_RB24) +# define AV_RB24(p) AV_RN24(p) +# elif !defined(AV_RN24) && defined(AV_RB24) +# define AV_RN24(p) AV_RB24(p) +# endif + +# if defined(AV_WN24) && !defined(AV_WB24) +# define AV_WB24(p, v) AV_WN24(p, v) +# elif !defined(AV_WN24) && defined(AV_WB24) +# define AV_WN24(p, v) AV_WB24(p, v) +# endif + +# if defined(AV_RN32) && !defined(AV_RB32) +# define AV_RB32(p) AV_RN32(p) +# elif !defined(AV_RN32) && defined(AV_RB32) +# define AV_RN32(p) AV_RB32(p) +# endif + +# if defined(AV_WN32) && !defined(AV_WB32) +# define AV_WB32(p, v) AV_WN32(p, v) +# elif !defined(AV_WN32) && defined(AV_WB32) +# define AV_WN32(p, v) AV_WB32(p, v) +# endif + +# if defined(AV_RN48) && !defined(AV_RB48) +# define AV_RB48(p) AV_RN48(p) +# elif !defined(AV_RN48) && defined(AV_RB48) +# define AV_RN48(p) AV_RB48(p) +# endif + +# if defined(AV_WN48) && !defined(AV_WB48) +# define AV_WB48(p, v) AV_WN48(p, v) +# elif !defined(AV_WN48) && defined(AV_WB48) +# define AV_WN48(p, v) AV_WB48(p, v) +# endif + +# if defined(AV_RN64) && !defined(AV_RB64) +# define AV_RB64(p) AV_RN64(p) +# elif !defined(AV_RN64) && defined(AV_RB64) +# define AV_RN64(p) AV_RB64(p) +# endif + +# if defined(AV_WN64) && !defined(AV_WB64) +# define AV_WB64(p, v) AV_WN64(p, v) +# elif !defined(AV_WN64) && defined(AV_WB64) +# define AV_WN64(p, v) AV_WB64(p, v) +# endif + +#else /* AV_HAVE_BIGENDIAN */ + +# if defined(AV_RN16) && !defined(AV_RL16) +# define AV_RL16(p) AV_RN16(p) +# elif !defined(AV_RN16) && defined(AV_RL16) +# define AV_RN16(p) AV_RL16(p) +# endif + +# if defined(AV_WN16) && !defined(AV_WL16) +# define AV_WL16(p, v) AV_WN16(p, v) +# elif !defined(AV_WN16) && defined(AV_WL16) +# define AV_WN16(p, v) AV_WL16(p, v) +# endif + +# if defined(AV_RN24) && !defined(AV_RL24) +# define AV_RL24(p) AV_RN24(p) +# elif !defined(AV_RN24) && defined(AV_RL24) +# define AV_RN24(p) AV_RL24(p) +# endif + +# if defined(AV_WN24) && !defined(AV_WL24) +# define AV_WL24(p, v) AV_WN24(p, v) +# elif !defined(AV_WN24) && defined(AV_WL24) +# define AV_WN24(p, v) AV_WL24(p, v) +# endif + +# if defined(AV_RN32) && !defined(AV_RL32) +# define AV_RL32(p) AV_RN32(p) +# elif !defined(AV_RN32) && defined(AV_RL32) +# define AV_RN32(p) AV_RL32(p) +# endif + +# if defined(AV_WN32) && !defined(AV_WL32) +# define AV_WL32(p, v) AV_WN32(p, v) +# elif !defined(AV_WN32) && defined(AV_WL32) +# define AV_WN32(p, v) AV_WL32(p, v) +# endif + +# if defined(AV_RN48) && !defined(AV_RL48) +# define AV_RL48(p) AV_RN48(p) +# elif !defined(AV_RN48) && defined(AV_RL48) +# define AV_RN48(p) AV_RL48(p) +# endif + +# if defined(AV_WN48) && !defined(AV_WL48) +# define AV_WL48(p, v) AV_WN48(p, v) +# elif !defined(AV_WN48) && defined(AV_WL48) +# define AV_WN48(p, v) AV_WL48(p, v) +# endif + +# if defined(AV_RN64) && !defined(AV_RL64) +# define AV_RL64(p) AV_RN64(p) +# elif !defined(AV_RN64) && defined(AV_RL64) +# define AV_RN64(p) AV_RL64(p) +# endif + +# if defined(AV_WN64) && !defined(AV_WL64) +# define AV_WL64(p, v) AV_WN64(p, v) +# elif !defined(AV_WN64) && defined(AV_WL64) +# define AV_WN64(p, v) AV_WL64(p, v) +# endif + +#endif /* !AV_HAVE_BIGENDIAN */ + +/* + * Define AV_[RW]N helper macros to simplify definitions not provided + * by per-arch headers. + */ + +#if defined(__GNUC__) || defined(__clang__) + +union unaligned_64 { uint64_t l; } __attribute__((packed)) av_alias; +union unaligned_32 { uint32_t l; } __attribute__((packed)) av_alias; +union unaligned_16 { uint16_t l; } __attribute__((packed)) av_alias; + +# define AV_RN(s, p) (((const union unaligned_##s *) (p))->l) +# define AV_WN(s, p, v) ((((union unaligned_##s *) (p))->l) = (v)) + +#elif defined(_MSC_VER) && (defined(_M_ARM) || defined(_M_X64) || defined(_M_ARM64)) && AV_HAVE_FAST_UNALIGNED + +# define AV_RN(s, p) (*((const __unaligned uint##s##_t*)(p))) +# define AV_WN(s, p, v) (*((__unaligned uint##s##_t*)(p)) = (v)) + +#elif AV_HAVE_FAST_UNALIGNED + +# define AV_RN(s, p) (((const av_alias##s*)(p))->u##s) +# define AV_WN(s, p, v) (((av_alias##s*)(p))->u##s = (v)) + +#else + +#ifndef AV_RB16 +# define AV_RB16(x) \ + ((((const uint8_t*)(x))[0] << 8) | \ + ((const uint8_t*)(x))[1]) +#endif +#ifndef AV_WB16 +# define AV_WB16(p, val) do { \ + uint16_t d = (val); \ + ((uint8_t*)(p))[1] = (d); \ + ((uint8_t*)(p))[0] = (d)>>8; \ + } while(0) +#endif + +#ifndef AV_RL16 +# define AV_RL16(x) \ + ((((const uint8_t*)(x))[1] << 8) | \ + ((const uint8_t*)(x))[0]) +#endif +#ifndef AV_WL16 +# define AV_WL16(p, val) do { \ + uint16_t d = (val); \ + ((uint8_t*)(p))[0] = (d); \ + ((uint8_t*)(p))[1] = (d)>>8; \ + } while(0) +#endif + +#ifndef AV_RB32 +# define AV_RB32(x) \ + (((uint32_t)((const uint8_t*)(x))[0] << 24) | \ + (((const uint8_t*)(x))[1] << 16) | \ + (((const uint8_t*)(x))[2] << 8) | \ + ((const uint8_t*)(x))[3]) +#endif +#ifndef AV_WB32 +# define AV_WB32(p, val) do { \ + uint32_t d = (val); \ + ((uint8_t*)(p))[3] = (d); \ + ((uint8_t*)(p))[2] = (d)>>8; \ + ((uint8_t*)(p))[1] = (d)>>16; \ + ((uint8_t*)(p))[0] = (d)>>24; \ + } while(0) +#endif + +#ifndef AV_RL32 +# define AV_RL32(x) \ + (((uint32_t)((const uint8_t*)(x))[3] << 24) | \ + (((const uint8_t*)(x))[2] << 16) | \ + (((const uint8_t*)(x))[1] << 8) | \ + ((const uint8_t*)(x))[0]) +#endif +#ifndef AV_WL32 +# define AV_WL32(p, val) do { \ + uint32_t d = (val); \ + ((uint8_t*)(p))[0] = (d); \ + ((uint8_t*)(p))[1] = (d)>>8; \ + ((uint8_t*)(p))[2] = (d)>>16; \ + ((uint8_t*)(p))[3] = (d)>>24; \ + } while(0) +#endif + +#ifndef AV_RB64 +# define AV_RB64(x) \ + (((uint64_t)((const uint8_t*)(x))[0] << 56) | \ + ((uint64_t)((const uint8_t*)(x))[1] << 48) | \ + ((uint64_t)((const uint8_t*)(x))[2] << 40) | \ + ((uint64_t)((const uint8_t*)(x))[3] << 32) | \ + ((uint64_t)((const uint8_t*)(x))[4] << 24) | \ + ((uint64_t)((const uint8_t*)(x))[5] << 16) | \ + ((uint64_t)((const uint8_t*)(x))[6] << 8) | \ + (uint64_t)((const uint8_t*)(x))[7]) +#endif +#ifndef AV_WB64 +# define AV_WB64(p, val) do { \ + uint64_t d = (val); \ + ((uint8_t*)(p))[7] = (d); \ + ((uint8_t*)(p))[6] = (d)>>8; \ + ((uint8_t*)(p))[5] = (d)>>16; \ + ((uint8_t*)(p))[4] = (d)>>24; \ + ((uint8_t*)(p))[3] = (d)>>32; \ + ((uint8_t*)(p))[2] = (d)>>40; \ + ((uint8_t*)(p))[1] = (d)>>48; \ + ((uint8_t*)(p))[0] = (d)>>56; \ + } while(0) +#endif + +#ifndef AV_RL64 +# define AV_RL64(x) \ + (((uint64_t)((const uint8_t*)(x))[7] << 56) | \ + ((uint64_t)((const uint8_t*)(x))[6] << 48) | \ + ((uint64_t)((const uint8_t*)(x))[5] << 40) | \ + ((uint64_t)((const uint8_t*)(x))[4] << 32) | \ + ((uint64_t)((const uint8_t*)(x))[3] << 24) | \ + ((uint64_t)((const uint8_t*)(x))[2] << 16) | \ + ((uint64_t)((const uint8_t*)(x))[1] << 8) | \ + (uint64_t)((const uint8_t*)(x))[0]) +#endif +#ifndef AV_WL64 +# define AV_WL64(p, val) do { \ + uint64_t d = (val); \ + ((uint8_t*)(p))[0] = (d); \ + ((uint8_t*)(p))[1] = (d)>>8; \ + ((uint8_t*)(p))[2] = (d)>>16; \ + ((uint8_t*)(p))[3] = (d)>>24; \ + ((uint8_t*)(p))[4] = (d)>>32; \ + ((uint8_t*)(p))[5] = (d)>>40; \ + ((uint8_t*)(p))[6] = (d)>>48; \ + ((uint8_t*)(p))[7] = (d)>>56; \ + } while(0) +#endif + +#if AV_HAVE_BIGENDIAN +# define AV_RN(s, p) AV_RB##s(p) +# define AV_WN(s, p, v) AV_WB##s(p, v) +#else +# define AV_RN(s, p) AV_RL##s(p) +# define AV_WN(s, p, v) AV_WL##s(p, v) +#endif + +#endif /* HAVE_FAST_UNALIGNED */ + +#ifndef AV_RN16 +# define AV_RN16(p) AV_RN(16, p) +#endif + +#ifndef AV_RN32 +# define AV_RN32(p) AV_RN(32, p) +#endif + +#ifndef AV_RN64 +# define AV_RN64(p) AV_RN(64, p) +#endif + +#ifndef AV_WN16 +# define AV_WN16(p, v) AV_WN(16, p, v) +#endif + +#ifndef AV_WN32 +# define AV_WN32(p, v) AV_WN(32, p, v) +#endif + +#ifndef AV_WN64 +# define AV_WN64(p, v) AV_WN(64, p, v) +#endif + +#if AV_HAVE_BIGENDIAN +# define AV_RB(s, p) AV_RN##s(p) +# define AV_WB(s, p, v) AV_WN##s(p, v) +# define AV_RL(s, p) av_bswap##s(AV_RN##s(p)) +# define AV_WL(s, p, v) AV_WN##s(p, av_bswap##s(v)) +#else +# define AV_RB(s, p) av_bswap##s(AV_RN##s(p)) +# define AV_WB(s, p, v) AV_WN##s(p, av_bswap##s(v)) +# define AV_RL(s, p) AV_RN##s(p) +# define AV_WL(s, p, v) AV_WN##s(p, v) +#endif + +#define AV_RB8(x) (((const uint8_t*)(x))[0]) +#define AV_WB8(p, d) do { ((uint8_t*)(p))[0] = (d); } while(0) + +#define AV_RL8(x) AV_RB8(x) +#define AV_WL8(p, d) AV_WB8(p, d) + +#ifndef AV_RB16 +# define AV_RB16(p) AV_RB(16, p) +#endif +#ifndef AV_WB16 +# define AV_WB16(p, v) AV_WB(16, p, v) +#endif + +#ifndef AV_RL16 +# define AV_RL16(p) AV_RL(16, p) +#endif +#ifndef AV_WL16 +# define AV_WL16(p, v) AV_WL(16, p, v) +#endif + +#ifndef AV_RB32 +# define AV_RB32(p) AV_RB(32, p) +#endif +#ifndef AV_WB32 +# define AV_WB32(p, v) AV_WB(32, p, v) +#endif + +#ifndef AV_RL32 +# define AV_RL32(p) AV_RL(32, p) +#endif +#ifndef AV_WL32 +# define AV_WL32(p, v) AV_WL(32, p, v) +#endif + +#ifndef AV_RB64 +# define AV_RB64(p) AV_RB(64, p) +#endif +#ifndef AV_WB64 +# define AV_WB64(p, v) AV_WB(64, p, v) +#endif + +#ifndef AV_RL64 +# define AV_RL64(p) AV_RL(64, p) +#endif +#ifndef AV_WL64 +# define AV_WL64(p, v) AV_WL(64, p, v) +#endif + +#ifndef AV_RB24 +# define AV_RB24(x) \ + ((((const uint8_t*)(x))[0] << 16) | \ + (((const uint8_t*)(x))[1] << 8) | \ + ((const uint8_t*)(x))[2]) +#endif +#ifndef AV_WB24 +# define AV_WB24(p, d) do { \ + ((uint8_t*)(p))[2] = (d); \ + ((uint8_t*)(p))[1] = (d)>>8; \ + ((uint8_t*)(p))[0] = (d)>>16; \ + } while(0) +#endif + +#ifndef AV_RL24 +# define AV_RL24(x) \ + ((((const uint8_t*)(x))[2] << 16) | \ + (((const uint8_t*)(x))[1] << 8) | \ + ((const uint8_t*)(x))[0]) +#endif +#ifndef AV_WL24 +# define AV_WL24(p, d) do { \ + ((uint8_t*)(p))[0] = (d); \ + ((uint8_t*)(p))[1] = (d)>>8; \ + ((uint8_t*)(p))[2] = (d)>>16; \ + } while(0) +#endif + +#ifndef AV_RB48 +# define AV_RB48(x) \ + (((uint64_t)((const uint8_t*)(x))[0] << 40) | \ + ((uint64_t)((const uint8_t*)(x))[1] << 32) | \ + ((uint64_t)((const uint8_t*)(x))[2] << 24) | \ + ((uint64_t)((const uint8_t*)(x))[3] << 16) | \ + ((uint64_t)((const uint8_t*)(x))[4] << 8) | \ + (uint64_t)((const uint8_t*)(x))[5]) +#endif +#ifndef AV_WB48 +# define AV_WB48(p, darg) do { \ + uint64_t d = (darg); \ + ((uint8_t*)(p))[5] = (d); \ + ((uint8_t*)(p))[4] = (d)>>8; \ + ((uint8_t*)(p))[3] = (d)>>16; \ + ((uint8_t*)(p))[2] = (d)>>24; \ + ((uint8_t*)(p))[1] = (d)>>32; \ + ((uint8_t*)(p))[0] = (d)>>40; \ + } while(0) +#endif + +#ifndef AV_RL48 +# define AV_RL48(x) \ + (((uint64_t)((const uint8_t*)(x))[5] << 40) | \ + ((uint64_t)((const uint8_t*)(x))[4] << 32) | \ + ((uint64_t)((const uint8_t*)(x))[3] << 24) | \ + ((uint64_t)((const uint8_t*)(x))[2] << 16) | \ + ((uint64_t)((const uint8_t*)(x))[1] << 8) | \ + (uint64_t)((const uint8_t*)(x))[0]) +#endif +#ifndef AV_WL48 +# define AV_WL48(p, darg) do { \ + uint64_t d = (darg); \ + ((uint8_t*)(p))[0] = (d); \ + ((uint8_t*)(p))[1] = (d)>>8; \ + ((uint8_t*)(p))[2] = (d)>>16; \ + ((uint8_t*)(p))[3] = (d)>>24; \ + ((uint8_t*)(p))[4] = (d)>>32; \ + ((uint8_t*)(p))[5] = (d)>>40; \ + } while(0) +#endif + +/* + * The AV_[RW]NA macros access naturally aligned data + * in a type-safe way. + */ + +#define AV_RNA(s, p) (((const av_alias##s*)(p))->u##s) +#define AV_WNA(s, p, v) (((av_alias##s*)(p))->u##s = (v)) + +#ifndef AV_RN16A +# define AV_RN16A(p) AV_RNA(16, p) +#endif + +#ifndef AV_RN32A +# define AV_RN32A(p) AV_RNA(32, p) +#endif + +#ifndef AV_RN64A +# define AV_RN64A(p) AV_RNA(64, p) +#endif + +#ifndef AV_WN16A +# define AV_WN16A(p, v) AV_WNA(16, p, v) +#endif + +#ifndef AV_WN32A +# define AV_WN32A(p, v) AV_WNA(32, p, v) +#endif + +#ifndef AV_WN64A +# define AV_WN64A(p, v) AV_WNA(64, p, v) +#endif + +#if AV_HAVE_BIGENDIAN +# define AV_RLA(s, p) av_bswap##s(AV_RN##s##A(p)) +# define AV_WLA(s, p, v) AV_WN##s##A(p, av_bswap##s(v)) +#else +# define AV_RLA(s, p) AV_RN##s##A(p) +# define AV_WLA(s, p, v) AV_WN##s##A(p, v) +#endif + +#ifndef AV_RL64A +# define AV_RL64A(p) AV_RLA(64, p) +#endif +#ifndef AV_WL64A +# define AV_WL64A(p, v) AV_WLA(64, p, v) +#endif + +/* + * The AV_COPYxxU macros are suitable for copying data to/from unaligned + * memory locations. + */ + +#define AV_COPYU(n, d, s) AV_WN##n(d, AV_RN##n(s)); + +#ifndef AV_COPY16U +# define AV_COPY16U(d, s) AV_COPYU(16, d, s) +#endif + +#ifndef AV_COPY32U +# define AV_COPY32U(d, s) AV_COPYU(32, d, s) +#endif + +#ifndef AV_COPY64U +# define AV_COPY64U(d, s) AV_COPYU(64, d, s) +#endif + +#ifndef AV_COPY128U +# define AV_COPY128U(d, s) \ + do { \ + AV_COPY64U(d, s); \ + AV_COPY64U((char *)(d) + 8, (const char *)(s) + 8); \ + } while(0) +#endif + +/* Parameters for AV_COPY*, AV_SWAP*, AV_ZERO* must be + * naturally aligned. They may be implemented using MMX, + * so emms_c() must be called before using any float code + * afterwards. + */ + +#define AV_COPY(n, d, s) \ + (((av_alias##n*)(d))->u##n = ((const av_alias##n*)(s))->u##n) + +#ifndef AV_COPY16 +# define AV_COPY16(d, s) AV_COPY(16, d, s) +#endif + +#ifndef AV_COPY32 +# define AV_COPY32(d, s) AV_COPY(32, d, s) +#endif + +#ifndef AV_COPY64 +# define AV_COPY64(d, s) AV_COPY(64, d, s) +#endif + +#ifndef AV_COPY128 +# define AV_COPY128(d, s) \ + do { \ + AV_COPY64(d, s); \ + AV_COPY64((char*)(d)+8, (char*)(s)+8); \ + } while(0) +#endif + +#define AV_SWAP(n, a, b) FFSWAP(av_alias##n, *(av_alias##n*)(a), *(av_alias##n*)(b)) + +#ifndef AV_SWAP64 +# define AV_SWAP64(a, b) AV_SWAP(64, a, b) +#endif + +#define AV_ZERO(n, d) (((av_alias##n*)(d))->u##n = 0) + +#ifndef AV_ZERO16 +# define AV_ZERO16(d) AV_ZERO(16, d) +#endif + +#ifndef AV_ZERO32 +# define AV_ZERO32(d) AV_ZERO(32, d) +#endif + +#ifndef AV_ZERO64 +# define AV_ZERO64(d) AV_ZERO(64, d) +#endif + +#ifndef AV_ZERO128 +# define AV_ZERO128(d) \ + do { \ + AV_ZERO64(d); \ + AV_ZERO64((char*)(d)+8); \ + } while(0) +#endif + +#endif /* AVUTIL_INTREADWRITE_H */ diff --git a/libs/FFmpeg/include/libavutil/lfg.h b/libs/FFmpeg/include/libavutil/lfg.h new file mode 100644 index 0000000..e75a986 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/lfg.h @@ -0,0 +1,81 @@ +/* + * Lagged Fibonacci PRNG + * Copyright (c) 2008 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_LFG_H +#define AVUTIL_LFG_H + +#include + +/** + * Context structure for the Lagged Fibonacci PRNG. + * The exact layout, types and content of this struct may change and should + * not be accessed directly. Only its `sizeof()` is guaranteed to stay the same + * to allow easy instanciation. + */ +typedef struct AVLFG { + unsigned int state[64]; + int index; +} AVLFG; + +void av_lfg_init(AVLFG *c, unsigned int seed); + +/** + * Seed the state of the ALFG using binary data. + * + * @return 0 on success, negative value (AVERROR) on failure. + */ +int av_lfg_init_from_data(AVLFG *c, const uint8_t *data, unsigned int length); + +/** + * Get the next random unsigned 32-bit number using an ALFG. + * + * Please also consider a simple LCG like state= state*1664525+1013904223, + * it may be good enough and faster for your specific use case. + */ +static inline unsigned int av_lfg_get(AVLFG *c){ + unsigned a = c->state[c->index & 63] = c->state[(c->index-24) & 63] + c->state[(c->index-55) & 63]; + c->index += 1U; + return a; +} + +/** + * Get the next random unsigned 32-bit number using a MLFG. + * + * Please also consider av_lfg_get() above, it is faster. + */ +static inline unsigned int av_mlfg_get(AVLFG *c){ + unsigned int a= c->state[(c->index-55) & 63]; + unsigned int b= c->state[(c->index-24) & 63]; + a = c->state[c->index & 63] = 2*a*b+a+b; + c->index += 1U; + return a; +} + +/** + * Get the next two numbers generated by a Box-Muller Gaussian + * generator using the random numbers issued by lfg. + * + * @param lfg pointer to the contex structure + * @param out array where the two generated numbers are placed + */ +void av_bmg_get(AVLFG *lfg, double out[2]); + +#endif /* AVUTIL_LFG_H */ diff --git a/libs/FFmpeg/include/libavutil/log.h b/libs/FFmpeg/include/libavutil/log.h new file mode 100644 index 0000000..ab7ceab --- /dev/null +++ b/libs/FFmpeg/include/libavutil/log.h @@ -0,0 +1,387 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_LOG_H +#define AVUTIL_LOG_H + +#include +#include "attributes.h" +#include "version.h" + +typedef enum { + AV_CLASS_CATEGORY_NA = 0, + AV_CLASS_CATEGORY_INPUT, + AV_CLASS_CATEGORY_OUTPUT, + AV_CLASS_CATEGORY_MUXER, + AV_CLASS_CATEGORY_DEMUXER, + AV_CLASS_CATEGORY_ENCODER, + AV_CLASS_CATEGORY_DECODER, + AV_CLASS_CATEGORY_FILTER, + AV_CLASS_CATEGORY_BITSTREAM_FILTER, + AV_CLASS_CATEGORY_SWSCALER, + AV_CLASS_CATEGORY_SWRESAMPLER, + AV_CLASS_CATEGORY_DEVICE_VIDEO_OUTPUT = 40, + AV_CLASS_CATEGORY_DEVICE_VIDEO_INPUT, + AV_CLASS_CATEGORY_DEVICE_AUDIO_OUTPUT, + AV_CLASS_CATEGORY_DEVICE_AUDIO_INPUT, + AV_CLASS_CATEGORY_DEVICE_OUTPUT, + AV_CLASS_CATEGORY_DEVICE_INPUT, + AV_CLASS_CATEGORY_NB ///< not part of ABI/API +}AVClassCategory; + +#define AV_IS_INPUT_DEVICE(category) \ + (((category) == AV_CLASS_CATEGORY_DEVICE_VIDEO_INPUT) || \ + ((category) == AV_CLASS_CATEGORY_DEVICE_AUDIO_INPUT) || \ + ((category) == AV_CLASS_CATEGORY_DEVICE_INPUT)) + +#define AV_IS_OUTPUT_DEVICE(category) \ + (((category) == AV_CLASS_CATEGORY_DEVICE_VIDEO_OUTPUT) || \ + ((category) == AV_CLASS_CATEGORY_DEVICE_AUDIO_OUTPUT) || \ + ((category) == AV_CLASS_CATEGORY_DEVICE_OUTPUT)) + +struct AVOptionRanges; + +/** + * Describe the class of an AVClass context structure. That is an + * arbitrary struct of which the first field is a pointer to an + * AVClass struct (e.g. AVCodecContext, AVFormatContext etc.). + */ +typedef struct AVClass { + /** + * The name of the class; usually it is the same name as the + * context structure type to which the AVClass is associated. + */ + const char* class_name; + + /** + * A pointer to a function which returns the name of a context + * instance ctx associated with the class. + */ + const char* (*item_name)(void* ctx); + + /** + * a pointer to the first option specified in the class if any or NULL + * + * @see av_set_default_options() + */ + const struct AVOption *option; + + /** + * LIBAVUTIL_VERSION with which this structure was created. + * This is used to allow fields to be added without requiring major + * version bumps everywhere. + */ + + int version; + + /** + * Offset in the structure where log_level_offset is stored. + * 0 means there is no such variable + */ + int log_level_offset_offset; + + /** + * Offset in the structure where a pointer to the parent context for + * logging is stored. For example a decoder could pass its AVCodecContext + * to eval as such a parent context, which an av_log() implementation + * could then leverage to display the parent context. + * The offset can be NULL. + */ + int parent_log_context_offset; + + /** + * Category used for visualization (like color) + * This is only set if the category is equal for all objects using this class. + * available since version (51 << 16 | 56 << 8 | 100) + */ + AVClassCategory category; + + /** + * Callback to return the category. + * available since version (51 << 16 | 59 << 8 | 100) + */ + AVClassCategory (*get_category)(void* ctx); + + /** + * Callback to return the supported/allowed ranges. + * available since version (52.12) + */ + int (*query_ranges)(struct AVOptionRanges **, void *obj, const char *key, int flags); + + /** + * Return next AVOptions-enabled child or NULL + */ + void* (*child_next)(void *obj, void *prev); + + /** + * Iterate over the AVClasses corresponding to potential AVOptions-enabled + * children. + * + * @param iter pointer to opaque iteration state. The caller must initialize + * *iter to NULL before the first call. + * @return AVClass for the next AVOptions-enabled child or NULL if there are + * no more such children. + * + * @note The difference between child_next and this is that child_next + * iterates over _already existing_ objects, while child_class_iterate + * iterates over _all possible_ children. + */ + const struct AVClass* (*child_class_iterate)(void **iter); +} AVClass; + +/** + * @addtogroup lavu_log + * + * @{ + * + * @defgroup lavu_log_constants Logging Constants + * + * @{ + */ + +/** + * Print no output. + */ +#define AV_LOG_QUIET -8 + +/** + * Something went really wrong and we will crash now. + */ +#define AV_LOG_PANIC 0 + +/** + * Something went wrong and recovery is not possible. + * For example, no header was found for a format which depends + * on headers or an illegal combination of parameters is used. + */ +#define AV_LOG_FATAL 8 + +/** + * Something went wrong and cannot losslessly be recovered. + * However, not all future data is affected. + */ +#define AV_LOG_ERROR 16 + +/** + * Something somehow does not look correct. This may or may not + * lead to problems. An example would be the use of '-vstrict -2'. + */ +#define AV_LOG_WARNING 24 + +/** + * Standard information. + */ +#define AV_LOG_INFO 32 + +/** + * Detailed information. + */ +#define AV_LOG_VERBOSE 40 + +/** + * Stuff which is only useful for libav* developers. + */ +#define AV_LOG_DEBUG 48 + +/** + * Extremely verbose debugging, useful for libav* development. + */ +#define AV_LOG_TRACE 56 + +#define AV_LOG_MAX_OFFSET (AV_LOG_TRACE - AV_LOG_QUIET) + +/** + * @} + */ + +/** + * Sets additional colors for extended debugging sessions. + * @code + av_log(ctx, AV_LOG_DEBUG|AV_LOG_C(134), "Message in purple\n"); + @endcode + * Requires 256color terminal support. Uses outside debugging is not + * recommended. + */ +#define AV_LOG_C(x) ((x) << 8) + +/** + * Send the specified message to the log if the level is less than or equal + * to the current av_log_level. By default, all logging messages are sent to + * stderr. This behavior can be altered by setting a different logging callback + * function. + * @see av_log_set_callback + * + * @param avcl A pointer to an arbitrary struct of which the first field is a + * pointer to an AVClass struct or NULL if general log. + * @param level The importance level of the message expressed using a @ref + * lavu_log_constants "Logging Constant". + * @param fmt The format string (printf-compatible) that specifies how + * subsequent arguments are converted to output. + */ +void av_log(void *avcl, int level, const char *fmt, ...) av_printf_format(3, 4); + +/** + * Send the specified message to the log once with the initial_level and then with + * the subsequent_level. By default, all logging messages are sent to + * stderr. This behavior can be altered by setting a different logging callback + * function. + * @see av_log + * + * @param avcl A pointer to an arbitrary struct of which the first field is a + * pointer to an AVClass struct or NULL if general log. + * @param initial_level importance level of the message expressed using a @ref + * lavu_log_constants "Logging Constant" for the first occurance. + * @param subsequent_level importance level of the message expressed using a @ref + * lavu_log_constants "Logging Constant" after the first occurance. + * @param fmt The format string (printf-compatible) that specifies how + * subsequent arguments are converted to output. + * @param state a variable to keep trak of if a message has already been printed + * this must be initialized to 0 before the first use. The same state + * must not be accessed by 2 Threads simultaneously. + */ +void av_log_once(void* avcl, int initial_level, int subsequent_level, int *state, const char *fmt, ...) av_printf_format(5, 6); + + +/** + * Send the specified message to the log if the level is less than or equal + * to the current av_log_level. By default, all logging messages are sent to + * stderr. This behavior can be altered by setting a different logging callback + * function. + * @see av_log_set_callback + * + * @param avcl A pointer to an arbitrary struct of which the first field is a + * pointer to an AVClass struct. + * @param level The importance level of the message expressed using a @ref + * lavu_log_constants "Logging Constant". + * @param fmt The format string (printf-compatible) that specifies how + * subsequent arguments are converted to output. + * @param vl The arguments referenced by the format string. + */ +void av_vlog(void *avcl, int level, const char *fmt, va_list vl); + +/** + * Get the current log level + * + * @see lavu_log_constants + * + * @return Current log level + */ +int av_log_get_level(void); + +/** + * Set the log level + * + * @see lavu_log_constants + * + * @param level Logging level + */ +void av_log_set_level(int level); + +/** + * Set the logging callback + * + * @note The callback must be thread safe, even if the application does not use + * threads itself as some codecs are multithreaded. + * + * @see av_log_default_callback + * + * @param callback A logging function with a compatible signature. + */ +void av_log_set_callback(void (*callback)(void*, int, const char*, va_list)); + +/** + * Default logging callback + * + * It prints the message to stderr, optionally colorizing it. + * + * @param avcl A pointer to an arbitrary struct of which the first field is a + * pointer to an AVClass struct. + * @param level The importance level of the message expressed using a @ref + * lavu_log_constants "Logging Constant". + * @param fmt The format string (printf-compatible) that specifies how + * subsequent arguments are converted to output. + * @param vl The arguments referenced by the format string. + */ +void av_log_default_callback(void *avcl, int level, const char *fmt, + va_list vl); + +/** + * Return the context name + * + * @param ctx The AVClass context + * + * @return The AVClass class_name + */ +const char* av_default_item_name(void* ctx); +AVClassCategory av_default_get_category(void *ptr); + +/** + * Format a line of log the same way as the default callback. + * @param line buffer to receive the formatted line + * @param line_size size of the buffer + * @param print_prefix used to store whether the prefix must be printed; + * must point to a persistent integer initially set to 1 + */ +void av_log_format_line(void *ptr, int level, const char *fmt, va_list vl, + char *line, int line_size, int *print_prefix); + +/** + * Format a line of log the same way as the default callback. + * @param line buffer to receive the formatted line; + * may be NULL if line_size is 0 + * @param line_size size of the buffer; at most line_size-1 characters will + * be written to the buffer, plus one null terminator + * @param print_prefix used to store whether the prefix must be printed; + * must point to a persistent integer initially set to 1 + * @return Returns a negative value if an error occurred, otherwise returns + * the number of characters that would have been written for a + * sufficiently large buffer, not including the terminating null + * character. If the return value is not less than line_size, it means + * that the log message was truncated to fit the buffer. + */ +int av_log_format_line2(void *ptr, int level, const char *fmt, va_list vl, + char *line, int line_size, int *print_prefix); + +/** + * Skip repeated messages, this requires the user app to use av_log() instead of + * (f)printf as the 2 would otherwise interfere and lead to + * "Last message repeated x times" messages below (f)printf messages with some + * bad luck. + * Also to receive the last, "last repeated" line if any, the user app must + * call av_log(NULL, AV_LOG_QUIET, "%s", ""); at the end + */ +#define AV_LOG_SKIP_REPEATED 1 + +/** + * Include the log severity in messages originating from codecs. + * + * Results in messages such as: + * [rawvideo @ 0xDEADBEEF] [error] encode did not produce valid pts + */ +#define AV_LOG_PRINT_LEVEL 2 + +void av_log_set_flags(int arg); +int av_log_get_flags(void); + +/** + * @} + */ + +#endif /* AVUTIL_LOG_H */ diff --git a/libs/FFmpeg/include/libavutil/lzo.h b/libs/FFmpeg/include/libavutil/lzo.h new file mode 100644 index 0000000..c034039 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/lzo.h @@ -0,0 +1,66 @@ +/* + * LZO 1x decompression + * copyright (c) 2006 Reimar Doeffinger + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_LZO_H +#define AVUTIL_LZO_H + +/** + * @defgroup lavu_lzo LZO + * @ingroup lavu_crypto + * + * @{ + */ + +#include + +/** @name Error flags returned by av_lzo1x_decode + * @{ */ +/// end of the input buffer reached before decoding finished +#define AV_LZO_INPUT_DEPLETED 1 +/// decoded data did not fit into output buffer +#define AV_LZO_OUTPUT_FULL 2 +/// a reference to previously decoded data was wrong +#define AV_LZO_INVALID_BACKPTR 4 +/// a non-specific error in the compressed bitstream +#define AV_LZO_ERROR 8 +/** @} */ + +#define AV_LZO_INPUT_PADDING 8 +#define AV_LZO_OUTPUT_PADDING 12 + +/** + * @brief Decodes LZO 1x compressed data. + * @param out output buffer + * @param outlen size of output buffer, number of bytes left are returned here + * @param in input buffer + * @param inlen size of input buffer, number of bytes left are returned here + * @return 0 on success, otherwise a combination of the error flags above + * + * Make sure all buffers are appropriately padded, in must provide + * AV_LZO_INPUT_PADDING, out must provide AV_LZO_OUTPUT_PADDING additional bytes. + */ +int av_lzo1x_decode(void *out, int *outlen, const void *in, int *inlen); + +/** + * @} + */ + +#endif /* AVUTIL_LZO_H */ diff --git a/libs/FFmpeg/include/libavutil/macros.h b/libs/FFmpeg/include/libavutil/macros.h new file mode 100644 index 0000000..2a7567c --- /dev/null +++ b/libs/FFmpeg/include/libavutil/macros.h @@ -0,0 +1,80 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu + * Utility Preprocessor macros + */ + +#ifndef AVUTIL_MACROS_H +#define AVUTIL_MACROS_H + +#include "libavutil/avconfig.h" + +#if AV_HAVE_BIGENDIAN +# define AV_NE(be, le) (be) +#else +# define AV_NE(be, le) (le) +#endif + +/** + * Comparator. + * For two numerical expressions x and y, gives 1 if x > y, -1 if x < y, and 0 + * if x == y. This is useful for instance in a qsort comparator callback. + * Furthermore, compilers are able to optimize this to branchless code, and + * there is no risk of overflow with signed types. + * As with many macros, this evaluates its argument multiple times, it thus + * must not have a side-effect. + */ +#define FFDIFFSIGN(x,y) (((x)>(y)) - ((x)<(y))) + +#define FFMAX(a,b) ((a) > (b) ? (a) : (b)) +#define FFMAX3(a,b,c) FFMAX(FFMAX(a,b),c) +#define FFMIN(a,b) ((a) > (b) ? (b) : (a)) +#define FFMIN3(a,b,c) FFMIN(FFMIN(a,b),c) + +#define FFSWAP(type,a,b) do{type SWAP_tmp= b; b= a; a= SWAP_tmp;}while(0) +#define FF_ARRAY_ELEMS(a) (sizeof(a) / sizeof((a)[0])) + +#define MKTAG(a,b,c,d) ((a) | ((b) << 8) | ((c) << 16) | ((unsigned)(d) << 24)) +#define MKBETAG(a,b,c,d) ((d) | ((c) << 8) | ((b) << 16) | ((unsigned)(a) << 24)) + +/** + * @addtogroup preproc_misc Preprocessor String Macros + * + * String manipulation macros + * + * @{ + */ + +#define AV_STRINGIFY(s) AV_TOSTRING(s) +#define AV_TOSTRING(s) #s + +#define AV_GLUE(a, b) a ## b +#define AV_JOIN(a, b) AV_GLUE(a, b) + +/** + * @} + */ + +#define AV_PRAGMA(s) _Pragma(#s) + +#define FFALIGN(x, a) (((x)+(a)-1)&~((a)-1)) + +#endif /* AVUTIL_MACROS_H */ diff --git a/libs/FFmpeg/include/libavutil/mastering_display_metadata.h b/libs/FFmpeg/include/libavutil/mastering_display_metadata.h new file mode 100644 index 0000000..c23b07c --- /dev/null +++ b/libs/FFmpeg/include/libavutil/mastering_display_metadata.h @@ -0,0 +1,128 @@ +/* + * Copyright (c) 2016 Neil Birkbeck + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_MASTERING_DISPLAY_METADATA_H +#define AVUTIL_MASTERING_DISPLAY_METADATA_H + +#include "frame.h" +#include "rational.h" + + +/** + * Mastering display metadata capable of representing the color volume of + * the display used to master the content (SMPTE 2086:2014). + * + * To be used as payload of a AVFrameSideData or AVPacketSideData with the + * appropriate type. + * + * @note The struct should be allocated with av_mastering_display_metadata_alloc() + * and its size is not a part of the public ABI. + */ +typedef struct AVMasteringDisplayMetadata { + /** + * CIE 1931 xy chromaticity coords of color primaries (r, g, b order). + */ + AVRational display_primaries[3][2]; + + /** + * CIE 1931 xy chromaticity coords of white point. + */ + AVRational white_point[2]; + + /** + * Min luminance of mastering display (cd/m^2). + */ + AVRational min_luminance; + + /** + * Max luminance of mastering display (cd/m^2). + */ + AVRational max_luminance; + + /** + * Flag indicating whether the display primaries (and white point) are set. + */ + int has_primaries; + + /** + * Flag indicating whether the luminance (min_ and max_) have been set. + */ + int has_luminance; + +} AVMasteringDisplayMetadata; + +/** + * Allocate an AVMasteringDisplayMetadata structure and set its fields to + * default values. The resulting struct can be freed using av_freep(). + * + * @return An AVMasteringDisplayMetadata filled with default values or NULL + * on failure. + */ +AVMasteringDisplayMetadata *av_mastering_display_metadata_alloc(void); + +/** + * Allocate a complete AVMasteringDisplayMetadata and add it to the frame. + * + * @param frame The frame which side data is added to. + * + * @return The AVMasteringDisplayMetadata structure to be filled by caller. + */ +AVMasteringDisplayMetadata *av_mastering_display_metadata_create_side_data(AVFrame *frame); + +/** + * Content light level needed by to transmit HDR over HDMI (CTA-861.3). + * + * To be used as payload of a AVFrameSideData or AVPacketSideData with the + * appropriate type. + * + * @note The struct should be allocated with av_content_light_metadata_alloc() + * and its size is not a part of the public ABI. + */ +typedef struct AVContentLightMetadata { + /** + * Max content light level (cd/m^2). + */ + unsigned MaxCLL; + + /** + * Max average light level per frame (cd/m^2). + */ + unsigned MaxFALL; +} AVContentLightMetadata; + +/** + * Allocate an AVContentLightMetadata structure and set its fields to + * default values. The resulting struct can be freed using av_freep(). + * + * @return An AVContentLightMetadata filled with default values or NULL + * on failure. + */ +AVContentLightMetadata *av_content_light_metadata_alloc(size_t *size); + +/** + * Allocate a complete AVContentLightMetadata and add it to the frame. + * + * @param frame The frame which side data is added to. + * + * @return The AVContentLightMetadata structure to be filled by caller. + */ +AVContentLightMetadata *av_content_light_metadata_create_side_data(AVFrame *frame); + +#endif /* AVUTIL_MASTERING_DISPLAY_METADATA_H */ diff --git a/libs/FFmpeg/include/libavutil/mathematics.h b/libs/FFmpeg/include/libavutil/mathematics.h new file mode 100644 index 0000000..e213bab --- /dev/null +++ b/libs/FFmpeg/include/libavutil/mathematics.h @@ -0,0 +1,300 @@ +/* + * copyright (c) 2005-2012 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @addtogroup lavu_math + * Mathematical utilities for working with timestamp and time base. + */ + +#ifndef AVUTIL_MATHEMATICS_H +#define AVUTIL_MATHEMATICS_H + +#include +#include +#include "attributes.h" +#include "rational.h" +#include "intfloat.h" + +#ifndef M_E +#define M_E 2.7182818284590452354 /* e */ +#endif +#ifndef M_Ef +#define M_Ef 2.7182818284590452354f /* e */ +#endif +#ifndef M_LN2 +#define M_LN2 0.69314718055994530942 /* log_e 2 */ +#endif +#ifndef M_LN2f +#define M_LN2f 0.69314718055994530942f /* log_e 2 */ +#endif +#ifndef M_LN10 +#define M_LN10 2.30258509299404568402 /* log_e 10 */ +#endif +#ifndef M_LN10f +#define M_LN10f 2.30258509299404568402f /* log_e 10 */ +#endif +#ifndef M_LOG2_10 +#define M_LOG2_10 3.32192809488736234787 /* log_2 10 */ +#endif +#ifndef M_LOG2_10f +#define M_LOG2_10f 3.32192809488736234787f /* log_2 10 */ +#endif +#ifndef M_PHI +#define M_PHI 1.61803398874989484820 /* phi / golden ratio */ +#endif +#ifndef M_PHIf +#define M_PHIf 1.61803398874989484820f /* phi / golden ratio */ +#endif +#ifndef M_PI +#define M_PI 3.14159265358979323846 /* pi */ +#endif +#ifndef M_PIf +#define M_PIf 3.14159265358979323846f /* pi */ +#endif +#ifndef M_PI_2 +#define M_PI_2 1.57079632679489661923 /* pi/2 */ +#endif +#ifndef M_PI_2f +#define M_PI_2f 1.57079632679489661923f /* pi/2 */ +#endif +#ifndef M_PI_4 +#define M_PI_4 0.78539816339744830962 /* pi/4 */ +#endif +#ifndef M_PI_4f +#define M_PI_4f 0.78539816339744830962f /* pi/4 */ +#endif +#ifndef M_1_PI +#define M_1_PI 0.31830988618379067154 /* 1/pi */ +#endif +#ifndef M_1_PIf +#define M_1_PIf 0.31830988618379067154f /* 1/pi */ +#endif +#ifndef M_2_PI +#define M_2_PI 0.63661977236758134308 /* 2/pi */ +#endif +#ifndef M_2_PIf +#define M_2_PIf 0.63661977236758134308f /* 2/pi */ +#endif +#ifndef M_2_SQRTPI +#define M_2_SQRTPI 1.12837916709551257390 /* 2/sqrt(pi) */ +#endif +#ifndef M_2_SQRTPIf +#define M_2_SQRTPIf 1.12837916709551257390f /* 2/sqrt(pi) */ +#endif +#ifndef M_SQRT1_2 +#define M_SQRT1_2 0.70710678118654752440 /* 1/sqrt(2) */ +#endif +#ifndef M_SQRT1_2f +#define M_SQRT1_2f 0.70710678118654752440f /* 1/sqrt(2) */ +#endif +#ifndef M_SQRT2 +#define M_SQRT2 1.41421356237309504880 /* sqrt(2) */ +#endif +#ifndef M_SQRT2f +#define M_SQRT2f 1.41421356237309504880f /* sqrt(2) */ +#endif +#ifndef NAN +#define NAN av_int2float(0x7fc00000) +#endif +#ifndef INFINITY +#define INFINITY av_int2float(0x7f800000) +#endif + +/** + * @addtogroup lavu_math + * + * @{ + */ + +/** + * Rounding methods. + */ +enum AVRounding { + AV_ROUND_ZERO = 0, ///< Round toward zero. + AV_ROUND_INF = 1, ///< Round away from zero. + AV_ROUND_DOWN = 2, ///< Round toward -infinity. + AV_ROUND_UP = 3, ///< Round toward +infinity. + AV_ROUND_NEAR_INF = 5, ///< Round to nearest and halfway cases away from zero. + /** + * Flag telling rescaling functions to pass `INT64_MIN`/`MAX` through + * unchanged, avoiding special cases for #AV_NOPTS_VALUE. + * + * Unlike other values of the enumeration AVRounding, this value is a + * bitmask that must be used in conjunction with another value of the + * enumeration through a bitwise OR, in order to set behavior for normal + * cases. + * + * @code{.c} + * av_rescale_rnd(3, 1, 2, AV_ROUND_UP | AV_ROUND_PASS_MINMAX); + * // Rescaling 3: + * // Calculating 3 * 1 / 2 + * // 3 / 2 is rounded up to 2 + * // => 2 + * + * av_rescale_rnd(AV_NOPTS_VALUE, 1, 2, AV_ROUND_UP | AV_ROUND_PASS_MINMAX); + * // Rescaling AV_NOPTS_VALUE: + * // AV_NOPTS_VALUE == INT64_MIN + * // AV_NOPTS_VALUE is passed through + * // => AV_NOPTS_VALUE + * @endcode + */ + AV_ROUND_PASS_MINMAX = 8192, +}; + +/** + * Compute the greatest common divisor of two integer operands. + * + * @param a Operand + * @param b Operand + * @return GCD of a and b up to sign; if a >= 0 and b >= 0, return value is >= 0; + * if a == 0 and b == 0, returns 0. + */ +int64_t av_const av_gcd(int64_t a, int64_t b); + +/** + * Rescale a 64-bit integer with rounding to nearest. + * + * The operation is mathematically equivalent to `a * b / c`, but writing that + * directly can overflow. + * + * This function is equivalent to av_rescale_rnd() with #AV_ROUND_NEAR_INF. + * + * @see av_rescale_rnd(), av_rescale_q(), av_rescale_q_rnd() + */ +int64_t av_rescale(int64_t a, int64_t b, int64_t c) av_const; + +/** + * Rescale a 64-bit integer with specified rounding. + * + * The operation is mathematically equivalent to `a * b / c`, but writing that + * directly can overflow, and does not support different rounding methods. + * If the result is not representable then INT64_MIN is returned. + * + * @see av_rescale(), av_rescale_q(), av_rescale_q_rnd() + */ +int64_t av_rescale_rnd(int64_t a, int64_t b, int64_t c, enum AVRounding rnd) av_const; + +/** + * Rescale a 64-bit integer by 2 rational numbers. + * + * The operation is mathematically equivalent to `a * bq / cq`. + * + * This function is equivalent to av_rescale_q_rnd() with #AV_ROUND_NEAR_INF. + * + * @see av_rescale(), av_rescale_rnd(), av_rescale_q_rnd() + */ +int64_t av_rescale_q(int64_t a, AVRational bq, AVRational cq) av_const; + +/** + * Rescale a 64-bit integer by 2 rational numbers with specified rounding. + * + * The operation is mathematically equivalent to `a * bq / cq`. + * + * @see av_rescale(), av_rescale_rnd(), av_rescale_q() + */ +int64_t av_rescale_q_rnd(int64_t a, AVRational bq, AVRational cq, + enum AVRounding rnd) av_const; + +/** + * Compare two timestamps each in its own time base. + * + * @return One of the following values: + * - -1 if `ts_a` is before `ts_b` + * - 1 if `ts_a` is after `ts_b` + * - 0 if they represent the same position + * + * @warning + * The result of the function is undefined if one of the timestamps is outside + * the `int64_t` range when represented in the other's timebase. + */ +int av_compare_ts(int64_t ts_a, AVRational tb_a, int64_t ts_b, AVRational tb_b); + +/** + * Compare the remainders of two integer operands divided by a common divisor. + * + * In other words, compare the least significant `log2(mod)` bits of integers + * `a` and `b`. + * + * @code{.c} + * av_compare_mod(0x11, 0x02, 0x10) < 0 // since 0x11 % 0x10 (0x1) < 0x02 % 0x10 (0x2) + * av_compare_mod(0x11, 0x02, 0x20) > 0 // since 0x11 % 0x20 (0x11) > 0x02 % 0x20 (0x02) + * @endcode + * + * @param a Operand + * @param b Operand + * @param mod Divisor; must be a power of 2 + * @return + * - a negative value if `a % mod < b % mod` + * - a positive value if `a % mod > b % mod` + * - zero if `a % mod == b % mod` + */ +int64_t av_compare_mod(uint64_t a, uint64_t b, uint64_t mod); + +/** + * Rescale a timestamp while preserving known durations. + * + * This function is designed to be called per audio packet to scale the input + * timestamp to a different time base. Compared to a simple av_rescale_q() + * call, this function is robust against possible inconsistent frame durations. + * + * The `last` parameter is a state variable that must be preserved for all + * subsequent calls for the same stream. For the first call, `*last` should be + * initialized to #AV_NOPTS_VALUE. + * + * @param[in] in_tb Input time base + * @param[in] in_ts Input timestamp + * @param[in] fs_tb Duration time base; typically this is finer-grained + * (greater) than `in_tb` and `out_tb` + * @param[in] duration Duration till the next call to this function (i.e. + * duration of the current packet/frame) + * @param[in,out] last Pointer to a timestamp expressed in terms of + * `fs_tb`, acting as a state variable + * @param[in] out_tb Output timebase + * @return Timestamp expressed in terms of `out_tb` + * + * @note In the context of this function, "duration" is in term of samples, not + * seconds. + */ +int64_t av_rescale_delta(AVRational in_tb, int64_t in_ts, AVRational fs_tb, int duration, int64_t *last, AVRational out_tb); + +/** + * Add a value to a timestamp. + * + * This function guarantees that when the same value is repeatly added that + * no accumulation of rounding errors occurs. + * + * @param[in] ts Input timestamp + * @param[in] ts_tb Input timestamp time base + * @param[in] inc Value to be added + * @param[in] inc_tb Time base of `inc` + */ +int64_t av_add_stable(AVRational ts_tb, int64_t ts, AVRational inc_tb, int64_t inc); + +/** + * 0th order modified bessel function of the first kind. + */ +double av_bessel_i0(double x); + +/** + * @} + */ + +#endif /* AVUTIL_MATHEMATICS_H */ diff --git a/libs/FFmpeg/include/libavutil/md5.h b/libs/FFmpeg/include/libavutil/md5.h new file mode 100644 index 0000000..fc2eabd --- /dev/null +++ b/libs/FFmpeg/include/libavutil/md5.h @@ -0,0 +1,89 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_md5 + * Public header for MD5 hash function implementation. + */ + +#ifndef AVUTIL_MD5_H +#define AVUTIL_MD5_H + +#include +#include + +#include "attributes.h" + +/** + * @defgroup lavu_md5 MD5 + * @ingroup lavu_hash + * MD5 hash function implementation. + * + * @{ + */ + +extern const int av_md5_size; + +struct AVMD5; + +/** + * Allocate an AVMD5 context. + */ +struct AVMD5 *av_md5_alloc(void); + +/** + * Initialize MD5 hashing. + * + * @param ctx pointer to the function context (of size av_md5_size) + */ +void av_md5_init(struct AVMD5 *ctx); + +/** + * Update hash value. + * + * @param ctx hash function context + * @param src input data to update hash with + * @param len input data length + */ +void av_md5_update(struct AVMD5 *ctx, const uint8_t *src, size_t len); + +/** + * Finish hashing and output digest value. + * + * @param ctx hash function context + * @param dst buffer where output digest value is stored + */ +void av_md5_final(struct AVMD5 *ctx, uint8_t *dst); + +/** + * Hash an array of data. + * + * @param dst The output buffer to write the digest into + * @param src The data to hash + * @param len The length of the data, in bytes + */ +void av_md5_sum(uint8_t *dst, const uint8_t *src, size_t len); + +/** + * @} + */ + +#endif /* AVUTIL_MD5_H */ diff --git a/libs/FFmpeg/include/libavutil/mem.h b/libs/FFmpeg/include/libavutil/mem.h new file mode 100644 index 0000000..ab7648a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/mem.h @@ -0,0 +1,607 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_mem + * Memory handling functions + */ + +#ifndef AVUTIL_MEM_H +#define AVUTIL_MEM_H + +#include +#include + +#include "attributes.h" + +/** + * @addtogroup lavu_mem + * Utilities for manipulating memory. + * + * FFmpeg has several applications of memory that are not required of a typical + * program. For example, the computing-heavy components like video decoding and + * encoding can be sped up significantly through the use of aligned memory. + * + * However, for each of FFmpeg's applications of memory, there might not be a + * recognized or standardized API for that specific use. Memory alignment, for + * instance, varies wildly depending on operating systems, architectures, and + * compilers. Hence, this component of @ref libavutil is created to make + * dealing with memory consistently possible on all platforms. + * + * @{ + */ + +/** + * @defgroup lavu_mem_attrs Function Attributes + * Function attributes applicable to memory handling functions. + * + * These function attributes can help compilers emit more useful warnings, or + * generate better code. + * @{ + */ + +/** + * @def av_malloc_attrib + * Function attribute denoting a malloc-like function. + * + * @see Function attribute `malloc` in GCC's documentation + */ + +#if AV_GCC_VERSION_AT_LEAST(3,1) + #define av_malloc_attrib __attribute__((__malloc__)) +#else + #define av_malloc_attrib +#endif + +/** + * @def av_alloc_size(...) + * Function attribute used on a function that allocates memory, whose size is + * given by the specified parameter(s). + * + * @code{.c} + * void *av_malloc(size_t size) av_alloc_size(1); + * void *av_calloc(size_t nmemb, size_t size) av_alloc_size(1, 2); + * @endcode + * + * @param ... One or two parameter indexes, separated by a comma + * + * @see Function attribute `alloc_size` in GCC's documentation + */ + +#if AV_GCC_VERSION_AT_LEAST(4,3) + #define av_alloc_size(...) __attribute__((alloc_size(__VA_ARGS__))) +#else + #define av_alloc_size(...) +#endif + +/** + * @} + */ + +/** + * @defgroup lavu_mem_funcs Heap Management + * Functions responsible for allocating, freeing, and copying memory. + * + * All memory allocation functions have a built-in upper limit of `INT_MAX` + * bytes. This may be changed with av_max_alloc(), although exercise extreme + * caution when doing so. + * + * @{ + */ + +/** + * Allocate a memory block with alignment suitable for all memory accesses + * (including vectors if available on the CPU). + * + * @param size Size in bytes for the memory block to be allocated + * @return Pointer to the allocated block, or `NULL` if the block cannot + * be allocated + * @see av_mallocz() + */ +void *av_malloc(size_t size) av_malloc_attrib av_alloc_size(1); + +/** + * Allocate a memory block with alignment suitable for all memory accesses + * (including vectors if available on the CPU) and zero all the bytes of the + * block. + * + * @param size Size in bytes for the memory block to be allocated + * @return Pointer to the allocated block, or `NULL` if it cannot be allocated + * @see av_malloc() + */ +void *av_mallocz(size_t size) av_malloc_attrib av_alloc_size(1); + +/** + * Allocate a memory block for an array with av_malloc(). + * + * The allocated memory will have size `size * nmemb` bytes. + * + * @param nmemb Number of element + * @param size Size of a single element + * @return Pointer to the allocated block, or `NULL` if the block cannot + * be allocated + * @see av_malloc() + */ +av_alloc_size(1, 2) void *av_malloc_array(size_t nmemb, size_t size); + +/** + * Allocate a memory block for an array with av_mallocz(). + * + * The allocated memory will have size `size * nmemb` bytes. + * + * @param nmemb Number of elements + * @param size Size of the single element + * @return Pointer to the allocated block, or `NULL` if the block cannot + * be allocated + * + * @see av_mallocz() + * @see av_malloc_array() + */ +void *av_calloc(size_t nmemb, size_t size) av_malloc_attrib av_alloc_size(1, 2); + +/** + * Allocate, reallocate, or free a block of memory. + * + * If `ptr` is `NULL` and `size` > 0, allocate a new block. Otherwise, expand or + * shrink that block of memory according to `size`. + * + * @param ptr Pointer to a memory block already allocated with + * av_realloc() or `NULL` + * @param size Size in bytes of the memory block to be allocated or + * reallocated + * + * @return Pointer to a newly-reallocated block or `NULL` if the block + * cannot be reallocated + * + * @warning Unlike av_malloc(), the returned pointer is not guaranteed to be + * correctly aligned. The returned pointer must be freed after even + * if size is zero. + * @see av_fast_realloc() + * @see av_reallocp() + */ +void *av_realloc(void *ptr, size_t size) av_alloc_size(2); + +/** + * Allocate, reallocate, or free a block of memory through a pointer to a + * pointer. + * + * If `*ptr` is `NULL` and `size` > 0, allocate a new block. If `size` is + * zero, free the memory block pointed to by `*ptr`. Otherwise, expand or + * shrink that block of memory according to `size`. + * + * @param[in,out] ptr Pointer to a pointer to a memory block already allocated + * with av_realloc(), or a pointer to `NULL`. The pointer + * is updated on success, or freed on failure. + * @param[in] size Size in bytes for the memory block to be allocated or + * reallocated + * + * @return Zero on success, an AVERROR error code on failure + * + * @warning Unlike av_malloc(), the allocated memory is not guaranteed to be + * correctly aligned. + */ +av_warn_unused_result +int av_reallocp(void *ptr, size_t size); + +/** + * Allocate, reallocate, or free a block of memory. + * + * This function does the same thing as av_realloc(), except: + * - It takes two size arguments and allocates `nelem * elsize` bytes, + * after checking the result of the multiplication for integer overflow. + * - It frees the input block in case of failure, thus avoiding the memory + * leak with the classic + * @code{.c} + * buf = realloc(buf); + * if (!buf) + * return -1; + * @endcode + * pattern. + */ +void *av_realloc_f(void *ptr, size_t nelem, size_t elsize); + +/** + * Allocate, reallocate, or free an array. + * + * If `ptr` is `NULL` and `nmemb` > 0, allocate a new block. + * + * @param ptr Pointer to a memory block already allocated with + * av_realloc() or `NULL` + * @param nmemb Number of elements in the array + * @param size Size of the single element of the array + * + * @return Pointer to a newly-reallocated block or NULL if the block + * cannot be reallocated + * + * @warning Unlike av_malloc(), the allocated memory is not guaranteed to be + * correctly aligned. The returned pointer must be freed after even if + * nmemb is zero. + * @see av_reallocp_array() + */ +av_alloc_size(2, 3) void *av_realloc_array(void *ptr, size_t nmemb, size_t size); + +/** + * Allocate, reallocate an array through a pointer to a pointer. + * + * If `*ptr` is `NULL` and `nmemb` > 0, allocate a new block. + * + * @param[in,out] ptr Pointer to a pointer to a memory block already + * allocated with av_realloc(), or a pointer to `NULL`. + * The pointer is updated on success, or freed on failure. + * @param[in] nmemb Number of elements + * @param[in] size Size of the single element + * + * @return Zero on success, an AVERROR error code on failure + * + * @warning Unlike av_malloc(), the allocated memory is not guaranteed to be + * correctly aligned. *ptr must be freed after even if nmemb is zero. + */ +int av_reallocp_array(void *ptr, size_t nmemb, size_t size); + +/** + * Reallocate the given buffer if it is not large enough, otherwise do nothing. + * + * If the given buffer is `NULL`, then a new uninitialized buffer is allocated. + * + * If the given buffer is not large enough, and reallocation fails, `NULL` is + * returned and `*size` is set to 0, but the original buffer is not changed or + * freed. + * + * A typical use pattern follows: + * + * @code{.c} + * uint8_t *buf = ...; + * uint8_t *new_buf = av_fast_realloc(buf, ¤t_size, size_needed); + * if (!new_buf) { + * // Allocation failed; clean up original buffer + * av_freep(&buf); + * return AVERROR(ENOMEM); + * } + * @endcode + * + * @param[in,out] ptr Already allocated buffer, or `NULL` + * @param[in,out] size Pointer to the size of buffer `ptr`. `*size` is + * updated to the new allocated size, in particular 0 + * in case of failure. + * @param[in] min_size Desired minimal size of buffer `ptr` + * @return `ptr` if the buffer is large enough, a pointer to newly reallocated + * buffer if the buffer was not large enough, or `NULL` in case of + * error + * @see av_realloc() + * @see av_fast_malloc() + */ +void *av_fast_realloc(void *ptr, unsigned int *size, size_t min_size); + +/** + * Allocate a buffer, reusing the given one if large enough. + * + * Contrary to av_fast_realloc(), the current buffer contents might not be + * preserved and on error the old buffer is freed, thus no special handling to + * avoid memleaks is necessary. + * + * `*ptr` is allowed to be `NULL`, in which case allocation always happens if + * `size_needed` is greater than 0. + * + * @code{.c} + * uint8_t *buf = ...; + * av_fast_malloc(&buf, ¤t_size, size_needed); + * if (!buf) { + * // Allocation failed; buf already freed + * return AVERROR(ENOMEM); + * } + * @endcode + * + * @param[in,out] ptr Pointer to pointer to an already allocated buffer. + * `*ptr` will be overwritten with pointer to new + * buffer on success or `NULL` on failure + * @param[in,out] size Pointer to the size of buffer `*ptr`. `*size` is + * updated to the new allocated size, in particular 0 + * in case of failure. + * @param[in] min_size Desired minimal size of buffer `*ptr` + * @see av_realloc() + * @see av_fast_mallocz() + */ +void av_fast_malloc(void *ptr, unsigned int *size, size_t min_size); + +/** + * Allocate and clear a buffer, reusing the given one if large enough. + * + * Like av_fast_malloc(), but all newly allocated space is initially cleared. + * Reused buffer is not cleared. + * + * `*ptr` is allowed to be `NULL`, in which case allocation always happens if + * `size_needed` is greater than 0. + * + * @param[in,out] ptr Pointer to pointer to an already allocated buffer. + * `*ptr` will be overwritten with pointer to new + * buffer on success or `NULL` on failure + * @param[in,out] size Pointer to the size of buffer `*ptr`. `*size` is + * updated to the new allocated size, in particular 0 + * in case of failure. + * @param[in] min_size Desired minimal size of buffer `*ptr` + * @see av_fast_malloc() + */ +void av_fast_mallocz(void *ptr, unsigned int *size, size_t min_size); + +/** + * Free a memory block which has been allocated with a function of av_malloc() + * or av_realloc() family. + * + * @param ptr Pointer to the memory block which should be freed. + * + * @note `ptr = NULL` is explicitly allowed. + * @note It is recommended that you use av_freep() instead, to prevent leaving + * behind dangling pointers. + * @see av_freep() + */ +void av_free(void *ptr); + +/** + * Free a memory block which has been allocated with a function of av_malloc() + * or av_realloc() family, and set the pointer pointing to it to `NULL`. + * + * @code{.c} + * uint8_t *buf = av_malloc(16); + * av_free(buf); + * // buf now contains a dangling pointer to freed memory, and accidental + * // dereference of buf will result in a use-after-free, which may be a + * // security risk. + * + * uint8_t *buf = av_malloc(16); + * av_freep(&buf); + * // buf is now NULL, and accidental dereference will only result in a + * // NULL-pointer dereference. + * @endcode + * + * @param ptr Pointer to the pointer to the memory block which should be freed + * @note `*ptr = NULL` is safe and leads to no action. + * @see av_free() + */ +void av_freep(void *ptr); + +/** + * Duplicate a string. + * + * @param s String to be duplicated + * @return Pointer to a newly-allocated string containing a + * copy of `s` or `NULL` if the string cannot be allocated + * @see av_strndup() + */ +char *av_strdup(const char *s) av_malloc_attrib; + +/** + * Duplicate a substring of a string. + * + * @param s String to be duplicated + * @param len Maximum length of the resulting string (not counting the + * terminating byte) + * @return Pointer to a newly-allocated string containing a + * substring of `s` or `NULL` if the string cannot be allocated + */ +char *av_strndup(const char *s, size_t len) av_malloc_attrib; + +/** + * Duplicate a buffer with av_malloc(). + * + * @param p Buffer to be duplicated + * @param size Size in bytes of the buffer copied + * @return Pointer to a newly allocated buffer containing a + * copy of `p` or `NULL` if the buffer cannot be allocated + */ +void *av_memdup(const void *p, size_t size); + +/** + * Overlapping memcpy() implementation. + * + * @param dst Destination buffer + * @param back Number of bytes back to start copying (i.e. the initial size of + * the overlapping window); must be > 0 + * @param cnt Number of bytes to copy; must be >= 0 + * + * @note `cnt > back` is valid, this will copy the bytes we just copied, + * thus creating a repeating pattern with a period length of `back`. + */ +void av_memcpy_backptr(uint8_t *dst, int back, int cnt); + +/** + * @} + */ + +/** + * @defgroup lavu_mem_dynarray Dynamic Array + * + * Utilities to make an array grow when needed. + * + * Sometimes, the programmer would want to have an array that can grow when + * needed. The libavutil dynamic array utilities fill that need. + * + * libavutil supports two systems of appending elements onto a dynamically + * allocated array, the first one storing the pointer to the value in the + * array, and the second storing the value directly. In both systems, the + * caller is responsible for maintaining a variable containing the length of + * the array, as well as freeing of the array after use. + * + * The first system stores pointers to values in a block of dynamically + * allocated memory. Since only pointers are stored, the function does not need + * to know the size of the type. Both av_dynarray_add() and + * av_dynarray_add_nofree() implement this system. + * + * @code + * type **array = NULL; //< an array of pointers to values + * int nb = 0; //< a variable to keep track of the length of the array + * + * type to_be_added = ...; + * type to_be_added2 = ...; + * + * av_dynarray_add(&array, &nb, &to_be_added); + * if (nb == 0) + * return AVERROR(ENOMEM); + * + * av_dynarray_add(&array, &nb, &to_be_added2); + * if (nb == 0) + * return AVERROR(ENOMEM); + * + * // Now: + * // nb == 2 + * // &to_be_added == array[0] + * // &to_be_added2 == array[1] + * + * av_freep(&array); + * @endcode + * + * The second system stores the value directly in a block of memory. As a + * result, the function has to know the size of the type. av_dynarray2_add() + * implements this mechanism. + * + * @code + * type *array = NULL; //< an array of values + * int nb = 0; //< a variable to keep track of the length of the array + * + * type to_be_added = ...; + * type to_be_added2 = ...; + * + * type *addr = av_dynarray2_add((void **)&array, &nb, sizeof(*array), NULL); + * if (!addr) + * return AVERROR(ENOMEM); + * memcpy(addr, &to_be_added, sizeof(to_be_added)); + * + * // Shortcut of the above. + * type *addr = av_dynarray2_add((void **)&array, &nb, sizeof(*array), + * (const void *)&to_be_added2); + * if (!addr) + * return AVERROR(ENOMEM); + * + * // Now: + * // nb == 2 + * // to_be_added == array[0] + * // to_be_added2 == array[1] + * + * av_freep(&array); + * @endcode + * + * @{ + */ + +/** + * Add the pointer to an element to a dynamic array. + * + * The array to grow is supposed to be an array of pointers to + * structures, and the element to add must be a pointer to an already + * allocated structure. + * + * The array is reallocated when its size reaches powers of 2. + * Therefore, the amortized cost of adding an element is constant. + * + * In case of success, the pointer to the array is updated in order to + * point to the new grown array, and the number pointed to by `nb_ptr` + * is incremented. + * In case of failure, the array is freed, `*tab_ptr` is set to `NULL` and + * `*nb_ptr` is set to 0. + * + * @param[in,out] tab_ptr Pointer to the array to grow + * @param[in,out] nb_ptr Pointer to the number of elements in the array + * @param[in] elem Element to add + * @see av_dynarray_add_nofree(), av_dynarray2_add() + */ +void av_dynarray_add(void *tab_ptr, int *nb_ptr, void *elem); + +/** + * Add an element to a dynamic array. + * + * Function has the same functionality as av_dynarray_add(), + * but it doesn't free memory on fails. It returns error code + * instead and leave current buffer untouched. + * + * @return >=0 on success, negative otherwise + * @see av_dynarray_add(), av_dynarray2_add() + */ +av_warn_unused_result +int av_dynarray_add_nofree(void *tab_ptr, int *nb_ptr, void *elem); + +/** + * Add an element of size `elem_size` to a dynamic array. + * + * The array is reallocated when its number of elements reaches powers of 2. + * Therefore, the amortized cost of adding an element is constant. + * + * In case of success, the pointer to the array is updated in order to + * point to the new grown array, and the number pointed to by `nb_ptr` + * is incremented. + * In case of failure, the array is freed, `*tab_ptr` is set to `NULL` and + * `*nb_ptr` is set to 0. + * + * @param[in,out] tab_ptr Pointer to the array to grow + * @param[in,out] nb_ptr Pointer to the number of elements in the array + * @param[in] elem_size Size in bytes of an element in the array + * @param[in] elem_data Pointer to the data of the element to add. If + * `NULL`, the space of the newly added element is + * allocated but left uninitialized. + * + * @return Pointer to the data of the element to copy in the newly allocated + * space + * @see av_dynarray_add(), av_dynarray_add_nofree() + */ +void *av_dynarray2_add(void **tab_ptr, int *nb_ptr, size_t elem_size, + const uint8_t *elem_data); + +/** + * @} + */ + +/** + * @defgroup lavu_mem_misc Miscellaneous Functions + * + * Other functions related to memory allocation. + * + * @{ + */ + +/** + * Multiply two `size_t` values checking for overflow. + * + * @param[in] a Operand of multiplication + * @param[in] b Operand of multiplication + * @param[out] r Pointer to the result of the operation + * @return 0 on success, AVERROR(EINVAL) on overflow + */ +int av_size_mult(size_t a, size_t b, size_t *r); + +/** + * Set the maximum size that may be allocated in one block. + * + * The value specified with this function is effective for all libavutil's @ref + * lavu_mem_funcs "heap management functions." + * + * By default, the max value is defined as `INT_MAX`. + * + * @param max Value to be set as the new maximum size + * + * @warning Exercise extreme caution when using this function. Don't touch + * this if you do not understand the full consequence of doing so. + */ +void av_max_alloc(size_t max); + +/** + * @} + * @} + */ + +#endif /* AVUTIL_MEM_H */ diff --git a/libs/FFmpeg/include/libavutil/motion_vector.h b/libs/FFmpeg/include/libavutil/motion_vector.h new file mode 100644 index 0000000..ec29556 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/motion_vector.h @@ -0,0 +1,57 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_MOTION_VECTOR_H +#define AVUTIL_MOTION_VECTOR_H + +#include + +typedef struct AVMotionVector { + /** + * Where the current macroblock comes from; negative value when it comes + * from the past, positive value when it comes from the future. + * XXX: set exact relative ref frame reference instead of a +/- 1 "direction". + */ + int32_t source; + /** + * Width and height of the block. + */ + uint8_t w, h; + /** + * Absolute source position. Can be outside the frame area. + */ + int16_t src_x, src_y; + /** + * Absolute destination position. Can be outside the frame area. + */ + int16_t dst_x, dst_y; + /** + * Extra flag information. + * Currently unused. + */ + uint64_t flags; + /** + * Motion vector + * src_x = dst_x + motion_x / motion_scale + * src_y = dst_y + motion_y / motion_scale + */ + int32_t motion_x, motion_y; + uint16_t motion_scale; +} AVMotionVector; + +#endif /* AVUTIL_MOTION_VECTOR_H */ diff --git a/libs/FFmpeg/include/libavutil/murmur3.h b/libs/FFmpeg/include/libavutil/murmur3.h new file mode 100644 index 0000000..d90bc2f --- /dev/null +++ b/libs/FFmpeg/include/libavutil/murmur3.h @@ -0,0 +1,115 @@ +/* + * Copyright (C) 2013 Reimar Döffinger + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_murmur3 + * Public header for MurmurHash3 hash function implementation. + */ + +#ifndef AVUTIL_MURMUR3_H +#define AVUTIL_MURMUR3_H + +#include +#include + +/** + * @defgroup lavu_murmur3 Murmur3 + * @ingroup lavu_hash + * MurmurHash3 hash function implementation. + * + * MurmurHash3 is a non-cryptographic hash function, of which three + * incompatible versions were created by its inventor Austin Appleby: + * + * - 32-bit output + * - 128-bit output for 32-bit platforms + * - 128-bit output for 64-bit platforms + * + * FFmpeg only implements the last variant: 128-bit output designed for 64-bit + * platforms. Even though the hash function was designed for 64-bit platforms, + * the function in reality works on 32-bit systems too, only with reduced + * performance. + * + * @anchor lavu_murmur3_seedinfo + * By design, MurmurHash3 requires a seed to operate. In response to this, + * libavutil provides two functions for hash initiation, one that requires a + * seed (av_murmur3_init_seeded()) and one that uses a fixed arbitrary integer + * as the seed, and therefore does not (av_murmur3_init()). + * + * To make hashes comparable, you should provide the same seed for all calls to + * this hash function -- if you are supplying one yourself, that is. + * + * @{ + */ + +/** + * Allocate an AVMurMur3 hash context. + * + * @return Uninitialized hash context or `NULL` in case of error + */ +struct AVMurMur3 *av_murmur3_alloc(void); + +/** + * Initialize or reinitialize an AVMurMur3 hash context with a seed. + * + * @param[out] c Hash context + * @param[in] seed Random seed + * + * @see av_murmur3_init() + * @see @ref lavu_murmur3_seedinfo "Detailed description" on a discussion of + * seeds for MurmurHash3. + */ +void av_murmur3_init_seeded(struct AVMurMur3 *c, uint64_t seed); + +/** + * Initialize or reinitialize an AVMurMur3 hash context. + * + * Equivalent to av_murmur3_init_seeded() with a built-in seed. + * + * @param[out] c Hash context + * + * @see av_murmur3_init_seeded() + * @see @ref lavu_murmur3_seedinfo "Detailed description" on a discussion of + * seeds for MurmurHash3. + */ +void av_murmur3_init(struct AVMurMur3 *c); + +/** + * Update hash context with new data. + * + * @param[out] c Hash context + * @param[in] src Input data to update hash with + * @param[in] len Number of bytes to read from `src` + */ +void av_murmur3_update(struct AVMurMur3 *c, const uint8_t *src, size_t len); + +/** + * Finish hashing and output digest value. + * + * @param[in,out] c Hash context + * @param[out] dst Buffer where output digest value is stored + */ +void av_murmur3_final(struct AVMurMur3 *c, uint8_t dst[16]); + +/** + * @} + */ + +#endif /* AVUTIL_MURMUR3_H */ diff --git a/libs/FFmpeg/include/libavutil/opt.h b/libs/FFmpeg/include/libavutil/opt.h new file mode 100644 index 0000000..461b5d3 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/opt.h @@ -0,0 +1,891 @@ +/* + * AVOptions + * copyright (c) 2005 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_OPT_H +#define AVUTIL_OPT_H + +/** + * @file + * AVOptions + */ + +#include "rational.h" +#include "avutil.h" +#include "channel_layout.h" +#include "dict.h" +#include "log.h" +#include "pixfmt.h" +#include "samplefmt.h" + +/** + * @defgroup avoptions AVOptions + * @ingroup lavu_data + * @{ + * AVOptions provide a generic system to declare options on arbitrary structs + * ("objects"). An option can have a help text, a type and a range of possible + * values. Options may then be enumerated, read and written to. + * + * @section avoptions_implement Implementing AVOptions + * This section describes how to add AVOptions capabilities to a struct. + * + * All AVOptions-related information is stored in an AVClass. Therefore + * the first member of the struct should be a pointer to an AVClass describing it. + * The option field of the AVClass must be set to a NULL-terminated static array + * of AVOptions. Each AVOption must have a non-empty name, a type, a default + * value and for number-type AVOptions also a range of allowed values. It must + * also declare an offset in bytes from the start of the struct, where the field + * associated with this AVOption is located. Other fields in the AVOption struct + * should also be set when applicable, but are not required. + * + * The following example illustrates an AVOptions-enabled struct: + * @code + * typedef struct test_struct { + * const AVClass *class; + * int int_opt; + * char *str_opt; + * uint8_t *bin_opt; + * int bin_len; + * } test_struct; + * + * static const AVOption test_options[] = { + * { "test_int", "This is a test option of int type.", offsetof(test_struct, int_opt), + * AV_OPT_TYPE_INT, { .i64 = -1 }, INT_MIN, INT_MAX }, + * { "test_str", "This is a test option of string type.", offsetof(test_struct, str_opt), + * AV_OPT_TYPE_STRING }, + * { "test_bin", "This is a test option of binary type.", offsetof(test_struct, bin_opt), + * AV_OPT_TYPE_BINARY }, + * { NULL }, + * }; + * + * static const AVClass test_class = { + * .class_name = "test class", + * .item_name = av_default_item_name, + * .option = test_options, + * .version = LIBAVUTIL_VERSION_INT, + * }; + * @endcode + * + * Next, when allocating your struct, you must ensure that the AVClass pointer + * is set to the correct value. Then, av_opt_set_defaults() can be called to + * initialize defaults. After that the struct is ready to be used with the + * AVOptions API. + * + * When cleaning up, you may use the av_opt_free() function to automatically + * free all the allocated string and binary options. + * + * Continuing with the above example: + * + * @code + * test_struct *alloc_test_struct(void) + * { + * test_struct *ret = av_mallocz(sizeof(*ret)); + * ret->class = &test_class; + * av_opt_set_defaults(ret); + * return ret; + * } + * void free_test_struct(test_struct **foo) + * { + * av_opt_free(*foo); + * av_freep(foo); + * } + * @endcode + * + * @subsection avoptions_implement_nesting Nesting + * It may happen that an AVOptions-enabled struct contains another + * AVOptions-enabled struct as a member (e.g. AVCodecContext in + * libavcodec exports generic options, while its priv_data field exports + * codec-specific options). In such a case, it is possible to set up the + * parent struct to export a child's options. To do that, simply + * implement AVClass.child_next() and AVClass.child_class_iterate() in the + * parent struct's AVClass. + * Assuming that the test_struct from above now also contains a + * child_struct field: + * + * @code + * typedef struct child_struct { + * AVClass *class; + * int flags_opt; + * } child_struct; + * static const AVOption child_opts[] = { + * { "test_flags", "This is a test option of flags type.", + * offsetof(child_struct, flags_opt), AV_OPT_TYPE_FLAGS, { .i64 = 0 }, INT_MIN, INT_MAX }, + * { NULL }, + * }; + * static const AVClass child_class = { + * .class_name = "child class", + * .item_name = av_default_item_name, + * .option = child_opts, + * .version = LIBAVUTIL_VERSION_INT, + * }; + * + * void *child_next(void *obj, void *prev) + * { + * test_struct *t = obj; + * if (!prev && t->child_struct) + * return t->child_struct; + * return NULL + * } + * const AVClass child_class_iterate(void **iter) + * { + * const AVClass *c = *iter ? NULL : &child_class; + * *iter = (void*)(uintptr_t)c; + * return c; + * } + * @endcode + * Putting child_next() and child_class_iterate() as defined above into + * test_class will now make child_struct's options accessible through + * test_struct (again, proper setup as described above needs to be done on + * child_struct right after it is created). + * + * From the above example it might not be clear why both child_next() + * and child_class_iterate() are needed. The distinction is that child_next() + * iterates over actually existing objects, while child_class_iterate() + * iterates over all possible child classes. E.g. if an AVCodecContext + * was initialized to use a codec which has private options, then its + * child_next() will return AVCodecContext.priv_data and finish + * iterating. OTOH child_class_iterate() on AVCodecContext.av_class will + * iterate over all available codecs with private options. + * + * @subsection avoptions_implement_named_constants Named constants + * It is possible to create named constants for options. Simply set the unit + * field of the option the constants should apply to a string and + * create the constants themselves as options of type AV_OPT_TYPE_CONST + * with their unit field set to the same string. + * Their default_val field should contain the value of the named + * constant. + * For example, to add some named constants for the test_flags option + * above, put the following into the child_opts array: + * @code + * { "test_flags", "This is a test option of flags type.", + * offsetof(child_struct, flags_opt), AV_OPT_TYPE_FLAGS, { .i64 = 0 }, INT_MIN, INT_MAX, "test_unit" }, + * { "flag1", "This is a flag with value 16", 0, AV_OPT_TYPE_CONST, { .i64 = 16 }, 0, 0, "test_unit" }, + * @endcode + * + * @section avoptions_use Using AVOptions + * This section deals with accessing options in an AVOptions-enabled struct. + * Such structs in FFmpeg are e.g. AVCodecContext in libavcodec or + * AVFormatContext in libavformat. + * + * @subsection avoptions_use_examine Examining AVOptions + * The basic functions for examining options are av_opt_next(), which iterates + * over all options defined for one object, and av_opt_find(), which searches + * for an option with the given name. + * + * The situation is more complicated with nesting. An AVOptions-enabled struct + * may have AVOptions-enabled children. Passing the AV_OPT_SEARCH_CHILDREN flag + * to av_opt_find() will make the function search children recursively. + * + * For enumerating there are basically two cases. The first is when you want to + * get all options that may potentially exist on the struct and its children + * (e.g. when constructing documentation). In that case you should call + * av_opt_child_class_iterate() recursively on the parent struct's AVClass. The + * second case is when you have an already initialized struct with all its + * children and you want to get all options that can be actually written or read + * from it. In that case you should call av_opt_child_next() recursively (and + * av_opt_next() on each result). + * + * @subsection avoptions_use_get_set Reading and writing AVOptions + * When setting options, you often have a string read directly from the + * user. In such a case, simply passing it to av_opt_set() is enough. For + * non-string type options, av_opt_set() will parse the string according to the + * option type. + * + * Similarly av_opt_get() will read any option type and convert it to a string + * which will be returned. Do not forget that the string is allocated, so you + * have to free it with av_free(). + * + * In some cases it may be more convenient to put all options into an + * AVDictionary and call av_opt_set_dict() on it. A specific case of this + * are the format/codec open functions in lavf/lavc which take a dictionary + * filled with option as a parameter. This makes it possible to set some options + * that cannot be set otherwise, since e.g. the input file format is not known + * before the file is actually opened. + */ + +enum AVOptionType{ + AV_OPT_TYPE_FLAGS, + AV_OPT_TYPE_INT, + AV_OPT_TYPE_INT64, + AV_OPT_TYPE_DOUBLE, + AV_OPT_TYPE_FLOAT, + AV_OPT_TYPE_STRING, + AV_OPT_TYPE_RATIONAL, + AV_OPT_TYPE_BINARY, ///< offset must point to a pointer immediately followed by an int for the length + AV_OPT_TYPE_DICT, + AV_OPT_TYPE_UINT64, + AV_OPT_TYPE_CONST, + AV_OPT_TYPE_IMAGE_SIZE, ///< offset must point to two consecutive integers + AV_OPT_TYPE_PIXEL_FMT, + AV_OPT_TYPE_SAMPLE_FMT, + AV_OPT_TYPE_VIDEO_RATE, ///< offset must point to AVRational + AV_OPT_TYPE_DURATION, + AV_OPT_TYPE_COLOR, +#if FF_API_OLD_CHANNEL_LAYOUT + AV_OPT_TYPE_CHANNEL_LAYOUT, +#endif + AV_OPT_TYPE_BOOL, + AV_OPT_TYPE_CHLAYOUT, +}; + +/** + * AVOption + */ +typedef struct AVOption { + const char *name; + + /** + * short English help text + * @todo What about other languages? + */ + const char *help; + + /** + * The offset relative to the context structure where the option + * value is stored. It should be 0 for named constants. + */ + int offset; + enum AVOptionType type; + + /** + * the default value for scalar options + */ + union { + int64_t i64; + double dbl; + const char *str; + /* TODO those are unused now */ + AVRational q; + } default_val; + double min; ///< minimum valid value for the option + double max; ///< maximum valid value for the option + + int flags; +#define AV_OPT_FLAG_ENCODING_PARAM 1 ///< a generic parameter which can be set by the user for muxing or encoding +#define AV_OPT_FLAG_DECODING_PARAM 2 ///< a generic parameter which can be set by the user for demuxing or decoding +#define AV_OPT_FLAG_AUDIO_PARAM 8 +#define AV_OPT_FLAG_VIDEO_PARAM 16 +#define AV_OPT_FLAG_SUBTITLE_PARAM 32 +/** + * The option is intended for exporting values to the caller. + */ +#define AV_OPT_FLAG_EXPORT 64 +/** + * The option may not be set through the AVOptions API, only read. + * This flag only makes sense when AV_OPT_FLAG_EXPORT is also set. + */ +#define AV_OPT_FLAG_READONLY 128 +#define AV_OPT_FLAG_BSF_PARAM (1<<8) ///< a generic parameter which can be set by the user for bit stream filtering +#define AV_OPT_FLAG_RUNTIME_PARAM (1<<15) ///< a generic parameter which can be set by the user at runtime +#define AV_OPT_FLAG_FILTERING_PARAM (1<<16) ///< a generic parameter which can be set by the user for filtering +#define AV_OPT_FLAG_DEPRECATED (1<<17) ///< set if option is deprecated, users should refer to AVOption.help text for more information +#define AV_OPT_FLAG_CHILD_CONSTS (1<<18) ///< set if option constants can also reside in child objects +//FIXME think about enc-audio, ... style flags + + /** + * The logical unit to which the option belongs. Non-constant + * options and corresponding named constants share the same + * unit. May be NULL. + */ + const char *unit; +} AVOption; + +/** + * A single allowed range of values, or a single allowed value. + */ +typedef struct AVOptionRange { + const char *str; + /** + * Value range. + * For string ranges this represents the min/max length. + * For dimensions this represents the min/max pixel count or width/height in multi-component case. + */ + double value_min, value_max; + /** + * Value's component range. + * For string this represents the unicode range for chars, 0-127 limits to ASCII. + */ + double component_min, component_max; + /** + * Range flag. + * If set to 1 the struct encodes a range, if set to 0 a single value. + */ + int is_range; +} AVOptionRange; + +/** + * List of AVOptionRange structs. + */ +typedef struct AVOptionRanges { + /** + * Array of option ranges. + * + * Most of option types use just one component. + * Following describes multi-component option types: + * + * AV_OPT_TYPE_IMAGE_SIZE: + * component index 0: range of pixel count (width * height). + * component index 1: range of width. + * component index 2: range of height. + * + * @note To obtain multi-component version of this structure, user must + * provide AV_OPT_MULTI_COMPONENT_RANGE to av_opt_query_ranges or + * av_opt_query_ranges_default function. + * + * Multi-component range can be read as in following example: + * + * @code + * int range_index, component_index; + * AVOptionRanges *ranges; + * AVOptionRange *range[3]; //may require more than 3 in the future. + * av_opt_query_ranges(&ranges, obj, key, AV_OPT_MULTI_COMPONENT_RANGE); + * for (range_index = 0; range_index < ranges->nb_ranges; range_index++) { + * for (component_index = 0; component_index < ranges->nb_components; component_index++) + * range[component_index] = ranges->range[ranges->nb_ranges * component_index + range_index]; + * //do something with range here. + * } + * av_opt_freep_ranges(&ranges); + * @endcode + */ + AVOptionRange **range; + /** + * Number of ranges per component. + */ + int nb_ranges; + /** + * Number of componentes. + */ + int nb_components; +} AVOptionRanges; + +/** + * Show the obj options. + * + * @param req_flags requested flags for the options to show. Show only the + * options for which it is opt->flags & req_flags. + * @param rej_flags rejected flags for the options to show. Show only the + * options for which it is !(opt->flags & req_flags). + * @param av_log_obj log context to use for showing the options + */ +int av_opt_show2(void *obj, void *av_log_obj, int req_flags, int rej_flags); + +/** + * Set the values of all AVOption fields to their default values. + * + * @param s an AVOption-enabled struct (its first member must be a pointer to AVClass) + */ +void av_opt_set_defaults(void *s); + +/** + * Set the values of all AVOption fields to their default values. Only these + * AVOption fields for which (opt->flags & mask) == flags will have their + * default applied to s. + * + * @param s an AVOption-enabled struct (its first member must be a pointer to AVClass) + * @param mask combination of AV_OPT_FLAG_* + * @param flags combination of AV_OPT_FLAG_* + */ +void av_opt_set_defaults2(void *s, int mask, int flags); + +/** + * Parse the key/value pairs list in opts. For each key/value pair + * found, stores the value in the field in ctx that is named like the + * key. ctx must be an AVClass context, storing is done using + * AVOptions. + * + * @param opts options string to parse, may be NULL + * @param key_val_sep a 0-terminated list of characters used to + * separate key from value + * @param pairs_sep a 0-terminated list of characters used to separate + * two pairs from each other + * @return the number of successfully set key/value pairs, or a negative + * value corresponding to an AVERROR code in case of error: + * AVERROR(EINVAL) if opts cannot be parsed, + * the error code issued by av_opt_set() if a key/value pair + * cannot be set + */ +int av_set_options_string(void *ctx, const char *opts, + const char *key_val_sep, const char *pairs_sep); + +/** + * Parse the key-value pairs list in opts. For each key=value pair found, + * set the value of the corresponding option in ctx. + * + * @param ctx the AVClass object to set options on + * @param opts the options string, key-value pairs separated by a + * delimiter + * @param shorthand a NULL-terminated array of options names for shorthand + * notation: if the first field in opts has no key part, + * the key is taken from the first element of shorthand; + * then again for the second, etc., until either opts is + * finished, shorthand is finished or a named option is + * found; after that, all options must be named + * @param key_val_sep a 0-terminated list of characters used to separate + * key from value, for example '=' + * @param pairs_sep a 0-terminated list of characters used to separate + * two pairs from each other, for example ':' or ',' + * @return the number of successfully set key=value pairs, or a negative + * value corresponding to an AVERROR code in case of error: + * AVERROR(EINVAL) if opts cannot be parsed, + * the error code issued by av_set_string3() if a key/value pair + * cannot be set + * + * Options names must use only the following characters: a-z A-Z 0-9 - . / _ + * Separators must use characters distinct from option names and from each + * other. + */ +int av_opt_set_from_string(void *ctx, const char *opts, + const char *const *shorthand, + const char *key_val_sep, const char *pairs_sep); +/** + * Free all allocated objects in obj. + */ +void av_opt_free(void *obj); + +/** + * Check whether a particular flag is set in a flags field. + * + * @param field_name the name of the flag field option + * @param flag_name the name of the flag to check + * @return non-zero if the flag is set, zero if the flag isn't set, + * isn't of the right type, or the flags field doesn't exist. + */ +int av_opt_flag_is_set(void *obj, const char *field_name, const char *flag_name); + +/** + * Set all the options from a given dictionary on an object. + * + * @param obj a struct whose first element is a pointer to AVClass + * @param options options to process. This dictionary will be freed and replaced + * by a new one containing all options not found in obj. + * Of course this new dictionary needs to be freed by caller + * with av_dict_free(). + * + * @return 0 on success, a negative AVERROR if some option was found in obj, + * but could not be set. + * + * @see av_dict_copy() + */ +int av_opt_set_dict(void *obj, struct AVDictionary **options); + + +/** + * Set all the options from a given dictionary on an object. + * + * @param obj a struct whose first element is a pointer to AVClass + * @param options options to process. This dictionary will be freed and replaced + * by a new one containing all options not found in obj. + * Of course this new dictionary needs to be freed by caller + * with av_dict_free(). + * @param search_flags A combination of AV_OPT_SEARCH_*. + * + * @return 0 on success, a negative AVERROR if some option was found in obj, + * but could not be set. + * + * @see av_dict_copy() + */ +int av_opt_set_dict2(void *obj, struct AVDictionary **options, int search_flags); + +/** + * Extract a key-value pair from the beginning of a string. + * + * @param ropts pointer to the options string, will be updated to + * point to the rest of the string (one of the pairs_sep + * or the final NUL) + * @param key_val_sep a 0-terminated list of characters used to separate + * key from value, for example '=' + * @param pairs_sep a 0-terminated list of characters used to separate + * two pairs from each other, for example ':' or ',' + * @param flags flags; see the AV_OPT_FLAG_* values below + * @param rkey parsed key; must be freed using av_free() + * @param rval parsed value; must be freed using av_free() + * + * @return >=0 for success, or a negative value corresponding to an + * AVERROR code in case of error; in particular: + * AVERROR(EINVAL) if no key is present + * + */ +int av_opt_get_key_value(const char **ropts, + const char *key_val_sep, const char *pairs_sep, + unsigned flags, + char **rkey, char **rval); + +enum { + + /** + * Accept to parse a value without a key; the key will then be returned + * as NULL. + */ + AV_OPT_FLAG_IMPLICIT_KEY = 1, +}; + +/** + * @defgroup opt_eval_funcs Evaluating option strings + * @{ + * This group of functions can be used to evaluate option strings + * and get numbers out of them. They do the same thing as av_opt_set(), + * except the result is written into the caller-supplied pointer. + * + * @param obj a struct whose first element is a pointer to AVClass. + * @param o an option for which the string is to be evaluated. + * @param val string to be evaluated. + * @param *_out value of the string will be written here. + * + * @return 0 on success, a negative number on failure. + */ +int av_opt_eval_flags (void *obj, const AVOption *o, const char *val, int *flags_out); +int av_opt_eval_int (void *obj, const AVOption *o, const char *val, int *int_out); +int av_opt_eval_int64 (void *obj, const AVOption *o, const char *val, int64_t *int64_out); +int av_opt_eval_float (void *obj, const AVOption *o, const char *val, float *float_out); +int av_opt_eval_double(void *obj, const AVOption *o, const char *val, double *double_out); +int av_opt_eval_q (void *obj, const AVOption *o, const char *val, AVRational *q_out); +/** + * @} + */ + +#define AV_OPT_SEARCH_CHILDREN (1 << 0) /**< Search in possible children of the + given object first. */ +/** + * The obj passed to av_opt_find() is fake -- only a double pointer to AVClass + * instead of a required pointer to a struct containing AVClass. This is + * useful for searching for options without needing to allocate the corresponding + * object. + */ +#define AV_OPT_SEARCH_FAKE_OBJ (1 << 1) + +/** + * In av_opt_get, return NULL if the option has a pointer type and is set to NULL, + * rather than returning an empty string. + */ +#define AV_OPT_ALLOW_NULL (1 << 2) + +/** + * Allows av_opt_query_ranges and av_opt_query_ranges_default to return more than + * one component for certain option types. + * @see AVOptionRanges for details. + */ +#define AV_OPT_MULTI_COMPONENT_RANGE (1 << 12) + +/** + * Look for an option in an object. Consider only options which + * have all the specified flags set. + * + * @param[in] obj A pointer to a struct whose first element is a + * pointer to an AVClass. + * Alternatively a double pointer to an AVClass, if + * AV_OPT_SEARCH_FAKE_OBJ search flag is set. + * @param[in] name The name of the option to look for. + * @param[in] unit When searching for named constants, name of the unit + * it belongs to. + * @param opt_flags Find only options with all the specified flags set (AV_OPT_FLAG). + * @param search_flags A combination of AV_OPT_SEARCH_*. + * + * @return A pointer to the option found, or NULL if no option + * was found. + * + * @note Options found with AV_OPT_SEARCH_CHILDREN flag may not be settable + * directly with av_opt_set(). Use special calls which take an options + * AVDictionary (e.g. avformat_open_input()) to set options found with this + * flag. + */ +const AVOption *av_opt_find(void *obj, const char *name, const char *unit, + int opt_flags, int search_flags); + +/** + * Look for an option in an object. Consider only options which + * have all the specified flags set. + * + * @param[in] obj A pointer to a struct whose first element is a + * pointer to an AVClass. + * Alternatively a double pointer to an AVClass, if + * AV_OPT_SEARCH_FAKE_OBJ search flag is set. + * @param[in] name The name of the option to look for. + * @param[in] unit When searching for named constants, name of the unit + * it belongs to. + * @param opt_flags Find only options with all the specified flags set (AV_OPT_FLAG). + * @param search_flags A combination of AV_OPT_SEARCH_*. + * @param[out] target_obj if non-NULL, an object to which the option belongs will be + * written here. It may be different from obj if AV_OPT_SEARCH_CHILDREN is present + * in search_flags. This parameter is ignored if search_flags contain + * AV_OPT_SEARCH_FAKE_OBJ. + * + * @return A pointer to the option found, or NULL if no option + * was found. + */ +const AVOption *av_opt_find2(void *obj, const char *name, const char *unit, + int opt_flags, int search_flags, void **target_obj); + +/** + * Iterate over all AVOptions belonging to obj. + * + * @param obj an AVOptions-enabled struct or a double pointer to an + * AVClass describing it. + * @param prev result of the previous call to av_opt_next() on this object + * or NULL + * @return next AVOption or NULL + */ +const AVOption *av_opt_next(const void *obj, const AVOption *prev); + +/** + * Iterate over AVOptions-enabled children of obj. + * + * @param prev result of a previous call to this function or NULL + * @return next AVOptions-enabled child or NULL + */ +void *av_opt_child_next(void *obj, void *prev); + +/** + * Iterate over potential AVOptions-enabled children of parent. + * + * @param iter a pointer where iteration state is stored. + * @return AVClass corresponding to next potential child or NULL + */ +const AVClass *av_opt_child_class_iterate(const AVClass *parent, void **iter); + +/** + * @defgroup opt_set_funcs Option setting functions + * @{ + * Those functions set the field of obj with the given name to value. + * + * @param[in] obj A struct whose first element is a pointer to an AVClass. + * @param[in] name the name of the field to set + * @param[in] val The value to set. In case of av_opt_set() if the field is not + * of a string type, then the given string is parsed. + * SI postfixes and some named scalars are supported. + * If the field is of a numeric type, it has to be a numeric or named + * scalar. Behavior with more than one scalar and +- infix operators + * is undefined. + * If the field is of a flags type, it has to be a sequence of numeric + * scalars or named flags separated by '+' or '-'. Prefixing a flag + * with '+' causes it to be set without affecting the other flags; + * similarly, '-' unsets a flag. + * If the field is of a dictionary type, it has to be a ':' separated list of + * key=value parameters. Values containing ':' special characters must be + * escaped. + * @param search_flags flags passed to av_opt_find2. I.e. if AV_OPT_SEARCH_CHILDREN + * is passed here, then the option may be set on a child of obj. + * + * @return 0 if the value has been set, or an AVERROR code in case of + * error: + * AVERROR_OPTION_NOT_FOUND if no matching option exists + * AVERROR(ERANGE) if the value is out of range + * AVERROR(EINVAL) if the value is not valid + */ +int av_opt_set (void *obj, const char *name, const char *val, int search_flags); +int av_opt_set_int (void *obj, const char *name, int64_t val, int search_flags); +int av_opt_set_double (void *obj, const char *name, double val, int search_flags); +int av_opt_set_q (void *obj, const char *name, AVRational val, int search_flags); +int av_opt_set_bin (void *obj, const char *name, const uint8_t *val, int size, int search_flags); +int av_opt_set_image_size(void *obj, const char *name, int w, int h, int search_flags); +int av_opt_set_pixel_fmt (void *obj, const char *name, enum AVPixelFormat fmt, int search_flags); +int av_opt_set_sample_fmt(void *obj, const char *name, enum AVSampleFormat fmt, int search_flags); +int av_opt_set_video_rate(void *obj, const char *name, AVRational val, int search_flags); +#if FF_API_OLD_CHANNEL_LAYOUT +attribute_deprecated +int av_opt_set_channel_layout(void *obj, const char *name, int64_t ch_layout, int search_flags); +#endif +int av_opt_set_chlayout(void *obj, const char *name, const AVChannelLayout *layout, int search_flags); +/** + * @note Any old dictionary present is discarded and replaced with a copy of the new one. The + * caller still owns val is and responsible for freeing it. + */ +int av_opt_set_dict_val(void *obj, const char *name, const AVDictionary *val, int search_flags); + +/** + * Set a binary option to an integer list. + * + * @param obj AVClass object to set options on + * @param name name of the binary option + * @param val pointer to an integer list (must have the correct type with + * regard to the contents of the list) + * @param term list terminator (usually 0 or -1) + * @param flags search flags + */ +#define av_opt_set_int_list(obj, name, val, term, flags) \ + (av_int_list_length(val, term) > INT_MAX / sizeof(*(val)) ? \ + AVERROR(EINVAL) : \ + av_opt_set_bin(obj, name, (const uint8_t *)(val), \ + av_int_list_length(val, term) * sizeof(*(val)), flags)) + +/** + * @} + */ + +/** + * @defgroup opt_get_funcs Option getting functions + * @{ + * Those functions get a value of the option with the given name from an object. + * + * @param[in] obj a struct whose first element is a pointer to an AVClass. + * @param[in] name name of the option to get. + * @param[in] search_flags flags passed to av_opt_find2. I.e. if AV_OPT_SEARCH_CHILDREN + * is passed here, then the option may be found in a child of obj. + * @param[out] out_val value of the option will be written here + * @return >=0 on success, a negative error code otherwise + */ +/** + * @note the returned string will be av_malloc()ed and must be av_free()ed by the caller + * + * @note if AV_OPT_ALLOW_NULL is set in search_flags in av_opt_get, and the + * option is of type AV_OPT_TYPE_STRING, AV_OPT_TYPE_BINARY or AV_OPT_TYPE_DICT + * and is set to NULL, *out_val will be set to NULL instead of an allocated + * empty string. + */ +int av_opt_get (void *obj, const char *name, int search_flags, uint8_t **out_val); +int av_opt_get_int (void *obj, const char *name, int search_flags, int64_t *out_val); +int av_opt_get_double (void *obj, const char *name, int search_flags, double *out_val); +int av_opt_get_q (void *obj, const char *name, int search_flags, AVRational *out_val); +int av_opt_get_image_size(void *obj, const char *name, int search_flags, int *w_out, int *h_out); +int av_opt_get_pixel_fmt (void *obj, const char *name, int search_flags, enum AVPixelFormat *out_fmt); +int av_opt_get_sample_fmt(void *obj, const char *name, int search_flags, enum AVSampleFormat *out_fmt); +int av_opt_get_video_rate(void *obj, const char *name, int search_flags, AVRational *out_val); +#if FF_API_OLD_CHANNEL_LAYOUT +attribute_deprecated +int av_opt_get_channel_layout(void *obj, const char *name, int search_flags, int64_t *ch_layout); +#endif +int av_opt_get_chlayout(void *obj, const char *name, int search_flags, AVChannelLayout *layout); +/** + * @param[out] out_val The returned dictionary is a copy of the actual value and must + * be freed with av_dict_free() by the caller + */ +int av_opt_get_dict_val(void *obj, const char *name, int search_flags, AVDictionary **out_val); +/** + * @} + */ +/** + * Gets a pointer to the requested field in a struct. + * This function allows accessing a struct even when its fields are moved or + * renamed since the application making the access has been compiled, + * + * @returns a pointer to the field, it can be cast to the correct type and read + * or written to. + */ +void *av_opt_ptr(const AVClass *avclass, void *obj, const char *name); + +/** + * Free an AVOptionRanges struct and set it to NULL. + */ +void av_opt_freep_ranges(AVOptionRanges **ranges); + +/** + * Get a list of allowed ranges for the given option. + * + * The returned list may depend on other fields in obj like for example profile. + * + * @param flags is a bitmask of flags, undefined flags should not be set and should be ignored + * AV_OPT_SEARCH_FAKE_OBJ indicates that the obj is a double pointer to a AVClass instead of a full instance + * AV_OPT_MULTI_COMPONENT_RANGE indicates that function may return more than one component, @see AVOptionRanges + * + * The result must be freed with av_opt_freep_ranges. + * + * @return number of compontents returned on success, a negative errro code otherwise + */ +int av_opt_query_ranges(AVOptionRanges **, void *obj, const char *key, int flags); + +/** + * Copy options from src object into dest object. + * + * The underlying AVClass of both src and dest must coincide. The guarantee + * below does not apply if this is not fulfilled. + * + * Options that require memory allocation (e.g. string or binary) are malloc'ed in dest object. + * Original memory allocated for such options is freed unless both src and dest options points to the same memory. + * + * Even on error it is guaranteed that allocated options from src and dest + * no longer alias each other afterwards; in particular calling av_opt_free() + * on both src and dest is safe afterwards if dest has been memdup'ed from src. + * + * @param dest Object to copy from + * @param src Object to copy into + * @return 0 on success, negative on error + */ +int av_opt_copy(void *dest, const void *src); + +/** + * Get a default list of allowed ranges for the given option. + * + * This list is constructed without using the AVClass.query_ranges() callback + * and can be used as fallback from within the callback. + * + * @param flags is a bitmask of flags, undefined flags should not be set and should be ignored + * AV_OPT_SEARCH_FAKE_OBJ indicates that the obj is a double pointer to a AVClass instead of a full instance + * AV_OPT_MULTI_COMPONENT_RANGE indicates that function may return more than one component, @see AVOptionRanges + * + * The result must be freed with av_opt_free_ranges. + * + * @return number of compontents returned on success, a negative errro code otherwise + */ +int av_opt_query_ranges_default(AVOptionRanges **, void *obj, const char *key, int flags); + +/** + * Check if given option is set to its default value. + * + * Options o must belong to the obj. This function must not be called to check child's options state. + * @see av_opt_is_set_to_default_by_name(). + * + * @param obj AVClass object to check option on + * @param o option to be checked + * @return >0 when option is set to its default, + * 0 when option is not set its default, + * <0 on error + */ +int av_opt_is_set_to_default(void *obj, const AVOption *o); + +/** + * Check if given option is set to its default value. + * + * @param obj AVClass object to check option on + * @param name option name + * @param search_flags combination of AV_OPT_SEARCH_* + * @return >0 when option is set to its default, + * 0 when option is not set its default, + * <0 on error + */ +int av_opt_is_set_to_default_by_name(void *obj, const char *name, int search_flags); + + +#define AV_OPT_SERIALIZE_SKIP_DEFAULTS 0x00000001 ///< Serialize options that are not set to default values only. +#define AV_OPT_SERIALIZE_OPT_FLAGS_EXACT 0x00000002 ///< Serialize options that exactly match opt_flags only. + +/** + * Serialize object's options. + * + * Create a string containing object's serialized options. + * Such string may be passed back to av_opt_set_from_string() in order to restore option values. + * A key/value or pairs separator occurring in the serialized value or + * name string are escaped through the av_escape() function. + * + * @param[in] obj AVClass object to serialize + * @param[in] opt_flags serialize options with all the specified flags set (AV_OPT_FLAG) + * @param[in] flags combination of AV_OPT_SERIALIZE_* flags + * @param[out] buffer Pointer to buffer that will be allocated with string containg serialized options. + * Buffer must be freed by the caller when is no longer needed. + * @param[in] key_val_sep character used to separate key from value + * @param[in] pairs_sep character used to separate two pairs from each other + * @return >= 0 on success, negative on error + * @warning Separators cannot be neither '\\' nor '\0'. They also cannot be the same. + */ +int av_opt_serialize(void *obj, int opt_flags, int flags, char **buffer, + const char key_val_sep, const char pairs_sep); +/** + * @} + */ + +#endif /* AVUTIL_OPT_H */ diff --git a/libs/FFmpeg/include/libavutil/parseutils.h b/libs/FFmpeg/include/libavutil/parseutils.h new file mode 100644 index 0000000..dad5c27 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/parseutils.h @@ -0,0 +1,197 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_PARSEUTILS_H +#define AVUTIL_PARSEUTILS_H + +#include + +#include "rational.h" + +/** + * @file + * misc parsing utilities + */ + +/** + * Parse str and store the parsed ratio in q. + * + * Note that a ratio with infinite (1/0) or negative value is + * considered valid, so you should check on the returned value if you + * want to exclude those values. + * + * The undefined value can be expressed using the "0:0" string. + * + * @param[in,out] q pointer to the AVRational which will contain the ratio + * @param[in] str the string to parse: it has to be a string in the format + * num:den, a float number or an expression + * @param[in] max the maximum allowed numerator and denominator + * @param[in] log_offset log level offset which is applied to the log + * level of log_ctx + * @param[in] log_ctx parent logging context + * @return >= 0 on success, a negative error code otherwise + */ +int av_parse_ratio(AVRational *q, const char *str, int max, + int log_offset, void *log_ctx); + +#define av_parse_ratio_quiet(rate, str, max) \ + av_parse_ratio(rate, str, max, AV_LOG_MAX_OFFSET, NULL) + +/** + * Parse str and put in width_ptr and height_ptr the detected values. + * + * @param[in,out] width_ptr pointer to the variable which will contain the detected + * width value + * @param[in,out] height_ptr pointer to the variable which will contain the detected + * height value + * @param[in] str the string to parse: it has to be a string in the format + * width x height or a valid video size abbreviation. + * @return >= 0 on success, a negative error code otherwise + */ +int av_parse_video_size(int *width_ptr, int *height_ptr, const char *str); + +/** + * Parse str and store the detected values in *rate. + * + * @param[in,out] rate pointer to the AVRational which will contain the detected + * frame rate + * @param[in] str the string to parse: it has to be a string in the format + * rate_num / rate_den, a float number or a valid video rate abbreviation + * @return >= 0 on success, a negative error code otherwise + */ +int av_parse_video_rate(AVRational *rate, const char *str); + +/** + * Put the RGBA values that correspond to color_string in rgba_color. + * + * @param rgba_color 4-elements array of uint8_t values, where the respective + * red, green, blue and alpha component values are written. + * @param color_string a string specifying a color. It can be the name of + * a color (case insensitive match) or a [0x|#]RRGGBB[AA] sequence, + * possibly followed by "@" and a string representing the alpha + * component. + * The alpha component may be a string composed by "0x" followed by an + * hexadecimal number or a decimal number between 0.0 and 1.0, which + * represents the opacity value (0x00/0.0 means completely transparent, + * 0xff/1.0 completely opaque). + * If the alpha component is not specified then 0xff is assumed. + * The string "random" will result in a random color. + * @param slen length of the initial part of color_string containing the + * color. It can be set to -1 if color_string is a null terminated string + * containing nothing else than the color. + * @param log_ctx a pointer to an arbitrary struct of which the first field + * is a pointer to an AVClass struct (used for av_log()). Can be NULL. + * @return >= 0 in case of success, a negative value in case of + * failure (for example if color_string cannot be parsed). + */ +int av_parse_color(uint8_t *rgba_color, const char *color_string, int slen, + void *log_ctx); + +/** + * Get the name of a color from the internal table of hard-coded named + * colors. + * + * This function is meant to enumerate the color names recognized by + * av_parse_color(). + * + * @param color_idx index of the requested color, starting from 0 + * @param rgb if not NULL, will point to a 3-elements array with the color value in RGB + * @return the color name string or NULL if color_idx is not in the array + */ +const char *av_get_known_color_name(int color_idx, const uint8_t **rgb); + +/** + * Parse timestr and return in *time a corresponding number of + * microseconds. + * + * @param timeval puts here the number of microseconds corresponding + * to the string in timestr. If the string represents a duration, it + * is the number of microseconds contained in the time interval. If + * the string is a date, is the number of microseconds since 1st of + * January, 1970 up to the time of the parsed date. If timestr cannot + * be successfully parsed, set *time to INT64_MIN. + + * @param timestr a string representing a date or a duration. + * - If a date the syntax is: + * @code + * [{YYYY-MM-DD|YYYYMMDD}[T|t| ]]{{HH:MM:SS[.m...]]]}|{HHMMSS[.m...]]]}}[Z] + * now + * @endcode + * If the value is "now" it takes the current time. + * Time is local time unless Z is appended, in which case it is + * interpreted as UTC. + * If the year-month-day part is not specified it takes the current + * year-month-day. + * - If a duration the syntax is: + * @code + * [-][HH:]MM:SS[.m...] + * [-]S+[.m...] + * @endcode + * @param duration flag which tells how to interpret timestr, if not + * zero timestr is interpreted as a duration, otherwise as a date + * @return >= 0 in case of success, a negative value corresponding to an + * AVERROR code otherwise + */ +int av_parse_time(int64_t *timeval, const char *timestr, int duration); + +/** + * Attempt to find a specific tag in a URL. + * + * syntax: '?tag1=val1&tag2=val2...'. Little URL decoding is done. + * Return 1 if found. + */ +int av_find_info_tag(char *arg, int arg_size, const char *tag1, const char *info); + +/** + * Simplified version of strptime + * + * Parse the input string p according to the format string fmt and + * store its results in the structure dt. + * This implementation supports only a subset of the formats supported + * by the standard strptime(). + * + * The supported input field descriptors are listed below. + * - `%%H`: the hour as a decimal number, using a 24-hour clock, in the + * range '00' through '23' + * - `%%J`: hours as a decimal number, in the range '0' through INT_MAX + * - `%%M`: the minute as a decimal number, using a 24-hour clock, in the + * range '00' through '59' + * - `%%S`: the second as a decimal number, using a 24-hour clock, in the + * range '00' through '59' + * - `%%Y`: the year as a decimal number, using the Gregorian calendar + * - `%%m`: the month as a decimal number, in the range '1' through '12' + * - `%%d`: the day of the month as a decimal number, in the range '1' + * through '31' + * - `%%T`: alias for `%%H:%%M:%%S` + * - `%%`: a literal `%` + * + * @return a pointer to the first character not processed in this function + * call. In case the input string contains more characters than + * required by the format string the return value points right after + * the last consumed input character. In case the whole input string + * is consumed the return value points to the null byte at the end of + * the string. On failure NULL is returned. + */ +char *av_small_strptime(const char *p, const char *fmt, struct tm *dt); + +/** + * Convert the decomposed UTC time in tm to a time_t value. + */ +time_t av_timegm(struct tm *tm); + +#endif /* AVUTIL_PARSEUTILS_H */ diff --git a/libs/FFmpeg/include/libavutil/pixdesc.h b/libs/FFmpeg/include/libavutil/pixdesc.h new file mode 100644 index 0000000..ba2f632 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/pixdesc.h @@ -0,0 +1,440 @@ +/* + * pixel format descriptor + * Copyright (c) 2009 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_PIXDESC_H +#define AVUTIL_PIXDESC_H + +#include + +#include "attributes.h" +#include "pixfmt.h" + +typedef struct AVComponentDescriptor { + /** + * Which of the 4 planes contains the component. + */ + int plane; + + /** + * Number of elements between 2 horizontally consecutive pixels. + * Elements are bits for bitstream formats, bytes otherwise. + */ + int step; + + /** + * Number of elements before the component of the first pixel. + * Elements are bits for bitstream formats, bytes otherwise. + */ + int offset; + + /** + * Number of least significant bits that must be shifted away + * to get the value. + */ + int shift; + + /** + * Number of bits in the component. + */ + int depth; +} AVComponentDescriptor; + +/** + * Descriptor that unambiguously describes how the bits of a pixel are + * stored in the up to 4 data planes of an image. It also stores the + * subsampling factors and number of components. + * + * @note This is separate of the colorspace (RGB, YCbCr, YPbPr, JPEG-style YUV + * and all the YUV variants) AVPixFmtDescriptor just stores how values + * are stored not what these values represent. + */ +typedef struct AVPixFmtDescriptor { + const char *name; + uint8_t nb_components; ///< The number of components each pixel has, (1-4) + + /** + * Amount to shift the luma width right to find the chroma width. + * For YV12 this is 1 for example. + * chroma_width = AV_CEIL_RSHIFT(luma_width, log2_chroma_w) + * The note above is needed to ensure rounding up. + * This value only refers to the chroma components. + */ + uint8_t log2_chroma_w; + + /** + * Amount to shift the luma height right to find the chroma height. + * For YV12 this is 1 for example. + * chroma_height= AV_CEIL_RSHIFT(luma_height, log2_chroma_h) + * The note above is needed to ensure rounding up. + * This value only refers to the chroma components. + */ + uint8_t log2_chroma_h; + + /** + * Combination of AV_PIX_FMT_FLAG_... flags. + */ + uint64_t flags; + + /** + * Parameters that describe how pixels are packed. + * If the format has 1 or 2 components, then luma is 0. + * If the format has 3 or 4 components: + * if the RGB flag is set then 0 is red, 1 is green and 2 is blue; + * otherwise 0 is luma, 1 is chroma-U and 2 is chroma-V. + * + * If present, the Alpha channel is always the last component. + */ + AVComponentDescriptor comp[4]; + + /** + * Alternative comma-separated names. + */ + const char *alias; +} AVPixFmtDescriptor; + +/** + * Pixel format is big-endian. + */ +#define AV_PIX_FMT_FLAG_BE (1 << 0) +/** + * Pixel format has a palette in data[1], values are indexes in this palette. + */ +#define AV_PIX_FMT_FLAG_PAL (1 << 1) +/** + * All values of a component are bit-wise packed end to end. + */ +#define AV_PIX_FMT_FLAG_BITSTREAM (1 << 2) +/** + * Pixel format is an HW accelerated format. + */ +#define AV_PIX_FMT_FLAG_HWACCEL (1 << 3) +/** + * At least one pixel component is not in the first data plane. + */ +#define AV_PIX_FMT_FLAG_PLANAR (1 << 4) +/** + * The pixel format contains RGB-like data (as opposed to YUV/grayscale). + */ +#define AV_PIX_FMT_FLAG_RGB (1 << 5) + +/** + * The pixel format has an alpha channel. This is set on all formats that + * support alpha in some way, including AV_PIX_FMT_PAL8. The alpha is always + * straight, never pre-multiplied. + * + * If a codec or a filter does not support alpha, it should set all alpha to + * opaque, or use the equivalent pixel formats without alpha component, e.g. + * AV_PIX_FMT_RGB0 (or AV_PIX_FMT_RGB24 etc.) instead of AV_PIX_FMT_RGBA. + */ +#define AV_PIX_FMT_FLAG_ALPHA (1 << 7) + +/** + * The pixel format is following a Bayer pattern + */ +#define AV_PIX_FMT_FLAG_BAYER (1 << 8) + +/** + * The pixel format contains IEEE-754 floating point values. Precision (double, + * single, or half) should be determined by the pixel size (64, 32, or 16 bits). + */ +#define AV_PIX_FMT_FLAG_FLOAT (1 << 9) + +/** + * The pixel format contains XYZ-like data (as opposed to YUV/RGB/grayscale). + */ +#define AV_PIX_FMT_FLAG_XYZ (1 << 10) + +/** + * Return the number of bits per pixel used by the pixel format + * described by pixdesc. Note that this is not the same as the number + * of bits per sample. + * + * The returned number of bits refers to the number of bits actually + * used for storing the pixel information, that is padding bits are + * not counted. + */ +int av_get_bits_per_pixel(const AVPixFmtDescriptor *pixdesc); + +/** + * Return the number of bits per pixel for the pixel format + * described by pixdesc, including any padding or unused bits. + */ +int av_get_padded_bits_per_pixel(const AVPixFmtDescriptor *pixdesc); + +/** + * @return a pixel format descriptor for provided pixel format or NULL if + * this pixel format is unknown. + */ +const AVPixFmtDescriptor *av_pix_fmt_desc_get(enum AVPixelFormat pix_fmt); + +/** + * Iterate over all pixel format descriptors known to libavutil. + * + * @param prev previous descriptor. NULL to get the first descriptor. + * + * @return next descriptor or NULL after the last descriptor + */ +const AVPixFmtDescriptor *av_pix_fmt_desc_next(const AVPixFmtDescriptor *prev); + +/** + * @return an AVPixelFormat id described by desc, or AV_PIX_FMT_NONE if desc + * is not a valid pointer to a pixel format descriptor. + */ +enum AVPixelFormat av_pix_fmt_desc_get_id(const AVPixFmtDescriptor *desc); + +/** + * Utility function to access log2_chroma_w log2_chroma_h from + * the pixel format AVPixFmtDescriptor. + * + * @param[in] pix_fmt the pixel format + * @param[out] h_shift store log2_chroma_w (horizontal/width shift) + * @param[out] v_shift store log2_chroma_h (vertical/height shift) + * + * @return 0 on success, AVERROR(ENOSYS) on invalid or unknown pixel format + */ +int av_pix_fmt_get_chroma_sub_sample(enum AVPixelFormat pix_fmt, + int *h_shift, int *v_shift); + +/** + * @return number of planes in pix_fmt, a negative AVERROR if pix_fmt is not a + * valid pixel format. + */ +int av_pix_fmt_count_planes(enum AVPixelFormat pix_fmt); + +/** + * @return the name for provided color range or NULL if unknown. + */ +const char *av_color_range_name(enum AVColorRange range); + +/** + * @return the AVColorRange value for name or an AVError if not found. + */ +int av_color_range_from_name(const char *name); + +/** + * @return the name for provided color primaries or NULL if unknown. + */ +const char *av_color_primaries_name(enum AVColorPrimaries primaries); + +/** + * @return the AVColorPrimaries value for name or an AVError if not found. + */ +int av_color_primaries_from_name(const char *name); + +/** + * @return the name for provided color transfer or NULL if unknown. + */ +const char *av_color_transfer_name(enum AVColorTransferCharacteristic transfer); + +/** + * @return the AVColorTransferCharacteristic value for name or an AVError if not found. + */ +int av_color_transfer_from_name(const char *name); + +/** + * @return the name for provided color space or NULL if unknown. + */ +const char *av_color_space_name(enum AVColorSpace space); + +/** + * @return the AVColorSpace value for name or an AVError if not found. + */ +int av_color_space_from_name(const char *name); + +/** + * @return the name for provided chroma location or NULL if unknown. + */ +const char *av_chroma_location_name(enum AVChromaLocation location); + +/** + * @return the AVChromaLocation value for name or an AVError if not found. + */ +int av_chroma_location_from_name(const char *name); + +/** + * Converts AVChromaLocation to swscale x/y chroma position. + * + * The positions represent the chroma (0,0) position in a coordinates system + * with luma (0,0) representing the origin and luma(1,1) representing 256,256 + * + * @param xpos horizontal chroma sample position + * @param ypos vertical chroma sample position + */ +int av_chroma_location_enum_to_pos(int *xpos, int *ypos, enum AVChromaLocation pos); + +/** + * Converts swscale x/y chroma position to AVChromaLocation. + * + * The positions represent the chroma (0,0) position in a coordinates system + * with luma (0,0) representing the origin and luma(1,1) representing 256,256 + * + * @param xpos horizontal chroma sample position + * @param ypos vertical chroma sample position + */ +enum AVChromaLocation av_chroma_location_pos_to_enum(int xpos, int ypos); + +/** + * Return the pixel format corresponding to name. + * + * If there is no pixel format with name name, then looks for a + * pixel format with the name corresponding to the native endian + * format of name. + * For example in a little-endian system, first looks for "gray16", + * then for "gray16le". + * + * Finally if no pixel format has been found, returns AV_PIX_FMT_NONE. + */ +enum AVPixelFormat av_get_pix_fmt(const char *name); + +/** + * Return the short name for a pixel format, NULL in case pix_fmt is + * unknown. + * + * @see av_get_pix_fmt(), av_get_pix_fmt_string() + */ +const char *av_get_pix_fmt_name(enum AVPixelFormat pix_fmt); + +/** + * Print in buf the string corresponding to the pixel format with + * number pix_fmt, or a header if pix_fmt is negative. + * + * @param buf the buffer where to write the string + * @param buf_size the size of buf + * @param pix_fmt the number of the pixel format to print the + * corresponding info string, or a negative value to print the + * corresponding header. + */ +char *av_get_pix_fmt_string(char *buf, int buf_size, + enum AVPixelFormat pix_fmt); + +/** + * Read a line from an image, and write the values of the + * pixel format component c to dst. + * + * @param data the array containing the pointers to the planes of the image + * @param linesize the array containing the linesizes of the image + * @param desc the pixel format descriptor for the image + * @param x the horizontal coordinate of the first pixel to read + * @param y the vertical coordinate of the first pixel to read + * @param w the width of the line to read, that is the number of + * values to write to dst + * @param read_pal_component if not zero and the format is a paletted + * format writes the values corresponding to the palette + * component c in data[1] to dst, rather than the palette indexes in + * data[0]. The behavior is undefined if the format is not paletted. + * @param dst_element_size size of elements in dst array (2 or 4 byte) + */ +void av_read_image_line2(void *dst, const uint8_t *data[4], + const int linesize[4], const AVPixFmtDescriptor *desc, + int x, int y, int c, int w, int read_pal_component, + int dst_element_size); + +void av_read_image_line(uint16_t *dst, const uint8_t *data[4], + const int linesize[4], const AVPixFmtDescriptor *desc, + int x, int y, int c, int w, int read_pal_component); + +/** + * Write the values from src to the pixel format component c of an + * image line. + * + * @param src array containing the values to write + * @param data the array containing the pointers to the planes of the + * image to write into. It is supposed to be zeroed. + * @param linesize the array containing the linesizes of the image + * @param desc the pixel format descriptor for the image + * @param x the horizontal coordinate of the first pixel to write + * @param y the vertical coordinate of the first pixel to write + * @param w the width of the line to write, that is the number of + * values to write to the image line + * @param src_element_size size of elements in src array (2 or 4 byte) + */ +void av_write_image_line2(const void *src, uint8_t *data[4], + const int linesize[4], const AVPixFmtDescriptor *desc, + int x, int y, int c, int w, int src_element_size); + +void av_write_image_line(const uint16_t *src, uint8_t *data[4], + const int linesize[4], const AVPixFmtDescriptor *desc, + int x, int y, int c, int w); + +/** + * Utility function to swap the endianness of a pixel format. + * + * @param[in] pix_fmt the pixel format + * + * @return pixel format with swapped endianness if it exists, + * otherwise AV_PIX_FMT_NONE + */ +enum AVPixelFormat av_pix_fmt_swap_endianness(enum AVPixelFormat pix_fmt); + +#define FF_LOSS_RESOLUTION 0x0001 /**< loss due to resolution change */ +#define FF_LOSS_DEPTH 0x0002 /**< loss due to color depth change */ +#define FF_LOSS_COLORSPACE 0x0004 /**< loss due to color space conversion */ +#define FF_LOSS_ALPHA 0x0008 /**< loss of alpha bits */ +#define FF_LOSS_COLORQUANT 0x0010 /**< loss due to color quantization */ +#define FF_LOSS_CHROMA 0x0020 /**< loss of chroma (e.g. RGB to gray conversion) */ +#define FF_LOSS_EXCESS_RESOLUTION 0x0040 /**< loss due to unneeded extra resolution */ +#define FF_LOSS_EXCESS_DEPTH 0x0080 /**< loss due to unneeded extra color depth */ + + +/** + * Compute what kind of losses will occur when converting from one specific + * pixel format to another. + * When converting from one pixel format to another, information loss may occur. + * For example, when converting from RGB24 to GRAY, the color information will + * be lost. Similarly, other losses occur when converting from some formats to + * other formats. These losses can involve loss of chroma, but also loss of + * resolution, loss of color depth, loss due to the color space conversion, loss + * of the alpha bits or loss due to color quantization. + * av_get_fix_fmt_loss() informs you about the various types of losses + * which will occur when converting from one pixel format to another. + * + * @param[in] dst_pix_fmt destination pixel format + * @param[in] src_pix_fmt source pixel format + * @param[in] has_alpha Whether the source pixel format alpha channel is used. + * @return Combination of flags informing you what kind of losses will occur + * (maximum loss for an invalid dst_pix_fmt). + */ +int av_get_pix_fmt_loss(enum AVPixelFormat dst_pix_fmt, + enum AVPixelFormat src_pix_fmt, + int has_alpha); + +/** + * Compute what kind of losses will occur when converting from one specific + * pixel format to another. + * When converting from one pixel format to another, information loss may occur. + * For example, when converting from RGB24 to GRAY, the color information will + * be lost. Similarly, other losses occur when converting from some formats to + * other formats. These losses can involve loss of chroma, but also loss of + * resolution, loss of color depth, loss due to the color space conversion, loss + * of the alpha bits or loss due to color quantization. + * av_get_fix_fmt_loss() informs you about the various types of losses + * which will occur when converting from one pixel format to another. + * + * @param[in] dst_pix_fmt destination pixel format + * @param[in] src_pix_fmt source pixel format + * @param[in] has_alpha Whether the source pixel format alpha channel is used. + * @return Combination of flags informing you what kind of losses will occur + * (maximum loss for an invalid dst_pix_fmt). + */ +enum AVPixelFormat av_find_best_pix_fmt_of_2(enum AVPixelFormat dst_pix_fmt1, enum AVPixelFormat dst_pix_fmt2, + enum AVPixelFormat src_pix_fmt, int has_alpha, int *loss_ptr); + +#endif /* AVUTIL_PIXDESC_H */ diff --git a/libs/FFmpeg/include/libavutil/pixelutils.h b/libs/FFmpeg/include/libavutil/pixelutils.h new file mode 100644 index 0000000..7a997cd --- /dev/null +++ b/libs/FFmpeg/include/libavutil/pixelutils.h @@ -0,0 +1,51 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_PIXELUTILS_H +#define AVUTIL_PIXELUTILS_H + +#include +#include + +/** + * Sum of abs(src1[x] - src2[x]) + */ +typedef int (*av_pixelutils_sad_fn)(const uint8_t *src1, ptrdiff_t stride1, + const uint8_t *src2, ptrdiff_t stride2); + +/** + * Get a potentially optimized pointer to a Sum-of-absolute-differences + * function (see the av_pixelutils_sad_fn prototype). + * + * @param w_bits 1< + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_PIXFMT_H +#define AVUTIL_PIXFMT_H + +/** + * @file + * pixel format definitions + */ + +#include "libavutil/avconfig.h" +#include "version.h" + +#define AVPALETTE_SIZE 1024 +#define AVPALETTE_COUNT 256 + +/** + * Pixel format. + * + * @note + * AV_PIX_FMT_RGB32 is handled in an endian-specific manner. An RGBA + * color is put together as: + * (A << 24) | (R << 16) | (G << 8) | B + * This is stored as BGRA on little-endian CPU architectures and ARGB on + * big-endian CPUs. + * + * @note + * If the resolution is not a multiple of the chroma subsampling factor + * then the chroma plane resolution must be rounded up. + * + * @par + * When the pixel format is palettized RGB32 (AV_PIX_FMT_PAL8), the palettized + * image data is stored in AVFrame.data[0]. The palette is transported in + * AVFrame.data[1], is 1024 bytes long (256 4-byte entries) and is + * formatted the same as in AV_PIX_FMT_RGB32 described above (i.e., it is + * also endian-specific). Note also that the individual RGB32 palette + * components stored in AVFrame.data[1] should be in the range 0..255. + * This is important as many custom PAL8 video codecs that were designed + * to run on the IBM VGA graphics adapter use 6-bit palette components. + * + * @par + * For all the 8 bits per pixel formats, an RGB32 palette is in data[1] like + * for pal8. This palette is filled in automatically by the function + * allocating the picture. + */ +enum AVPixelFormat { + AV_PIX_FMT_NONE = -1, + AV_PIX_FMT_YUV420P, ///< planar YUV 4:2:0, 12bpp, (1 Cr & Cb sample per 2x2 Y samples) + AV_PIX_FMT_YUYV422, ///< packed YUV 4:2:2, 16bpp, Y0 Cb Y1 Cr + AV_PIX_FMT_RGB24, ///< packed RGB 8:8:8, 24bpp, RGBRGB... + AV_PIX_FMT_BGR24, ///< packed RGB 8:8:8, 24bpp, BGRBGR... + AV_PIX_FMT_YUV422P, ///< planar YUV 4:2:2, 16bpp, (1 Cr & Cb sample per 2x1 Y samples) + AV_PIX_FMT_YUV444P, ///< planar YUV 4:4:4, 24bpp, (1 Cr & Cb sample per 1x1 Y samples) + AV_PIX_FMT_YUV410P, ///< planar YUV 4:1:0, 9bpp, (1 Cr & Cb sample per 4x4 Y samples) + AV_PIX_FMT_YUV411P, ///< planar YUV 4:1:1, 12bpp, (1 Cr & Cb sample per 4x1 Y samples) + AV_PIX_FMT_GRAY8, ///< Y , 8bpp + AV_PIX_FMT_MONOWHITE, ///< Y , 1bpp, 0 is white, 1 is black, in each byte pixels are ordered from the msb to the lsb + AV_PIX_FMT_MONOBLACK, ///< Y , 1bpp, 0 is black, 1 is white, in each byte pixels are ordered from the msb to the lsb + AV_PIX_FMT_PAL8, ///< 8 bits with AV_PIX_FMT_RGB32 palette + AV_PIX_FMT_YUVJ420P, ///< planar YUV 4:2:0, 12bpp, full scale (JPEG), deprecated in favor of AV_PIX_FMT_YUV420P and setting color_range + AV_PIX_FMT_YUVJ422P, ///< planar YUV 4:2:2, 16bpp, full scale (JPEG), deprecated in favor of AV_PIX_FMT_YUV422P and setting color_range + AV_PIX_FMT_YUVJ444P, ///< planar YUV 4:4:4, 24bpp, full scale (JPEG), deprecated in favor of AV_PIX_FMT_YUV444P and setting color_range + AV_PIX_FMT_UYVY422, ///< packed YUV 4:2:2, 16bpp, Cb Y0 Cr Y1 + AV_PIX_FMT_UYYVYY411, ///< packed YUV 4:1:1, 12bpp, Cb Y0 Y1 Cr Y2 Y3 + AV_PIX_FMT_BGR8, ///< packed RGB 3:3:2, 8bpp, (msb)2B 3G 3R(lsb) + AV_PIX_FMT_BGR4, ///< packed RGB 1:2:1 bitstream, 4bpp, (msb)1B 2G 1R(lsb), a byte contains two pixels, the first pixel in the byte is the one composed by the 4 msb bits + AV_PIX_FMT_BGR4_BYTE, ///< packed RGB 1:2:1, 8bpp, (msb)1B 2G 1R(lsb) + AV_PIX_FMT_RGB8, ///< packed RGB 3:3:2, 8bpp, (msb)2R 3G 3B(lsb) + AV_PIX_FMT_RGB4, ///< packed RGB 1:2:1 bitstream, 4bpp, (msb)1R 2G 1B(lsb), a byte contains two pixels, the first pixel in the byte is the one composed by the 4 msb bits + AV_PIX_FMT_RGB4_BYTE, ///< packed RGB 1:2:1, 8bpp, (msb)1R 2G 1B(lsb) + AV_PIX_FMT_NV12, ///< planar YUV 4:2:0, 12bpp, 1 plane for Y and 1 plane for the UV components, which are interleaved (first byte U and the following byte V) + AV_PIX_FMT_NV21, ///< as above, but U and V bytes are swapped + + AV_PIX_FMT_ARGB, ///< packed ARGB 8:8:8:8, 32bpp, ARGBARGB... + AV_PIX_FMT_RGBA, ///< packed RGBA 8:8:8:8, 32bpp, RGBARGBA... + AV_PIX_FMT_ABGR, ///< packed ABGR 8:8:8:8, 32bpp, ABGRABGR... + AV_PIX_FMT_BGRA, ///< packed BGRA 8:8:8:8, 32bpp, BGRABGRA... + + AV_PIX_FMT_GRAY16BE, ///< Y , 16bpp, big-endian + AV_PIX_FMT_GRAY16LE, ///< Y , 16bpp, little-endian + AV_PIX_FMT_YUV440P, ///< planar YUV 4:4:0 (1 Cr & Cb sample per 1x2 Y samples) + AV_PIX_FMT_YUVJ440P, ///< planar YUV 4:4:0 full scale (JPEG), deprecated in favor of AV_PIX_FMT_YUV440P and setting color_range + AV_PIX_FMT_YUVA420P, ///< planar YUV 4:2:0, 20bpp, (1 Cr & Cb sample per 2x2 Y & A samples) + AV_PIX_FMT_RGB48BE, ///< packed RGB 16:16:16, 48bpp, 16R, 16G, 16B, the 2-byte value for each R/G/B component is stored as big-endian + AV_PIX_FMT_RGB48LE, ///< packed RGB 16:16:16, 48bpp, 16R, 16G, 16B, the 2-byte value for each R/G/B component is stored as little-endian + + AV_PIX_FMT_RGB565BE, ///< packed RGB 5:6:5, 16bpp, (msb) 5R 6G 5B(lsb), big-endian + AV_PIX_FMT_RGB565LE, ///< packed RGB 5:6:5, 16bpp, (msb) 5R 6G 5B(lsb), little-endian + AV_PIX_FMT_RGB555BE, ///< packed RGB 5:5:5, 16bpp, (msb)1X 5R 5G 5B(lsb), big-endian , X=unused/undefined + AV_PIX_FMT_RGB555LE, ///< packed RGB 5:5:5, 16bpp, (msb)1X 5R 5G 5B(lsb), little-endian, X=unused/undefined + + AV_PIX_FMT_BGR565BE, ///< packed BGR 5:6:5, 16bpp, (msb) 5B 6G 5R(lsb), big-endian + AV_PIX_FMT_BGR565LE, ///< packed BGR 5:6:5, 16bpp, (msb) 5B 6G 5R(lsb), little-endian + AV_PIX_FMT_BGR555BE, ///< packed BGR 5:5:5, 16bpp, (msb)1X 5B 5G 5R(lsb), big-endian , X=unused/undefined + AV_PIX_FMT_BGR555LE, ///< packed BGR 5:5:5, 16bpp, (msb)1X 5B 5G 5R(lsb), little-endian, X=unused/undefined + + /** + * Hardware acceleration through VA-API, data[3] contains a + * VASurfaceID. + */ + AV_PIX_FMT_VAAPI, + + AV_PIX_FMT_YUV420P16LE, ///< planar YUV 4:2:0, 24bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian + AV_PIX_FMT_YUV420P16BE, ///< planar YUV 4:2:0, 24bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian + AV_PIX_FMT_YUV422P16LE, ///< planar YUV 4:2:2, 32bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian + AV_PIX_FMT_YUV422P16BE, ///< planar YUV 4:2:2, 32bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian + AV_PIX_FMT_YUV444P16LE, ///< planar YUV 4:4:4, 48bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian + AV_PIX_FMT_YUV444P16BE, ///< planar YUV 4:4:4, 48bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian + AV_PIX_FMT_DXVA2_VLD, ///< HW decoding through DXVA2, Picture.data[3] contains a LPDIRECT3DSURFACE9 pointer + + AV_PIX_FMT_RGB444LE, ///< packed RGB 4:4:4, 16bpp, (msb)4X 4R 4G 4B(lsb), little-endian, X=unused/undefined + AV_PIX_FMT_RGB444BE, ///< packed RGB 4:4:4, 16bpp, (msb)4X 4R 4G 4B(lsb), big-endian, X=unused/undefined + AV_PIX_FMT_BGR444LE, ///< packed BGR 4:4:4, 16bpp, (msb)4X 4B 4G 4R(lsb), little-endian, X=unused/undefined + AV_PIX_FMT_BGR444BE, ///< packed BGR 4:4:4, 16bpp, (msb)4X 4B 4G 4R(lsb), big-endian, X=unused/undefined + AV_PIX_FMT_YA8, ///< 8 bits gray, 8 bits alpha + + AV_PIX_FMT_Y400A = AV_PIX_FMT_YA8, ///< alias for AV_PIX_FMT_YA8 + AV_PIX_FMT_GRAY8A= AV_PIX_FMT_YA8, ///< alias for AV_PIX_FMT_YA8 + + AV_PIX_FMT_BGR48BE, ///< packed RGB 16:16:16, 48bpp, 16B, 16G, 16R, the 2-byte value for each R/G/B component is stored as big-endian + AV_PIX_FMT_BGR48LE, ///< packed RGB 16:16:16, 48bpp, 16B, 16G, 16R, the 2-byte value for each R/G/B component is stored as little-endian + + /** + * The following 12 formats have the disadvantage of needing 1 format for each bit depth. + * Notice that each 9/10 bits sample is stored in 16 bits with extra padding. + * If you want to support multiple bit depths, then using AV_PIX_FMT_YUV420P16* with the bpp stored separately is better. + */ + AV_PIX_FMT_YUV420P9BE, ///< planar YUV 4:2:0, 13.5bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian + AV_PIX_FMT_YUV420P9LE, ///< planar YUV 4:2:0, 13.5bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian + AV_PIX_FMT_YUV420P10BE,///< planar YUV 4:2:0, 15bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian + AV_PIX_FMT_YUV420P10LE,///< planar YUV 4:2:0, 15bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian + AV_PIX_FMT_YUV422P10BE,///< planar YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian + AV_PIX_FMT_YUV422P10LE,///< planar YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian + AV_PIX_FMT_YUV444P9BE, ///< planar YUV 4:4:4, 27bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian + AV_PIX_FMT_YUV444P9LE, ///< planar YUV 4:4:4, 27bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian + AV_PIX_FMT_YUV444P10BE,///< planar YUV 4:4:4, 30bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian + AV_PIX_FMT_YUV444P10LE,///< planar YUV 4:4:4, 30bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian + AV_PIX_FMT_YUV422P9BE, ///< planar YUV 4:2:2, 18bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian + AV_PIX_FMT_YUV422P9LE, ///< planar YUV 4:2:2, 18bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian + AV_PIX_FMT_GBRP, ///< planar GBR 4:4:4 24bpp + AV_PIX_FMT_GBR24P = AV_PIX_FMT_GBRP, // alias for #AV_PIX_FMT_GBRP + AV_PIX_FMT_GBRP9BE, ///< planar GBR 4:4:4 27bpp, big-endian + AV_PIX_FMT_GBRP9LE, ///< planar GBR 4:4:4 27bpp, little-endian + AV_PIX_FMT_GBRP10BE, ///< planar GBR 4:4:4 30bpp, big-endian + AV_PIX_FMT_GBRP10LE, ///< planar GBR 4:4:4 30bpp, little-endian + AV_PIX_FMT_GBRP16BE, ///< planar GBR 4:4:4 48bpp, big-endian + AV_PIX_FMT_GBRP16LE, ///< planar GBR 4:4:4 48bpp, little-endian + AV_PIX_FMT_YUVA422P, ///< planar YUV 4:2:2 24bpp, (1 Cr & Cb sample per 2x1 Y & A samples) + AV_PIX_FMT_YUVA444P, ///< planar YUV 4:4:4 32bpp, (1 Cr & Cb sample per 1x1 Y & A samples) + AV_PIX_FMT_YUVA420P9BE, ///< planar YUV 4:2:0 22.5bpp, (1 Cr & Cb sample per 2x2 Y & A samples), big-endian + AV_PIX_FMT_YUVA420P9LE, ///< planar YUV 4:2:0 22.5bpp, (1 Cr & Cb sample per 2x2 Y & A samples), little-endian + AV_PIX_FMT_YUVA422P9BE, ///< planar YUV 4:2:2 27bpp, (1 Cr & Cb sample per 2x1 Y & A samples), big-endian + AV_PIX_FMT_YUVA422P9LE, ///< planar YUV 4:2:2 27bpp, (1 Cr & Cb sample per 2x1 Y & A samples), little-endian + AV_PIX_FMT_YUVA444P9BE, ///< planar YUV 4:4:4 36bpp, (1 Cr & Cb sample per 1x1 Y & A samples), big-endian + AV_PIX_FMT_YUVA444P9LE, ///< planar YUV 4:4:4 36bpp, (1 Cr & Cb sample per 1x1 Y & A samples), little-endian + AV_PIX_FMT_YUVA420P10BE, ///< planar YUV 4:2:0 25bpp, (1 Cr & Cb sample per 2x2 Y & A samples, big-endian) + AV_PIX_FMT_YUVA420P10LE, ///< planar YUV 4:2:0 25bpp, (1 Cr & Cb sample per 2x2 Y & A samples, little-endian) + AV_PIX_FMT_YUVA422P10BE, ///< planar YUV 4:2:2 30bpp, (1 Cr & Cb sample per 2x1 Y & A samples, big-endian) + AV_PIX_FMT_YUVA422P10LE, ///< planar YUV 4:2:2 30bpp, (1 Cr & Cb sample per 2x1 Y & A samples, little-endian) + AV_PIX_FMT_YUVA444P10BE, ///< planar YUV 4:4:4 40bpp, (1 Cr & Cb sample per 1x1 Y & A samples, big-endian) + AV_PIX_FMT_YUVA444P10LE, ///< planar YUV 4:4:4 40bpp, (1 Cr & Cb sample per 1x1 Y & A samples, little-endian) + AV_PIX_FMT_YUVA420P16BE, ///< planar YUV 4:2:0 40bpp, (1 Cr & Cb sample per 2x2 Y & A samples, big-endian) + AV_PIX_FMT_YUVA420P16LE, ///< planar YUV 4:2:0 40bpp, (1 Cr & Cb sample per 2x2 Y & A samples, little-endian) + AV_PIX_FMT_YUVA422P16BE, ///< planar YUV 4:2:2 48bpp, (1 Cr & Cb sample per 2x1 Y & A samples, big-endian) + AV_PIX_FMT_YUVA422P16LE, ///< planar YUV 4:2:2 48bpp, (1 Cr & Cb sample per 2x1 Y & A samples, little-endian) + AV_PIX_FMT_YUVA444P16BE, ///< planar YUV 4:4:4 64bpp, (1 Cr & Cb sample per 1x1 Y & A samples, big-endian) + AV_PIX_FMT_YUVA444P16LE, ///< planar YUV 4:4:4 64bpp, (1 Cr & Cb sample per 1x1 Y & A samples, little-endian) + + AV_PIX_FMT_VDPAU, ///< HW acceleration through VDPAU, Picture.data[3] contains a VdpVideoSurface + + AV_PIX_FMT_XYZ12LE, ///< packed XYZ 4:4:4, 36 bpp, (msb) 12X, 12Y, 12Z (lsb), the 2-byte value for each X/Y/Z is stored as little-endian, the 4 lower bits are set to 0 + AV_PIX_FMT_XYZ12BE, ///< packed XYZ 4:4:4, 36 bpp, (msb) 12X, 12Y, 12Z (lsb), the 2-byte value for each X/Y/Z is stored as big-endian, the 4 lower bits are set to 0 + AV_PIX_FMT_NV16, ///< interleaved chroma YUV 4:2:2, 16bpp, (1 Cr & Cb sample per 2x1 Y samples) + AV_PIX_FMT_NV20LE, ///< interleaved chroma YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian + AV_PIX_FMT_NV20BE, ///< interleaved chroma YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian + + AV_PIX_FMT_RGBA64BE, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian + AV_PIX_FMT_RGBA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian + AV_PIX_FMT_BGRA64BE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian + AV_PIX_FMT_BGRA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian + + AV_PIX_FMT_YVYU422, ///< packed YUV 4:2:2, 16bpp, Y0 Cr Y1 Cb + + AV_PIX_FMT_YA16BE, ///< 16 bits gray, 16 bits alpha (big-endian) + AV_PIX_FMT_YA16LE, ///< 16 bits gray, 16 bits alpha (little-endian) + + AV_PIX_FMT_GBRAP, ///< planar GBRA 4:4:4:4 32bpp + AV_PIX_FMT_GBRAP16BE, ///< planar GBRA 4:4:4:4 64bpp, big-endian + AV_PIX_FMT_GBRAP16LE, ///< planar GBRA 4:4:4:4 64bpp, little-endian + /** + * HW acceleration through QSV, data[3] contains a pointer to the + * mfxFrameSurface1 structure. + * + * Before FFmpeg 5.0: + * mfxFrameSurface1.Data.MemId contains a pointer when importing + * the following frames as QSV frames: + * + * VAAPI: + * mfxFrameSurface1.Data.MemId contains a pointer to VASurfaceID + * + * DXVA2: + * mfxFrameSurface1.Data.MemId contains a pointer to IDirect3DSurface9 + * + * FFmpeg 5.0 and above: + * mfxFrameSurface1.Data.MemId contains a pointer to the mfxHDLPair + * structure when importing the following frames as QSV frames: + * + * VAAPI: + * mfxHDLPair.first contains a VASurfaceID pointer. + * mfxHDLPair.second is always MFX_INFINITE. + * + * DXVA2: + * mfxHDLPair.first contains IDirect3DSurface9 pointer. + * mfxHDLPair.second is always MFX_INFINITE. + * + * D3D11: + * mfxHDLPair.first contains a ID3D11Texture2D pointer. + * mfxHDLPair.second contains the texture array index of the frame if the + * ID3D11Texture2D is an array texture, or always MFX_INFINITE if it is a + * normal texture. + */ + AV_PIX_FMT_QSV, + /** + * HW acceleration though MMAL, data[3] contains a pointer to the + * MMAL_BUFFER_HEADER_T structure. + */ + AV_PIX_FMT_MMAL, + + AV_PIX_FMT_D3D11VA_VLD, ///< HW decoding through Direct3D11 via old API, Picture.data[3] contains a ID3D11VideoDecoderOutputView pointer + + /** + * HW acceleration through CUDA. data[i] contain CUdeviceptr pointers + * exactly as for system memory frames. + */ + AV_PIX_FMT_CUDA, + + AV_PIX_FMT_0RGB, ///< packed RGB 8:8:8, 32bpp, XRGBXRGB... X=unused/undefined + AV_PIX_FMT_RGB0, ///< packed RGB 8:8:8, 32bpp, RGBXRGBX... X=unused/undefined + AV_PIX_FMT_0BGR, ///< packed BGR 8:8:8, 32bpp, XBGRXBGR... X=unused/undefined + AV_PIX_FMT_BGR0, ///< packed BGR 8:8:8, 32bpp, BGRXBGRX... X=unused/undefined + + AV_PIX_FMT_YUV420P12BE, ///< planar YUV 4:2:0,18bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian + AV_PIX_FMT_YUV420P12LE, ///< planar YUV 4:2:0,18bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian + AV_PIX_FMT_YUV420P14BE, ///< planar YUV 4:2:0,21bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian + AV_PIX_FMT_YUV420P14LE, ///< planar YUV 4:2:0,21bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian + AV_PIX_FMT_YUV422P12BE, ///< planar YUV 4:2:2,24bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian + AV_PIX_FMT_YUV422P12LE, ///< planar YUV 4:2:2,24bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian + AV_PIX_FMT_YUV422P14BE, ///< planar YUV 4:2:2,28bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian + AV_PIX_FMT_YUV422P14LE, ///< planar YUV 4:2:2,28bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian + AV_PIX_FMT_YUV444P12BE, ///< planar YUV 4:4:4,36bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian + AV_PIX_FMT_YUV444P12LE, ///< planar YUV 4:4:4,36bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian + AV_PIX_FMT_YUV444P14BE, ///< planar YUV 4:4:4,42bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian + AV_PIX_FMT_YUV444P14LE, ///< planar YUV 4:4:4,42bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian + AV_PIX_FMT_GBRP12BE, ///< planar GBR 4:4:4 36bpp, big-endian + AV_PIX_FMT_GBRP12LE, ///< planar GBR 4:4:4 36bpp, little-endian + AV_PIX_FMT_GBRP14BE, ///< planar GBR 4:4:4 42bpp, big-endian + AV_PIX_FMT_GBRP14LE, ///< planar GBR 4:4:4 42bpp, little-endian + AV_PIX_FMT_YUVJ411P, ///< planar YUV 4:1:1, 12bpp, (1 Cr & Cb sample per 4x1 Y samples) full scale (JPEG), deprecated in favor of AV_PIX_FMT_YUV411P and setting color_range + + AV_PIX_FMT_BAYER_BGGR8, ///< bayer, BGBG..(odd line), GRGR..(even line), 8-bit samples + AV_PIX_FMT_BAYER_RGGB8, ///< bayer, RGRG..(odd line), GBGB..(even line), 8-bit samples + AV_PIX_FMT_BAYER_GBRG8, ///< bayer, GBGB..(odd line), RGRG..(even line), 8-bit samples + AV_PIX_FMT_BAYER_GRBG8, ///< bayer, GRGR..(odd line), BGBG..(even line), 8-bit samples + AV_PIX_FMT_BAYER_BGGR16LE, ///< bayer, BGBG..(odd line), GRGR..(even line), 16-bit samples, little-endian + AV_PIX_FMT_BAYER_BGGR16BE, ///< bayer, BGBG..(odd line), GRGR..(even line), 16-bit samples, big-endian + AV_PIX_FMT_BAYER_RGGB16LE, ///< bayer, RGRG..(odd line), GBGB..(even line), 16-bit samples, little-endian + AV_PIX_FMT_BAYER_RGGB16BE, ///< bayer, RGRG..(odd line), GBGB..(even line), 16-bit samples, big-endian + AV_PIX_FMT_BAYER_GBRG16LE, ///< bayer, GBGB..(odd line), RGRG..(even line), 16-bit samples, little-endian + AV_PIX_FMT_BAYER_GBRG16BE, ///< bayer, GBGB..(odd line), RGRG..(even line), 16-bit samples, big-endian + AV_PIX_FMT_BAYER_GRBG16LE, ///< bayer, GRGR..(odd line), BGBG..(even line), 16-bit samples, little-endian + AV_PIX_FMT_BAYER_GRBG16BE, ///< bayer, GRGR..(odd line), BGBG..(even line), 16-bit samples, big-endian + +#if FF_API_XVMC + AV_PIX_FMT_XVMC,///< XVideo Motion Acceleration via common packet passing +#endif + + AV_PIX_FMT_YUV440P10LE, ///< planar YUV 4:4:0,20bpp, (1 Cr & Cb sample per 1x2 Y samples), little-endian + AV_PIX_FMT_YUV440P10BE, ///< planar YUV 4:4:0,20bpp, (1 Cr & Cb sample per 1x2 Y samples), big-endian + AV_PIX_FMT_YUV440P12LE, ///< planar YUV 4:4:0,24bpp, (1 Cr & Cb sample per 1x2 Y samples), little-endian + AV_PIX_FMT_YUV440P12BE, ///< planar YUV 4:4:0,24bpp, (1 Cr & Cb sample per 1x2 Y samples), big-endian + AV_PIX_FMT_AYUV64LE, ///< packed AYUV 4:4:4,64bpp (1 Cr & Cb sample per 1x1 Y & A samples), little-endian + AV_PIX_FMT_AYUV64BE, ///< packed AYUV 4:4:4,64bpp (1 Cr & Cb sample per 1x1 Y & A samples), big-endian + + AV_PIX_FMT_VIDEOTOOLBOX, ///< hardware decoding through Videotoolbox + + AV_PIX_FMT_P010LE, ///< like NV12, with 10bpp per component, data in the high bits, zeros in the low bits, little-endian + AV_PIX_FMT_P010BE, ///< like NV12, with 10bpp per component, data in the high bits, zeros in the low bits, big-endian + + AV_PIX_FMT_GBRAP12BE, ///< planar GBR 4:4:4:4 48bpp, big-endian + AV_PIX_FMT_GBRAP12LE, ///< planar GBR 4:4:4:4 48bpp, little-endian + + AV_PIX_FMT_GBRAP10BE, ///< planar GBR 4:4:4:4 40bpp, big-endian + AV_PIX_FMT_GBRAP10LE, ///< planar GBR 4:4:4:4 40bpp, little-endian + + AV_PIX_FMT_MEDIACODEC, ///< hardware decoding through MediaCodec + + AV_PIX_FMT_GRAY12BE, ///< Y , 12bpp, big-endian + AV_PIX_FMT_GRAY12LE, ///< Y , 12bpp, little-endian + AV_PIX_FMT_GRAY10BE, ///< Y , 10bpp, big-endian + AV_PIX_FMT_GRAY10LE, ///< Y , 10bpp, little-endian + + AV_PIX_FMT_P016LE, ///< like NV12, with 16bpp per component, little-endian + AV_PIX_FMT_P016BE, ///< like NV12, with 16bpp per component, big-endian + + /** + * Hardware surfaces for Direct3D11. + * + * This is preferred over the legacy AV_PIX_FMT_D3D11VA_VLD. The new D3D11 + * hwaccel API and filtering support AV_PIX_FMT_D3D11 only. + * + * data[0] contains a ID3D11Texture2D pointer, and data[1] contains the + * texture array index of the frame as intptr_t if the ID3D11Texture2D is + * an array texture (or always 0 if it's a normal texture). + */ + AV_PIX_FMT_D3D11, + + AV_PIX_FMT_GRAY9BE, ///< Y , 9bpp, big-endian + AV_PIX_FMT_GRAY9LE, ///< Y , 9bpp, little-endian + + AV_PIX_FMT_GBRPF32BE, ///< IEEE-754 single precision planar GBR 4:4:4, 96bpp, big-endian + AV_PIX_FMT_GBRPF32LE, ///< IEEE-754 single precision planar GBR 4:4:4, 96bpp, little-endian + AV_PIX_FMT_GBRAPF32BE, ///< IEEE-754 single precision planar GBRA 4:4:4:4, 128bpp, big-endian + AV_PIX_FMT_GBRAPF32LE, ///< IEEE-754 single precision planar GBRA 4:4:4:4, 128bpp, little-endian + + /** + * DRM-managed buffers exposed through PRIME buffer sharing. + * + * data[0] points to an AVDRMFrameDescriptor. + */ + AV_PIX_FMT_DRM_PRIME, + /** + * Hardware surfaces for OpenCL. + * + * data[i] contain 2D image objects (typed in C as cl_mem, used + * in OpenCL as image2d_t) for each plane of the surface. + */ + AV_PIX_FMT_OPENCL, + + AV_PIX_FMT_GRAY14BE, ///< Y , 14bpp, big-endian + AV_PIX_FMT_GRAY14LE, ///< Y , 14bpp, little-endian + + AV_PIX_FMT_GRAYF32BE, ///< IEEE-754 single precision Y, 32bpp, big-endian + AV_PIX_FMT_GRAYF32LE, ///< IEEE-754 single precision Y, 32bpp, little-endian + + AV_PIX_FMT_YUVA422P12BE, ///< planar YUV 4:2:2,24bpp, (1 Cr & Cb sample per 2x1 Y samples), 12b alpha, big-endian + AV_PIX_FMT_YUVA422P12LE, ///< planar YUV 4:2:2,24bpp, (1 Cr & Cb sample per 2x1 Y samples), 12b alpha, little-endian + AV_PIX_FMT_YUVA444P12BE, ///< planar YUV 4:4:4,36bpp, (1 Cr & Cb sample per 1x1 Y samples), 12b alpha, big-endian + AV_PIX_FMT_YUVA444P12LE, ///< planar YUV 4:4:4,36bpp, (1 Cr & Cb sample per 1x1 Y samples), 12b alpha, little-endian + + AV_PIX_FMT_NV24, ///< planar YUV 4:4:4, 24bpp, 1 plane for Y and 1 plane for the UV components, which are interleaved (first byte U and the following byte V) + AV_PIX_FMT_NV42, ///< as above, but U and V bytes are swapped + + /** + * Vulkan hardware images. + * + * data[0] points to an AVVkFrame + */ + AV_PIX_FMT_VULKAN, + + AV_PIX_FMT_Y210BE, ///< packed YUV 4:2:2 like YUYV422, 20bpp, data in the high bits, big-endian + AV_PIX_FMT_Y210LE, ///< packed YUV 4:2:2 like YUYV422, 20bpp, data in the high bits, little-endian + + AV_PIX_FMT_X2RGB10LE, ///< packed RGB 10:10:10, 30bpp, (msb)2X 10R 10G 10B(lsb), little-endian, X=unused/undefined + AV_PIX_FMT_X2RGB10BE, ///< packed RGB 10:10:10, 30bpp, (msb)2X 10R 10G 10B(lsb), big-endian, X=unused/undefined + AV_PIX_FMT_X2BGR10LE, ///< packed BGR 10:10:10, 30bpp, (msb)2X 10B 10G 10R(lsb), little-endian, X=unused/undefined + AV_PIX_FMT_X2BGR10BE, ///< packed BGR 10:10:10, 30bpp, (msb)2X 10B 10G 10R(lsb), big-endian, X=unused/undefined + + AV_PIX_FMT_P210BE, ///< interleaved chroma YUV 4:2:2, 20bpp, data in the high bits, big-endian + AV_PIX_FMT_P210LE, ///< interleaved chroma YUV 4:2:2, 20bpp, data in the high bits, little-endian + + AV_PIX_FMT_P410BE, ///< interleaved chroma YUV 4:4:4, 30bpp, data in the high bits, big-endian + AV_PIX_FMT_P410LE, ///< interleaved chroma YUV 4:4:4, 30bpp, data in the high bits, little-endian + + AV_PIX_FMT_P216BE, ///< interleaved chroma YUV 4:2:2, 32bpp, big-endian + AV_PIX_FMT_P216LE, ///< interleaved chroma YUV 4:2:2, 32bpp, little-endian + + AV_PIX_FMT_P416BE, ///< interleaved chroma YUV 4:4:4, 48bpp, big-endian + AV_PIX_FMT_P416LE, ///< interleaved chroma YUV 4:4:4, 48bpp, little-endian + + AV_PIX_FMT_VUYA, ///< packed VUYA 4:4:4, 32bpp, VUYAVUYA... + + AV_PIX_FMT_RGBAF16BE, ///< IEEE-754 half precision packed RGBA 16:16:16:16, 64bpp, RGBARGBA..., big-endian + AV_PIX_FMT_RGBAF16LE, ///< IEEE-754 half precision packed RGBA 16:16:16:16, 64bpp, RGBARGBA..., little-endian + + AV_PIX_FMT_VUYX, ///< packed VUYX 4:4:4, 32bpp, Variant of VUYA where alpha channel is left undefined + + AV_PIX_FMT_P012LE, ///< like NV12, with 12bpp per component, data in the high bits, zeros in the low bits, little-endian + AV_PIX_FMT_P012BE, ///< like NV12, with 12bpp per component, data in the high bits, zeros in the low bits, big-endian + + AV_PIX_FMT_Y212BE, ///< packed YUV 4:2:2 like YUYV422, 24bpp, data in the high bits, zeros in the low bits, big-endian + AV_PIX_FMT_Y212LE, ///< packed YUV 4:2:2 like YUYV422, 24bpp, data in the high bits, zeros in the low bits, little-endian + + AV_PIX_FMT_XV30BE, ///< packed XVYU 4:4:4, 32bpp, (msb)2X 10V 10Y 10U(lsb), big-endian, variant of Y410 where alpha channel is left undefined + AV_PIX_FMT_XV30LE, ///< packed XVYU 4:4:4, 32bpp, (msb)2X 10V 10Y 10U(lsb), little-endian, variant of Y410 where alpha channel is left undefined + + AV_PIX_FMT_XV36BE, ///< packed XVYU 4:4:4, 48bpp, data in the high bits, zeros in the low bits, big-endian, variant of Y412 where alpha channel is left undefined + AV_PIX_FMT_XV36LE, ///< packed XVYU 4:4:4, 48bpp, data in the high bits, zeros in the low bits, little-endian, variant of Y412 where alpha channel is left undefined + + AV_PIX_FMT_RGBF32BE, ///< IEEE-754 single precision packed RGB 32:32:32, 96bpp, RGBRGB..., big-endian + AV_PIX_FMT_RGBF32LE, ///< IEEE-754 single precision packed RGB 32:32:32, 96bpp, RGBRGB..., little-endian + + AV_PIX_FMT_RGBAF32BE, ///< IEEE-754 single precision packed RGBA 32:32:32:32, 128bpp, RGBARGBA..., big-endian + AV_PIX_FMT_RGBAF32LE, ///< IEEE-754 single precision packed RGBA 32:32:32:32, 128bpp, RGBARGBA..., little-endian + + AV_PIX_FMT_P212BE, ///< interleaved chroma YUV 4:2:2, 24bpp, data in the high bits, big-endian + AV_PIX_FMT_P212LE, ///< interleaved chroma YUV 4:2:2, 24bpp, data in the high bits, little-endian + + AV_PIX_FMT_P412BE, ///< interleaved chroma YUV 4:4:4, 36bpp, data in the high bits, big-endian + AV_PIX_FMT_P412LE, ///< interleaved chroma YUV 4:4:4, 36bpp, data in the high bits, little-endian + + AV_PIX_FMT_GBRAP14BE, ///< planar GBR 4:4:4:4 56bpp, big-endian + AV_PIX_FMT_GBRAP14LE, ///< planar GBR 4:4:4:4 56bpp, little-endian + + AV_PIX_FMT_NB ///< number of pixel formats, DO NOT USE THIS if you want to link with shared libav* because the number of formats might differ between versions +}; + +#if AV_HAVE_BIGENDIAN +# define AV_PIX_FMT_NE(be, le) AV_PIX_FMT_##be +#else +# define AV_PIX_FMT_NE(be, le) AV_PIX_FMT_##le +#endif + +#define AV_PIX_FMT_RGB32 AV_PIX_FMT_NE(ARGB, BGRA) +#define AV_PIX_FMT_RGB32_1 AV_PIX_FMT_NE(RGBA, ABGR) +#define AV_PIX_FMT_BGR32 AV_PIX_FMT_NE(ABGR, RGBA) +#define AV_PIX_FMT_BGR32_1 AV_PIX_FMT_NE(BGRA, ARGB) +#define AV_PIX_FMT_0RGB32 AV_PIX_FMT_NE(0RGB, BGR0) +#define AV_PIX_FMT_0BGR32 AV_PIX_FMT_NE(0BGR, RGB0) + +#define AV_PIX_FMT_GRAY9 AV_PIX_FMT_NE(GRAY9BE, GRAY9LE) +#define AV_PIX_FMT_GRAY10 AV_PIX_FMT_NE(GRAY10BE, GRAY10LE) +#define AV_PIX_FMT_GRAY12 AV_PIX_FMT_NE(GRAY12BE, GRAY12LE) +#define AV_PIX_FMT_GRAY14 AV_PIX_FMT_NE(GRAY14BE, GRAY14LE) +#define AV_PIX_FMT_GRAY16 AV_PIX_FMT_NE(GRAY16BE, GRAY16LE) +#define AV_PIX_FMT_YA16 AV_PIX_FMT_NE(YA16BE, YA16LE) +#define AV_PIX_FMT_RGB48 AV_PIX_FMT_NE(RGB48BE, RGB48LE) +#define AV_PIX_FMT_RGB565 AV_PIX_FMT_NE(RGB565BE, RGB565LE) +#define AV_PIX_FMT_RGB555 AV_PIX_FMT_NE(RGB555BE, RGB555LE) +#define AV_PIX_FMT_RGB444 AV_PIX_FMT_NE(RGB444BE, RGB444LE) +#define AV_PIX_FMT_RGBA64 AV_PIX_FMT_NE(RGBA64BE, RGBA64LE) +#define AV_PIX_FMT_BGR48 AV_PIX_FMT_NE(BGR48BE, BGR48LE) +#define AV_PIX_FMT_BGR565 AV_PIX_FMT_NE(BGR565BE, BGR565LE) +#define AV_PIX_FMT_BGR555 AV_PIX_FMT_NE(BGR555BE, BGR555LE) +#define AV_PIX_FMT_BGR444 AV_PIX_FMT_NE(BGR444BE, BGR444LE) +#define AV_PIX_FMT_BGRA64 AV_PIX_FMT_NE(BGRA64BE, BGRA64LE) + +#define AV_PIX_FMT_YUV420P9 AV_PIX_FMT_NE(YUV420P9BE , YUV420P9LE) +#define AV_PIX_FMT_YUV422P9 AV_PIX_FMT_NE(YUV422P9BE , YUV422P9LE) +#define AV_PIX_FMT_YUV444P9 AV_PIX_FMT_NE(YUV444P9BE , YUV444P9LE) +#define AV_PIX_FMT_YUV420P10 AV_PIX_FMT_NE(YUV420P10BE, YUV420P10LE) +#define AV_PIX_FMT_YUV422P10 AV_PIX_FMT_NE(YUV422P10BE, YUV422P10LE) +#define AV_PIX_FMT_YUV440P10 AV_PIX_FMT_NE(YUV440P10BE, YUV440P10LE) +#define AV_PIX_FMT_YUV444P10 AV_PIX_FMT_NE(YUV444P10BE, YUV444P10LE) +#define AV_PIX_FMT_YUV420P12 AV_PIX_FMT_NE(YUV420P12BE, YUV420P12LE) +#define AV_PIX_FMT_YUV422P12 AV_PIX_FMT_NE(YUV422P12BE, YUV422P12LE) +#define AV_PIX_FMT_YUV440P12 AV_PIX_FMT_NE(YUV440P12BE, YUV440P12LE) +#define AV_PIX_FMT_YUV444P12 AV_PIX_FMT_NE(YUV444P12BE, YUV444P12LE) +#define AV_PIX_FMT_YUV420P14 AV_PIX_FMT_NE(YUV420P14BE, YUV420P14LE) +#define AV_PIX_FMT_YUV422P14 AV_PIX_FMT_NE(YUV422P14BE, YUV422P14LE) +#define AV_PIX_FMT_YUV444P14 AV_PIX_FMT_NE(YUV444P14BE, YUV444P14LE) +#define AV_PIX_FMT_YUV420P16 AV_PIX_FMT_NE(YUV420P16BE, YUV420P16LE) +#define AV_PIX_FMT_YUV422P16 AV_PIX_FMT_NE(YUV422P16BE, YUV422P16LE) +#define AV_PIX_FMT_YUV444P16 AV_PIX_FMT_NE(YUV444P16BE, YUV444P16LE) + +#define AV_PIX_FMT_GBRP9 AV_PIX_FMT_NE(GBRP9BE , GBRP9LE) +#define AV_PIX_FMT_GBRP10 AV_PIX_FMT_NE(GBRP10BE, GBRP10LE) +#define AV_PIX_FMT_GBRP12 AV_PIX_FMT_NE(GBRP12BE, GBRP12LE) +#define AV_PIX_FMT_GBRP14 AV_PIX_FMT_NE(GBRP14BE, GBRP14LE) +#define AV_PIX_FMT_GBRP16 AV_PIX_FMT_NE(GBRP16BE, GBRP16LE) +#define AV_PIX_FMT_GBRAP10 AV_PIX_FMT_NE(GBRAP10BE, GBRAP10LE) +#define AV_PIX_FMT_GBRAP12 AV_PIX_FMT_NE(GBRAP12BE, GBRAP12LE) +#define AV_PIX_FMT_GBRAP14 AV_PIX_FMT_NE(GBRAP14BE, GBRAP14LE) +#define AV_PIX_FMT_GBRAP16 AV_PIX_FMT_NE(GBRAP16BE, GBRAP16LE) + +#define AV_PIX_FMT_BAYER_BGGR16 AV_PIX_FMT_NE(BAYER_BGGR16BE, BAYER_BGGR16LE) +#define AV_PIX_FMT_BAYER_RGGB16 AV_PIX_FMT_NE(BAYER_RGGB16BE, BAYER_RGGB16LE) +#define AV_PIX_FMT_BAYER_GBRG16 AV_PIX_FMT_NE(BAYER_GBRG16BE, BAYER_GBRG16LE) +#define AV_PIX_FMT_BAYER_GRBG16 AV_PIX_FMT_NE(BAYER_GRBG16BE, BAYER_GRBG16LE) + +#define AV_PIX_FMT_GBRPF32 AV_PIX_FMT_NE(GBRPF32BE, GBRPF32LE) +#define AV_PIX_FMT_GBRAPF32 AV_PIX_FMT_NE(GBRAPF32BE, GBRAPF32LE) + +#define AV_PIX_FMT_GRAYF32 AV_PIX_FMT_NE(GRAYF32BE, GRAYF32LE) + +#define AV_PIX_FMT_YUVA420P9 AV_PIX_FMT_NE(YUVA420P9BE , YUVA420P9LE) +#define AV_PIX_FMT_YUVA422P9 AV_PIX_FMT_NE(YUVA422P9BE , YUVA422P9LE) +#define AV_PIX_FMT_YUVA444P9 AV_PIX_FMT_NE(YUVA444P9BE , YUVA444P9LE) +#define AV_PIX_FMT_YUVA420P10 AV_PIX_FMT_NE(YUVA420P10BE, YUVA420P10LE) +#define AV_PIX_FMT_YUVA422P10 AV_PIX_FMT_NE(YUVA422P10BE, YUVA422P10LE) +#define AV_PIX_FMT_YUVA444P10 AV_PIX_FMT_NE(YUVA444P10BE, YUVA444P10LE) +#define AV_PIX_FMT_YUVA422P12 AV_PIX_FMT_NE(YUVA422P12BE, YUVA422P12LE) +#define AV_PIX_FMT_YUVA444P12 AV_PIX_FMT_NE(YUVA444P12BE, YUVA444P12LE) +#define AV_PIX_FMT_YUVA420P16 AV_PIX_FMT_NE(YUVA420P16BE, YUVA420P16LE) +#define AV_PIX_FMT_YUVA422P16 AV_PIX_FMT_NE(YUVA422P16BE, YUVA422P16LE) +#define AV_PIX_FMT_YUVA444P16 AV_PIX_FMT_NE(YUVA444P16BE, YUVA444P16LE) + +#define AV_PIX_FMT_XYZ12 AV_PIX_FMT_NE(XYZ12BE, XYZ12LE) +#define AV_PIX_FMT_NV20 AV_PIX_FMT_NE(NV20BE, NV20LE) +#define AV_PIX_FMT_AYUV64 AV_PIX_FMT_NE(AYUV64BE, AYUV64LE) +#define AV_PIX_FMT_P010 AV_PIX_FMT_NE(P010BE, P010LE) +#define AV_PIX_FMT_P012 AV_PIX_FMT_NE(P012BE, P012LE) +#define AV_PIX_FMT_P016 AV_PIX_FMT_NE(P016BE, P016LE) + +#define AV_PIX_FMT_Y210 AV_PIX_FMT_NE(Y210BE, Y210LE) +#define AV_PIX_FMT_Y212 AV_PIX_FMT_NE(Y212BE, Y212LE) +#define AV_PIX_FMT_XV30 AV_PIX_FMT_NE(XV30BE, XV30LE) +#define AV_PIX_FMT_XV36 AV_PIX_FMT_NE(XV36BE, XV36LE) +#define AV_PIX_FMT_X2RGB10 AV_PIX_FMT_NE(X2RGB10BE, X2RGB10LE) +#define AV_PIX_FMT_X2BGR10 AV_PIX_FMT_NE(X2BGR10BE, X2BGR10LE) + +#define AV_PIX_FMT_P210 AV_PIX_FMT_NE(P210BE, P210LE) +#define AV_PIX_FMT_P410 AV_PIX_FMT_NE(P410BE, P410LE) +#define AV_PIX_FMT_P212 AV_PIX_FMT_NE(P212BE, P212LE) +#define AV_PIX_FMT_P412 AV_PIX_FMT_NE(P412BE, P412LE) +#define AV_PIX_FMT_P216 AV_PIX_FMT_NE(P216BE, P216LE) +#define AV_PIX_FMT_P416 AV_PIX_FMT_NE(P416BE, P416LE) + +#define AV_PIX_FMT_RGBAF16 AV_PIX_FMT_NE(RGBAF16BE, RGBAF16LE) + +#define AV_PIX_FMT_RGBF32 AV_PIX_FMT_NE(RGBF32BE, RGBF32LE) +#define AV_PIX_FMT_RGBAF32 AV_PIX_FMT_NE(RGBAF32BE, RGBAF32LE) + +/** + * Chromaticity coordinates of the source primaries. + * These values match the ones defined by ISO/IEC 23091-2_2019 subclause 8.1 and ITU-T H.273. + */ +enum AVColorPrimaries { + AVCOL_PRI_RESERVED0 = 0, + AVCOL_PRI_BT709 = 1, ///< also ITU-R BT1361 / IEC 61966-2-4 / SMPTE RP 177 Annex B + AVCOL_PRI_UNSPECIFIED = 2, + AVCOL_PRI_RESERVED = 3, + AVCOL_PRI_BT470M = 4, ///< also FCC Title 47 Code of Federal Regulations 73.682 (a)(20) + + AVCOL_PRI_BT470BG = 5, ///< also ITU-R BT601-6 625 / ITU-R BT1358 625 / ITU-R BT1700 625 PAL & SECAM + AVCOL_PRI_SMPTE170M = 6, ///< also ITU-R BT601-6 525 / ITU-R BT1358 525 / ITU-R BT1700 NTSC + AVCOL_PRI_SMPTE240M = 7, ///< identical to above, also called "SMPTE C" even though it uses D65 + AVCOL_PRI_FILM = 8, ///< colour filters using Illuminant C + AVCOL_PRI_BT2020 = 9, ///< ITU-R BT2020 + AVCOL_PRI_SMPTE428 = 10, ///< SMPTE ST 428-1 (CIE 1931 XYZ) + AVCOL_PRI_SMPTEST428_1 = AVCOL_PRI_SMPTE428, + AVCOL_PRI_SMPTE431 = 11, ///< SMPTE ST 431-2 (2011) / DCI P3 + AVCOL_PRI_SMPTE432 = 12, ///< SMPTE ST 432-1 (2010) / P3 D65 / Display P3 + AVCOL_PRI_EBU3213 = 22, ///< EBU Tech. 3213-E (nothing there) / one of JEDEC P22 group phosphors + AVCOL_PRI_JEDEC_P22 = AVCOL_PRI_EBU3213, + AVCOL_PRI_NB ///< Not part of ABI +}; + +/** + * Color Transfer Characteristic. + * These values match the ones defined by ISO/IEC 23091-2_2019 subclause 8.2. + */ +enum AVColorTransferCharacteristic { + AVCOL_TRC_RESERVED0 = 0, + AVCOL_TRC_BT709 = 1, ///< also ITU-R BT1361 + AVCOL_TRC_UNSPECIFIED = 2, + AVCOL_TRC_RESERVED = 3, + AVCOL_TRC_GAMMA22 = 4, ///< also ITU-R BT470M / ITU-R BT1700 625 PAL & SECAM + AVCOL_TRC_GAMMA28 = 5, ///< also ITU-R BT470BG + AVCOL_TRC_SMPTE170M = 6, ///< also ITU-R BT601-6 525 or 625 / ITU-R BT1358 525 or 625 / ITU-R BT1700 NTSC + AVCOL_TRC_SMPTE240M = 7, + AVCOL_TRC_LINEAR = 8, ///< "Linear transfer characteristics" + AVCOL_TRC_LOG = 9, ///< "Logarithmic transfer characteristic (100:1 range)" + AVCOL_TRC_LOG_SQRT = 10, ///< "Logarithmic transfer characteristic (100 * Sqrt(10) : 1 range)" + AVCOL_TRC_IEC61966_2_4 = 11, ///< IEC 61966-2-4 + AVCOL_TRC_BT1361_ECG = 12, ///< ITU-R BT1361 Extended Colour Gamut + AVCOL_TRC_IEC61966_2_1 = 13, ///< IEC 61966-2-1 (sRGB or sYCC) + AVCOL_TRC_BT2020_10 = 14, ///< ITU-R BT2020 for 10-bit system + AVCOL_TRC_BT2020_12 = 15, ///< ITU-R BT2020 for 12-bit system + AVCOL_TRC_SMPTE2084 = 16, ///< SMPTE ST 2084 for 10-, 12-, 14- and 16-bit systems + AVCOL_TRC_SMPTEST2084 = AVCOL_TRC_SMPTE2084, + AVCOL_TRC_SMPTE428 = 17, ///< SMPTE ST 428-1 + AVCOL_TRC_SMPTEST428_1 = AVCOL_TRC_SMPTE428, + AVCOL_TRC_ARIB_STD_B67 = 18, ///< ARIB STD-B67, known as "Hybrid log-gamma" + AVCOL_TRC_NB ///< Not part of ABI +}; + +/** + * YUV colorspace type. + * These values match the ones defined by ISO/IEC 23091-2_2019 subclause 8.3. + */ +enum AVColorSpace { + AVCOL_SPC_RGB = 0, ///< order of coefficients is actually GBR, also IEC 61966-2-1 (sRGB), YZX and ST 428-1 + AVCOL_SPC_BT709 = 1, ///< also ITU-R BT1361 / IEC 61966-2-4 xvYCC709 / derived in SMPTE RP 177 Annex B + AVCOL_SPC_UNSPECIFIED = 2, + AVCOL_SPC_RESERVED = 3, ///< reserved for future use by ITU-T and ISO/IEC just like 15-255 are + AVCOL_SPC_FCC = 4, ///< FCC Title 47 Code of Federal Regulations 73.682 (a)(20) + AVCOL_SPC_BT470BG = 5, ///< also ITU-R BT601-6 625 / ITU-R BT1358 625 / ITU-R BT1700 625 PAL & SECAM / IEC 61966-2-4 xvYCC601 + AVCOL_SPC_SMPTE170M = 6, ///< also ITU-R BT601-6 525 / ITU-R BT1358 525 / ITU-R BT1700 NTSC / functionally identical to above + AVCOL_SPC_SMPTE240M = 7, ///< derived from 170M primaries and D65 white point, 170M is derived from BT470 System M's primaries + AVCOL_SPC_YCGCO = 8, ///< used by Dirac / VC-2 and H.264 FRext, see ITU-T SG16 + AVCOL_SPC_YCOCG = AVCOL_SPC_YCGCO, + AVCOL_SPC_BT2020_NCL = 9, ///< ITU-R BT2020 non-constant luminance system + AVCOL_SPC_BT2020_CL = 10, ///< ITU-R BT2020 constant luminance system + AVCOL_SPC_SMPTE2085 = 11, ///< SMPTE 2085, Y'D'zD'x + AVCOL_SPC_CHROMA_DERIVED_NCL = 12, ///< Chromaticity-derived non-constant luminance system + AVCOL_SPC_CHROMA_DERIVED_CL = 13, ///< Chromaticity-derived constant luminance system + AVCOL_SPC_ICTCP = 14, ///< ITU-R BT.2100-0, ICtCp + AVCOL_SPC_NB ///< Not part of ABI +}; + +/** + * Visual content value range. + * + * These values are based on definitions that can be found in multiple + * specifications, such as ITU-T BT.709 (3.4 - Quantization of RGB, luminance + * and colour-difference signals), ITU-T BT.2020 (Table 5 - Digital + * Representation) as well as ITU-T BT.2100 (Table 9 - Digital 10- and 12-bit + * integer representation). At the time of writing, the BT.2100 one is + * recommended, as it also defines the full range representation. + * + * Common definitions: + * - For RGB and luma planes such as Y in YCbCr and I in ICtCp, + * 'E' is the original value in range of 0.0 to 1.0. + * - For chroma planes such as Cb,Cr and Ct,Cp, 'E' is the original + * value in range of -0.5 to 0.5. + * - 'n' is the output bit depth. + * - For additional definitions such as rounding and clipping to valid n + * bit unsigned integer range, please refer to BT.2100 (Table 9). + */ +enum AVColorRange { + AVCOL_RANGE_UNSPECIFIED = 0, + + /** + * Narrow or limited range content. + * + * - For luma planes: + * + * (219 * E + 16) * 2^(n-8) + * + * F.ex. the range of 16-235 for 8 bits + * + * - For chroma planes: + * + * (224 * E + 128) * 2^(n-8) + * + * F.ex. the range of 16-240 for 8 bits + */ + AVCOL_RANGE_MPEG = 1, + + /** + * Full range content. + * + * - For RGB and luma planes: + * + * (2^n - 1) * E + * + * F.ex. the range of 0-255 for 8 bits + * + * - For chroma planes: + * + * (2^n - 1) * E + 2^(n - 1) + * + * F.ex. the range of 1-255 for 8 bits + */ + AVCOL_RANGE_JPEG = 2, + AVCOL_RANGE_NB ///< Not part of ABI +}; + +/** + * Location of chroma samples. + * + * Illustration showing the location of the first (top left) chroma sample of the + * image, the left shows only luma, the right + * shows the location of the chroma sample, the 2 could be imagined to overlay + * each other but are drawn separately due to limitations of ASCII + * + * 1st 2nd 1st 2nd horizontal luma sample positions + * v v v v + * ______ ______ + *1st luma line > |X X ... |3 4 X ... X are luma samples, + * | |1 2 1-6 are possible chroma positions + *2nd luma line > |X X ... |5 6 X ... 0 is undefined/unknown position + */ +enum AVChromaLocation { + AVCHROMA_LOC_UNSPECIFIED = 0, + AVCHROMA_LOC_LEFT = 1, ///< MPEG-2/4 4:2:0, H.264 default for 4:2:0 + AVCHROMA_LOC_CENTER = 2, ///< MPEG-1 4:2:0, JPEG 4:2:0, H.263 4:2:0 + AVCHROMA_LOC_TOPLEFT = 3, ///< ITU-R 601, SMPTE 274M 296M S314M(DV 4:1:1), mpeg2 4:2:2 + AVCHROMA_LOC_TOP = 4, + AVCHROMA_LOC_BOTTOMLEFT = 5, + AVCHROMA_LOC_BOTTOM = 6, + AVCHROMA_LOC_NB ///< Not part of ABI +}; + +#endif /* AVUTIL_PIXFMT_H */ diff --git a/libs/FFmpeg/include/libavutil/random_seed.h b/libs/FFmpeg/include/libavutil/random_seed.h new file mode 100644 index 0000000..8a47be9 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/random_seed.h @@ -0,0 +1,57 @@ +/* + * Copyright (c) 2009 Baptiste Coudurier + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_RANDOM_SEED_H +#define AVUTIL_RANDOM_SEED_H + +#include +#include +/** + * @addtogroup lavu_crypto + * @{ + */ + +/** + * Get a seed to use in conjunction with random functions. + * This function tries to provide a good seed at a best effort bases. + * Its possible to call this function multiple times if more bits are needed. + * It can be quite slow, which is why it should only be used as seed for a faster + * PRNG. The quality of the seed depends on the platform. + */ +uint32_t av_get_random_seed(void); + +/** + * Generate cryptographically secure random data, i.e. suitable for use as + * encryption keys and similar. + * + * @param buf buffer into which the random data will be written + * @param len size of buf in bytes + * + * @retval 0 success, len bytes of random data was written + * into buf + * @retval "a negative AVERROR code" random data could not be generated + */ +int av_random_bytes(uint8_t *buf, size_t len); + +/** + * @} + */ + +#endif /* AVUTIL_RANDOM_SEED_H */ diff --git a/libs/FFmpeg/include/libavutil/rational.h b/libs/FFmpeg/include/libavutil/rational.h new file mode 100644 index 0000000..8cbfc8e --- /dev/null +++ b/libs/FFmpeg/include/libavutil/rational.h @@ -0,0 +1,221 @@ +/* + * rational numbers + * Copyright (c) 2003 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_math_rational + * Utilties for rational number calculation. + * @author Michael Niedermayer + */ + +#ifndef AVUTIL_RATIONAL_H +#define AVUTIL_RATIONAL_H + +#include +#include +#include "attributes.h" + +/** + * @defgroup lavu_math_rational AVRational + * @ingroup lavu_math + * Rational number calculation. + * + * While rational numbers can be expressed as floating-point numbers, the + * conversion process is a lossy one, so are floating-point operations. On the + * other hand, the nature of FFmpeg demands highly accurate calculation of + * timestamps. This set of rational number utilities serves as a generic + * interface for manipulating rational numbers as pairs of numerators and + * denominators. + * + * Many of the functions that operate on AVRational's have the suffix `_q`, in + * reference to the mathematical symbol "ℚ" (Q) which denotes the set of all + * rational numbers. + * + * @{ + */ + +/** + * Rational number (pair of numerator and denominator). + */ +typedef struct AVRational{ + int num; ///< Numerator + int den; ///< Denominator +} AVRational; + +/** + * Create an AVRational. + * + * Useful for compilers that do not support compound literals. + * + * @note The return value is not reduced. + * @see av_reduce() + */ +static inline AVRational av_make_q(int num, int den) +{ + AVRational r = { num, den }; + return r; +} + +/** + * Compare two rationals. + * + * @param a First rational + * @param b Second rational + * + * @return One of the following values: + * - 0 if `a == b` + * - 1 if `a > b` + * - -1 if `a < b` + * - `INT_MIN` if one of the values is of the form `0 / 0` + */ +static inline int av_cmp_q(AVRational a, AVRational b){ + const int64_t tmp= a.num * (int64_t)b.den - b.num * (int64_t)a.den; + + if(tmp) return (int)((tmp ^ a.den ^ b.den)>>63)|1; + else if(b.den && a.den) return 0; + else if(a.num && b.num) return (a.num>>31) - (b.num>>31); + else return INT_MIN; +} + +/** + * Convert an AVRational to a `double`. + * @param a AVRational to convert + * @return `a` in floating-point form + * @see av_d2q() + */ +static inline double av_q2d(AVRational a){ + return a.num / (double) a.den; +} + +/** + * Reduce a fraction. + * + * This is useful for framerate calculations. + * + * @param[out] dst_num Destination numerator + * @param[out] dst_den Destination denominator + * @param[in] num Source numerator + * @param[in] den Source denominator + * @param[in] max Maximum allowed values for `dst_num` & `dst_den` + * @return 1 if the operation is exact, 0 otherwise + */ +int av_reduce(int *dst_num, int *dst_den, int64_t num, int64_t den, int64_t max); + +/** + * Multiply two rationals. + * @param b First rational + * @param c Second rational + * @return b*c + */ +AVRational av_mul_q(AVRational b, AVRational c) av_const; + +/** + * Divide one rational by another. + * @param b First rational + * @param c Second rational + * @return b/c + */ +AVRational av_div_q(AVRational b, AVRational c) av_const; + +/** + * Add two rationals. + * @param b First rational + * @param c Second rational + * @return b+c + */ +AVRational av_add_q(AVRational b, AVRational c) av_const; + +/** + * Subtract one rational from another. + * @param b First rational + * @param c Second rational + * @return b-c + */ +AVRational av_sub_q(AVRational b, AVRational c) av_const; + +/** + * Invert a rational. + * @param q value + * @return 1 / q + */ +static av_always_inline AVRational av_inv_q(AVRational q) +{ + AVRational r = { q.den, q.num }; + return r; +} + +/** + * Convert a double precision floating point number to a rational. + * + * In case of infinity, the returned value is expressed as `{1, 0}` or + * `{-1, 0}` depending on the sign. + * + * @param d `double` to convert + * @param max Maximum allowed numerator and denominator + * @return `d` in AVRational form + * @see av_q2d() + */ +AVRational av_d2q(double d, int max) av_const; + +/** + * Find which of the two rationals is closer to another rational. + * + * @param q Rational to be compared against + * @param q1 Rational to be tested + * @param q2 Rational to be tested + * @return One of the following values: + * - 1 if `q1` is nearer to `q` than `q2` + * - -1 if `q2` is nearer to `q` than `q1` + * - 0 if they have the same distance + */ +int av_nearer_q(AVRational q, AVRational q1, AVRational q2); + +/** + * Find the value in a list of rationals nearest a given reference rational. + * + * @param q Reference rational + * @param q_list Array of rationals terminated by `{0, 0}` + * @return Index of the nearest value found in the array + */ +int av_find_nearest_q_idx(AVRational q, const AVRational* q_list); + +/** + * Convert an AVRational to a IEEE 32-bit `float` expressed in fixed-point + * format. + * + * @param q Rational to be converted + * @return Equivalent floating-point value, expressed as an unsigned 32-bit + * integer. + * @note The returned value is platform-indepedant. + */ +uint32_t av_q2intfloat(AVRational q); + +/** + * Return the best rational so that a and b are multiple of it. + * If the resulting denominator is larger than max_den, return def. + */ +AVRational av_gcd_q(AVRational a, AVRational b, int max_den, AVRational def); + +/** + * @} + */ + +#endif /* AVUTIL_RATIONAL_H */ diff --git a/libs/FFmpeg/include/libavutil/rc4.h b/libs/FFmpeg/include/libavutil/rc4.h new file mode 100644 index 0000000..bf0ca6e --- /dev/null +++ b/libs/FFmpeg/include/libavutil/rc4.h @@ -0,0 +1,69 @@ +/* + * RC4 encryption/decryption/pseudo-random number generator + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_RC4_H +#define AVUTIL_RC4_H + +#include + +/** + * @defgroup lavu_rc4 RC4 + * @ingroup lavu_crypto + * @{ + */ + +typedef struct AVRC4 { + uint8_t state[256]; + int x, y; +} AVRC4; + +/** + * Allocate an AVRC4 context. + */ +AVRC4 *av_rc4_alloc(void); + +/** + * @brief Initializes an AVRC4 context. + * + * @param d pointer to the AVRC4 context + * @param key buffer containig the key + * @param key_bits must be a multiple of 8 + * @param decrypt 0 for encryption, 1 for decryption, currently has no effect + * @return zero on success, negative value otherwise + */ +int av_rc4_init(struct AVRC4 *d, const uint8_t *key, int key_bits, int decrypt); + +/** + * @brief Encrypts / decrypts using the RC4 algorithm. + * + * @param d pointer to the AVRC4 context + * @param count number of bytes + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst, may be NULL + * @param iv not (yet) used for RC4, should be NULL + * @param decrypt 0 for encryption, 1 for decryption, not (yet) used + */ +void av_rc4_crypt(struct AVRC4 *d, uint8_t *dst, const uint8_t *src, int count, uint8_t *iv, int decrypt); + +/** + * @} + */ + +#endif /* AVUTIL_RC4_H */ diff --git a/libs/FFmpeg/include/libavutil/replaygain.h b/libs/FFmpeg/include/libavutil/replaygain.h new file mode 100644 index 0000000..b49bf1a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/replaygain.h @@ -0,0 +1,50 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_REPLAYGAIN_H +#define AVUTIL_REPLAYGAIN_H + +#include + +/** + * ReplayGain information (see + * http://wiki.hydrogenaudio.org/index.php?title=ReplayGain_1.0_specification). + * The size of this struct is a part of the public ABI. + */ +typedef struct AVReplayGain { + /** + * Track replay gain in microbels (divide by 100000 to get the value in dB). + * Should be set to INT32_MIN when unknown. + */ + int32_t track_gain; + /** + * Peak track amplitude, with 100000 representing full scale (but values + * may overflow). 0 when unknown. + */ + uint32_t track_peak; + /** + * Same as track_gain, but for the whole album. + */ + int32_t album_gain; + /** + * Same as track_peak, but for the whole album, + */ + uint32_t album_peak; +} AVReplayGain; + +#endif /* AVUTIL_REPLAYGAIN_H */ diff --git a/libs/FFmpeg/include/libavutil/ripemd.h b/libs/FFmpeg/include/libavutil/ripemd.h new file mode 100644 index 0000000..9df9f90 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/ripemd.h @@ -0,0 +1,83 @@ +/* + * Copyright (C) 2007 Michael Niedermayer + * Copyright (C) 2013 James Almer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_ripemd + * Public header for RIPEMD hash function implementation. + */ + +#ifndef AVUTIL_RIPEMD_H +#define AVUTIL_RIPEMD_H + +#include +#include + +#include "attributes.h" + +/** + * @defgroup lavu_ripemd RIPEMD + * @ingroup lavu_hash + * RIPEMD hash function implementation. + * + * @{ + */ + +extern const int av_ripemd_size; + +struct AVRIPEMD; + +/** + * Allocate an AVRIPEMD context. + */ +struct AVRIPEMD *av_ripemd_alloc(void); + +/** + * Initialize RIPEMD hashing. + * + * @param context pointer to the function context (of size av_ripemd_size) + * @param bits number of bits in digest (128, 160, 256 or 320 bits) + * @return zero if initialization succeeded, -1 otherwise + */ +int av_ripemd_init(struct AVRIPEMD* context, int bits); + +/** + * Update hash value. + * + * @param context hash function context + * @param data input data to update hash with + * @param len input data length + */ +void av_ripemd_update(struct AVRIPEMD* context, const uint8_t* data, size_t len); + +/** + * Finish hashing and output digest value. + * + * @param context hash function context + * @param digest buffer where output digest value is stored + */ +void av_ripemd_final(struct AVRIPEMD* context, uint8_t *digest); + +/** + * @} + */ + +#endif /* AVUTIL_RIPEMD_H */ diff --git a/libs/FFmpeg/include/libavutil/samplefmt.h b/libs/FFmpeg/include/libavutil/samplefmt.h new file mode 100644 index 0000000..43a57a4 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/samplefmt.h @@ -0,0 +1,269 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_SAMPLEFMT_H +#define AVUTIL_SAMPLEFMT_H + +#include + +/** + * @addtogroup lavu_audio + * @{ + * + * @defgroup lavu_sampfmts Audio sample formats + * + * Audio sample format enumeration and related convenience functions. + * @{ + */ + +/** + * Audio sample formats + * + * - The data described by the sample format is always in native-endian order. + * Sample values can be expressed by native C types, hence the lack of a signed + * 24-bit sample format even though it is a common raw audio data format. + * + * - The floating-point formats are based on full volume being in the range + * [-1.0, 1.0]. Any values outside this range are beyond full volume level. + * + * - The data layout as used in av_samples_fill_arrays() and elsewhere in FFmpeg + * (such as AVFrame in libavcodec) is as follows: + * + * @par + * For planar sample formats, each audio channel is in a separate data plane, + * and linesize is the buffer size, in bytes, for a single plane. All data + * planes must be the same size. For packed sample formats, only the first data + * plane is used, and samples for each channel are interleaved. In this case, + * linesize is the buffer size, in bytes, for the 1 plane. + * + */ +enum AVSampleFormat { + AV_SAMPLE_FMT_NONE = -1, + AV_SAMPLE_FMT_U8, ///< unsigned 8 bits + AV_SAMPLE_FMT_S16, ///< signed 16 bits + AV_SAMPLE_FMT_S32, ///< signed 32 bits + AV_SAMPLE_FMT_FLT, ///< float + AV_SAMPLE_FMT_DBL, ///< double + + AV_SAMPLE_FMT_U8P, ///< unsigned 8 bits, planar + AV_SAMPLE_FMT_S16P, ///< signed 16 bits, planar + AV_SAMPLE_FMT_S32P, ///< signed 32 bits, planar + AV_SAMPLE_FMT_FLTP, ///< float, planar + AV_SAMPLE_FMT_DBLP, ///< double, planar + AV_SAMPLE_FMT_S64, ///< signed 64 bits + AV_SAMPLE_FMT_S64P, ///< signed 64 bits, planar + + AV_SAMPLE_FMT_NB ///< Number of sample formats. DO NOT USE if linking dynamically +}; + +/** + * Return the name of sample_fmt, or NULL if sample_fmt is not + * recognized. + */ +const char *av_get_sample_fmt_name(enum AVSampleFormat sample_fmt); + +/** + * Return a sample format corresponding to name, or AV_SAMPLE_FMT_NONE + * on error. + */ +enum AVSampleFormat av_get_sample_fmt(const char *name); + +/** + * Return the planar<->packed alternative form of the given sample format, or + * AV_SAMPLE_FMT_NONE on error. If the passed sample_fmt is already in the + * requested planar/packed format, the format returned is the same as the + * input. + */ +enum AVSampleFormat av_get_alt_sample_fmt(enum AVSampleFormat sample_fmt, int planar); + +/** + * Get the packed alternative form of the given sample format. + * + * If the passed sample_fmt is already in packed format, the format returned is + * the same as the input. + * + * @return the packed alternative form of the given sample format or + AV_SAMPLE_FMT_NONE on error. + */ +enum AVSampleFormat av_get_packed_sample_fmt(enum AVSampleFormat sample_fmt); + +/** + * Get the planar alternative form of the given sample format. + * + * If the passed sample_fmt is already in planar format, the format returned is + * the same as the input. + * + * @return the planar alternative form of the given sample format or + AV_SAMPLE_FMT_NONE on error. + */ +enum AVSampleFormat av_get_planar_sample_fmt(enum AVSampleFormat sample_fmt); + +/** + * Generate a string corresponding to the sample format with + * sample_fmt, or a header if sample_fmt is negative. + * + * @param buf the buffer where to write the string + * @param buf_size the size of buf + * @param sample_fmt the number of the sample format to print the + * corresponding info string, or a negative value to print the + * corresponding header. + * @return the pointer to the filled buffer or NULL if sample_fmt is + * unknown or in case of other errors + */ +char *av_get_sample_fmt_string(char *buf, int buf_size, enum AVSampleFormat sample_fmt); + +/** + * Return number of bytes per sample. + * + * @param sample_fmt the sample format + * @return number of bytes per sample or zero if unknown for the given + * sample format + */ +int av_get_bytes_per_sample(enum AVSampleFormat sample_fmt); + +/** + * Check if the sample format is planar. + * + * @param sample_fmt the sample format to inspect + * @return 1 if the sample format is planar, 0 if it is interleaved + */ +int av_sample_fmt_is_planar(enum AVSampleFormat sample_fmt); + +/** + * Get the required buffer size for the given audio parameters. + * + * @param[out] linesize calculated linesize, may be NULL + * @param nb_channels the number of channels + * @param nb_samples the number of samples in a single channel + * @param sample_fmt the sample format + * @param align buffer size alignment (0 = default, 1 = no alignment) + * @return required buffer size, or negative error code on failure + */ +int av_samples_get_buffer_size(int *linesize, int nb_channels, int nb_samples, + enum AVSampleFormat sample_fmt, int align); + +/** + * @} + * + * @defgroup lavu_sampmanip Samples manipulation + * + * Functions that manipulate audio samples + * @{ + */ + +/** + * Fill plane data pointers and linesize for samples with sample + * format sample_fmt. + * + * The audio_data array is filled with the pointers to the samples data planes: + * for planar, set the start point of each channel's data within the buffer, + * for packed, set the start point of the entire buffer only. + * + * The value pointed to by linesize is set to the aligned size of each + * channel's data buffer for planar layout, or to the aligned size of the + * buffer for all channels for packed layout. + * + * The buffer in buf must be big enough to contain all the samples + * (use av_samples_get_buffer_size() to compute its minimum size), + * otherwise the audio_data pointers will point to invalid data. + * + * @see enum AVSampleFormat + * The documentation for AVSampleFormat describes the data layout. + * + * @param[out] audio_data array to be filled with the pointer for each channel + * @param[out] linesize calculated linesize, may be NULL + * @param buf the pointer to a buffer containing the samples + * @param nb_channels the number of channels + * @param nb_samples the number of samples in a single channel + * @param sample_fmt the sample format + * @param align buffer size alignment (0 = default, 1 = no alignment) + * @return minimum size in bytes required for the buffer on success, + * or a negative error code on failure + */ +int av_samples_fill_arrays(uint8_t **audio_data, int *linesize, + const uint8_t *buf, + int nb_channels, int nb_samples, + enum AVSampleFormat sample_fmt, int align); + +/** + * Allocate a samples buffer for nb_samples samples, and fill data pointers and + * linesize accordingly. + * The allocated samples buffer can be freed by using av_freep(&audio_data[0]) + * Allocated data will be initialized to silence. + * + * @see enum AVSampleFormat + * The documentation for AVSampleFormat describes the data layout. + * + * @param[out] audio_data array to be filled with the pointer for each channel + * @param[out] linesize aligned size for audio buffer(s), may be NULL + * @param nb_channels number of audio channels + * @param nb_samples number of samples per channel + * @param sample_fmt the sample format + * @param align buffer size alignment (0 = default, 1 = no alignment) + * @return >=0 on success or a negative error code on failure + * @todo return the size of the allocated buffer in case of success at the next bump + * @see av_samples_fill_arrays() + * @see av_samples_alloc_array_and_samples() + */ +int av_samples_alloc(uint8_t **audio_data, int *linesize, int nb_channels, + int nb_samples, enum AVSampleFormat sample_fmt, int align); + +/** + * Allocate a data pointers array, samples buffer for nb_samples + * samples, and fill data pointers and linesize accordingly. + * + * This is the same as av_samples_alloc(), but also allocates the data + * pointers array. + * + * @see av_samples_alloc() + */ +int av_samples_alloc_array_and_samples(uint8_t ***audio_data, int *linesize, int nb_channels, + int nb_samples, enum AVSampleFormat sample_fmt, int align); + +/** + * Copy samples from src to dst. + * + * @param dst destination array of pointers to data planes + * @param src source array of pointers to data planes + * @param dst_offset offset in samples at which the data will be written to dst + * @param src_offset offset in samples at which the data will be read from src + * @param nb_samples number of samples to be copied + * @param nb_channels number of audio channels + * @param sample_fmt audio sample format + */ +int av_samples_copy(uint8_t * const *dst, uint8_t * const *src, int dst_offset, + int src_offset, int nb_samples, int nb_channels, + enum AVSampleFormat sample_fmt); + +/** + * Fill an audio buffer with silence. + * + * @param audio_data array of pointers to data planes + * @param offset offset in samples at which to start filling + * @param nb_samples number of samples to fill + * @param nb_channels number of audio channels + * @param sample_fmt audio sample format + */ +int av_samples_set_silence(uint8_t * const *audio_data, int offset, int nb_samples, + int nb_channels, enum AVSampleFormat sample_fmt); + +/** + * @} + * @} + */ +#endif /* AVUTIL_SAMPLEFMT_H */ diff --git a/libs/FFmpeg/include/libavutil/sha.h b/libs/FFmpeg/include/libavutil/sha.h new file mode 100644 index 0000000..2e1220a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/sha.h @@ -0,0 +1,90 @@ +/* + * Copyright (C) 2007 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_sha + * Public header for SHA-1 & SHA-256 hash function implementations. + */ + +#ifndef AVUTIL_SHA_H +#define AVUTIL_SHA_H + +#include +#include + +#include "attributes.h" + +/** + * @defgroup lavu_sha SHA + * @ingroup lavu_hash + * SHA-1 and SHA-256 (Secure Hash Algorithm) hash function implementations. + * + * This module supports the following SHA hash functions: + * + * - SHA-1: 160 bits + * - SHA-224: 224 bits, as a variant of SHA-2 + * - SHA-256: 256 bits, as a variant of SHA-2 + * + * @see For SHA-384, SHA-512, and variants thereof, see @ref lavu_sha512. + * + * @{ + */ + +extern const int av_sha_size; + +struct AVSHA; + +/** + * Allocate an AVSHA context. + */ +struct AVSHA *av_sha_alloc(void); + +/** + * Initialize SHA-1 or SHA-2 hashing. + * + * @param context pointer to the function context (of size av_sha_size) + * @param bits number of bits in digest (SHA-1 - 160 bits, SHA-2 224 or 256 bits) + * @return zero if initialization succeeded, -1 otherwise + */ +int av_sha_init(struct AVSHA* context, int bits); + +/** + * Update hash value. + * + * @param ctx hash function context + * @param data input data to update hash with + * @param len input data length + */ +void av_sha_update(struct AVSHA *ctx, const uint8_t *data, size_t len); + +/** + * Finish hashing and output digest value. + * + * @param context hash function context + * @param digest buffer where output digest value is stored + */ +void av_sha_final(struct AVSHA* context, uint8_t *digest); + +/** + * @} + */ + +#endif /* AVUTIL_SHA_H */ diff --git a/libs/FFmpeg/include/libavutil/sha512.h b/libs/FFmpeg/include/libavutil/sha512.h new file mode 100644 index 0000000..a4a3f23 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/sha512.h @@ -0,0 +1,92 @@ +/* + * Copyright (C) 2007 Michael Niedermayer + * Copyright (C) 2013 James Almer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_sha512 + * Public header for SHA-512 implementation. + */ + +#ifndef AVUTIL_SHA512_H +#define AVUTIL_SHA512_H + +#include +#include + +#include "attributes.h" + +/** + * @defgroup lavu_sha512 SHA-512 + * @ingroup lavu_hash + * SHA-512 (Secure Hash Algorithm) hash function implementations. + * + * This module supports the following SHA-2 hash functions: + * + * - SHA-512/224: 224 bits + * - SHA-512/256: 256 bits + * - SHA-384: 384 bits + * - SHA-512: 512 bits + * + * @see For SHA-1, SHA-256, and variants thereof, see @ref lavu_sha. + * + * @{ + */ + +extern const int av_sha512_size; + +struct AVSHA512; + +/** + * Allocate an AVSHA512 context. + */ +struct AVSHA512 *av_sha512_alloc(void); + +/** + * Initialize SHA-2 512 hashing. + * + * @param context pointer to the function context (of size av_sha512_size) + * @param bits number of bits in digest (224, 256, 384 or 512 bits) + * @return zero if initialization succeeded, -1 otherwise + */ +int av_sha512_init(struct AVSHA512* context, int bits); + +/** + * Update hash value. + * + * @param context hash function context + * @param data input data to update hash with + * @param len input data length + */ +void av_sha512_update(struct AVSHA512* context, const uint8_t* data, size_t len); + +/** + * Finish hashing and output digest value. + * + * @param context hash function context + * @param digest buffer where output digest value is stored + */ +void av_sha512_final(struct AVSHA512* context, uint8_t *digest); + +/** + * @} + */ + +#endif /* AVUTIL_SHA512_H */ diff --git a/libs/FFmpeg/include/libavutil/spherical.h b/libs/FFmpeg/include/libavutil/spherical.h new file mode 100644 index 0000000..828ac83 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/spherical.h @@ -0,0 +1,227 @@ +/* + * Copyright (c) 2016 Vittorio Giovara + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_video_spherical + * Spherical video + */ + +#ifndef AVUTIL_SPHERICAL_H +#define AVUTIL_SPHERICAL_H + +#include +#include + +/** + * @defgroup lavu_video_spherical Spherical video mapping + * @ingroup lavu_video + * + * A spherical video file contains surfaces that need to be mapped onto a + * sphere. Depending on how the frame was converted, a different distortion + * transformation or surface recomposition function needs to be applied before + * the video should be mapped and displayed. + * @{ + */ + +/** + * Projection of the video surface(s) on a sphere. + */ +enum AVSphericalProjection { + /** + * Video represents a sphere mapped on a flat surface using + * equirectangular projection. + */ + AV_SPHERICAL_EQUIRECTANGULAR, + + /** + * Video frame is split into 6 faces of a cube, and arranged on a + * 3x2 layout. Faces are oriented upwards for the front, left, right, + * and back faces. The up face is oriented so the top of the face is + * forwards and the down face is oriented so the top of the face is + * to the back. + */ + AV_SPHERICAL_CUBEMAP, + + /** + * Video represents a portion of a sphere mapped on a flat surface + * using equirectangular projection. The @ref bounding fields indicate + * the position of the current video in a larger surface. + */ + AV_SPHERICAL_EQUIRECTANGULAR_TILE, +}; + +/** + * This structure describes how to handle spherical videos, outlining + * information about projection, initial layout, and any other view modifier. + * + * @note The struct must be allocated with av_spherical_alloc() and + * its size is not a part of the public ABI. + */ +typedef struct AVSphericalMapping { + /** + * Projection type. + */ + enum AVSphericalProjection projection; + + /** + * @name Initial orientation + * @{ + * There fields describe additional rotations applied to the sphere after + * the video frame is mapped onto it. The sphere is rotated around the + * viewer, who remains stationary. The order of transformation is always + * yaw, followed by pitch, and finally by roll. + * + * The coordinate system matches the one defined in OpenGL, where the + * forward vector (z) is coming out of screen, and it is equivalent to + * a rotation matrix of R = r_y(yaw) * r_x(pitch) * r_z(roll). + * + * A positive yaw rotates the portion of the sphere in front of the viewer + * toward their right. A positive pitch rotates the portion of the sphere + * in front of the viewer upwards. A positive roll tilts the portion of + * the sphere in front of the viewer to the viewer's right. + * + * These values are exported as 16.16 fixed point. + * + * See this equirectangular projection as example: + * + * @code{.unparsed} + * Yaw + * -180 0 180 + * 90 +-------------+-------------+ 180 + * | | | up + * P | | | y| forward + * i | ^ | | /z + * t 0 +-------------X-------------+ 0 Roll | / + * c | | | | / + * h | | | 0|/_____right + * | | | x + * -90 +-------------+-------------+ -180 + * + * X - the default camera center + * ^ - the default up vector + * @endcode + */ + int32_t yaw; ///< Rotation around the up vector [-180, 180]. + int32_t pitch; ///< Rotation around the right vector [-90, 90]. + int32_t roll; ///< Rotation around the forward vector [-180, 180]. + /** + * @} + */ + + /** + * @name Bounding rectangle + * @anchor bounding + * @{ + * These fields indicate the location of the current tile, and where + * it should be mapped relative to the original surface. They are + * exported as 0.32 fixed point, and can be converted to classic + * pixel values with av_spherical_bounds(). + * + * @code{.unparsed} + * +----------------+----------+ + * | |bound_top | + * | +--------+ | + * | bound_left |tile | | + * +<---------->| |<--->+bound_right + * | +--------+ | + * | | | + * | bound_bottom| | + * +----------------+----------+ + * @endcode + * + * If needed, the original video surface dimensions can be derived + * by adding the current stream or frame size to the related bounds, + * like in the following example: + * + * @code{c} + * original_width = tile->width + bound_left + bound_right; + * original_height = tile->height + bound_top + bound_bottom; + * @endcode + * + * @note These values are valid only for the tiled equirectangular + * projection type (@ref AV_SPHERICAL_EQUIRECTANGULAR_TILE), + * and should be ignored in all other cases. + */ + uint32_t bound_left; ///< Distance from the left edge + uint32_t bound_top; ///< Distance from the top edge + uint32_t bound_right; ///< Distance from the right edge + uint32_t bound_bottom; ///< Distance from the bottom edge + /** + * @} + */ + + /** + * Number of pixels to pad from the edge of each cube face. + * + * @note This value is valid for only for the cubemap projection type + * (@ref AV_SPHERICAL_CUBEMAP), and should be ignored in all other + * cases. + */ + uint32_t padding; +} AVSphericalMapping; + +/** + * Allocate a AVSphericalVideo structure and initialize its fields to default + * values. + * + * @return the newly allocated struct or NULL on failure + */ +AVSphericalMapping *av_spherical_alloc(size_t *size); + +/** + * Convert the @ref bounding fields from an AVSphericalVideo + * from 0.32 fixed point to pixels. + * + * @param map The AVSphericalVideo map to read bound values from. + * @param width Width of the current frame or stream. + * @param height Height of the current frame or stream. + * @param left Pixels from the left edge. + * @param top Pixels from the top edge. + * @param right Pixels from the right edge. + * @param bottom Pixels from the bottom edge. + */ +void av_spherical_tile_bounds(const AVSphericalMapping *map, + size_t width, size_t height, + size_t *left, size_t *top, + size_t *right, size_t *bottom); + +/** + * Provide a human-readable name of a given AVSphericalProjection. + * + * @param projection The input AVSphericalProjection. + * + * @return The name of the AVSphericalProjection, or "unknown". + */ +const char *av_spherical_projection_name(enum AVSphericalProjection projection); + +/** + * Get the AVSphericalProjection form a human-readable name. + * + * @param name The input string. + * + * @return The AVSphericalProjection value, or -1 if not found. + */ +int av_spherical_from_name(const char *name); +/** + * @} + */ + +#endif /* AVUTIL_SPHERICAL_H */ diff --git a/libs/FFmpeg/include/libavutil/stereo3d.h b/libs/FFmpeg/include/libavutil/stereo3d.h new file mode 100644 index 0000000..3aab959 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/stereo3d.h @@ -0,0 +1,229 @@ +/* + * Copyright (c) 2013 Vittorio Giovara + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu_video_stereo3d + * Stereoscopic video + */ + +#ifndef AVUTIL_STEREO3D_H +#define AVUTIL_STEREO3D_H + +#include + +#include "frame.h" + +/** + * @defgroup lavu_video_stereo3d Stereo3D types and functions + * @ingroup lavu_video + * + * A stereoscopic video file consists in multiple views embedded in a single + * frame, usually describing two views of a scene. This file describes all + * possible codec-independent view arrangements. + * + * @{ + */ + +/** + * List of possible 3D Types + */ +enum AVStereo3DType { + /** + * Video is not stereoscopic (and metadata has to be there). + */ + AV_STEREO3D_2D, + + /** + * Views are next to each other. + * + * @code{.unparsed} + * LLLLRRRR + * LLLLRRRR + * LLLLRRRR + * ... + * @endcode + */ + AV_STEREO3D_SIDEBYSIDE, + + /** + * Views are on top of each other. + * + * @code{.unparsed} + * LLLLLLLL + * LLLLLLLL + * RRRRRRRR + * RRRRRRRR + * @endcode + */ + AV_STEREO3D_TOPBOTTOM, + + /** + * Views are alternated temporally. + * + * @code{.unparsed} + * frame0 frame1 frame2 ... + * LLLLLLLL RRRRRRRR LLLLLLLL + * LLLLLLLL RRRRRRRR LLLLLLLL + * LLLLLLLL RRRRRRRR LLLLLLLL + * ... ... ... + * @endcode + */ + AV_STEREO3D_FRAMESEQUENCE, + + /** + * Views are packed in a checkerboard-like structure per pixel. + * + * @code{.unparsed} + * LRLRLRLR + * RLRLRLRL + * LRLRLRLR + * ... + * @endcode + */ + AV_STEREO3D_CHECKERBOARD, + + /** + * Views are next to each other, but when upscaling + * apply a checkerboard pattern. + * + * @code{.unparsed} + * LLLLRRRR L L L L R R R R + * LLLLRRRR => L L L L R R R R + * LLLLRRRR L L L L R R R R + * LLLLRRRR L L L L R R R R + * @endcode + */ + AV_STEREO3D_SIDEBYSIDE_QUINCUNX, + + /** + * Views are packed per line, as if interlaced. + * + * @code{.unparsed} + * LLLLLLLL + * RRRRRRRR + * LLLLLLLL + * ... + * @endcode + */ + AV_STEREO3D_LINES, + + /** + * Views are packed per column. + * + * @code{.unparsed} + * LRLRLRLR + * LRLRLRLR + * LRLRLRLR + * ... + * @endcode + */ + AV_STEREO3D_COLUMNS, +}; + +/** + * List of possible view types. + */ +enum AVStereo3DView { + /** + * Frame contains two packed views. + */ + AV_STEREO3D_VIEW_PACKED, + + /** + * Frame contains only the left view. + */ + AV_STEREO3D_VIEW_LEFT, + + /** + * Frame contains only the right view. + */ + AV_STEREO3D_VIEW_RIGHT, +}; + +/** + * Inverted views, Right/Bottom represents the left view. + */ +#define AV_STEREO3D_FLAG_INVERT (1 << 0) + +/** + * Stereo 3D type: this structure describes how two videos are packed + * within a single video surface, with additional information as needed. + * + * @note The struct must be allocated with av_stereo3d_alloc() and + * its size is not a part of the public ABI. + */ +typedef struct AVStereo3D { + /** + * How views are packed within the video. + */ + enum AVStereo3DType type; + + /** + * Additional information about the frame packing. + */ + int flags; + + /** + * Determines which views are packed. + */ + enum AVStereo3DView view; +} AVStereo3D; + +/** + * Allocate an AVStereo3D structure and set its fields to default values. + * The resulting struct can be freed using av_freep(). + * + * @return An AVStereo3D filled with default values or NULL on failure. + */ +AVStereo3D *av_stereo3d_alloc(void); + +/** + * Allocate a complete AVFrameSideData and add it to the frame. + * + * @param frame The frame which side data is added to. + * + * @return The AVStereo3D structure to be filled by caller. + */ +AVStereo3D *av_stereo3d_create_side_data(AVFrame *frame); + +/** + * Provide a human-readable name of a given stereo3d type. + * + * @param type The input stereo3d type value. + * + * @return The name of the stereo3d value, or "unknown". + */ +const char *av_stereo3d_type_name(unsigned int type); + +/** + * Get the AVStereo3DType form a human-readable name. + * + * @param name The input string. + * + * @return The AVStereo3DType value, or -1 if not found. + */ +int av_stereo3d_from_name(const char *name); + +/** + * @} + */ + +#endif /* AVUTIL_STEREO3D_H */ diff --git a/libs/FFmpeg/include/libavutil/tea.h b/libs/FFmpeg/include/libavutil/tea.h new file mode 100644 index 0000000..dd929bd --- /dev/null +++ b/libs/FFmpeg/include/libavutil/tea.h @@ -0,0 +1,71 @@ +/* + * A 32-bit implementation of the TEA algorithm + * Copyright (c) 2015 Vesselin Bontchev + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_TEA_H +#define AVUTIL_TEA_H + +#include + +/** + * @file + * @brief Public header for libavutil TEA algorithm + * @defgroup lavu_tea TEA + * @ingroup lavu_crypto + * @{ + */ + +extern const int av_tea_size; + +struct AVTEA; + +/** + * Allocate an AVTEA context + * To free the struct: av_free(ptr) + */ +struct AVTEA *av_tea_alloc(void); + +/** + * Initialize an AVTEA context. + * + * @param ctx an AVTEA context + * @param key a key of 16 bytes used for encryption/decryption + * @param rounds the number of rounds in TEA (64 is the "standard") + */ +void av_tea_init(struct AVTEA *ctx, const uint8_t key[16], int rounds); + +/** + * Encrypt or decrypt a buffer using a previously initialized context. + * + * @param ctx an AVTEA context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 8 byte blocks + * @param iv initialization vector for CBC mode, if NULL then ECB will be used + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_tea_crypt(struct AVTEA *ctx, uint8_t *dst, const uint8_t *src, + int count, uint8_t *iv, int decrypt); + +/** + * @} + */ + +#endif /* AVUTIL_TEA_H */ diff --git a/libs/FFmpeg/include/libavutil/threadmessage.h b/libs/FFmpeg/include/libavutil/threadmessage.h new file mode 100644 index 0000000..42ce655 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/threadmessage.h @@ -0,0 +1,115 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public License + * as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public License + * along with FFmpeg; if not, write to the Free Software Foundation, Inc., + * 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_THREADMESSAGE_H +#define AVUTIL_THREADMESSAGE_H + +typedef struct AVThreadMessageQueue AVThreadMessageQueue; + +typedef enum AVThreadMessageFlags { + + /** + * Perform non-blocking operation. + * If this flag is set, send and recv operations are non-blocking and + * return AVERROR(EAGAIN) immediately if they can not proceed. + */ + AV_THREAD_MESSAGE_NONBLOCK = 1, + +} AVThreadMessageFlags; + +/** + * Allocate a new message queue. + * + * @param mq pointer to the message queue + * @param nelem maximum number of elements in the queue + * @param elsize size of each element in the queue + * @return >=0 for success; <0 for error, in particular AVERROR(ENOSYS) if + * lavu was built without thread support + */ +int av_thread_message_queue_alloc(AVThreadMessageQueue **mq, + unsigned nelem, + unsigned elsize); + +/** + * Free a message queue. + * + * The message queue must no longer be in use by another thread. + */ +void av_thread_message_queue_free(AVThreadMessageQueue **mq); + +/** + * Send a message on the queue. + */ +int av_thread_message_queue_send(AVThreadMessageQueue *mq, + void *msg, + unsigned flags); + +/** + * Receive a message from the queue. + */ +int av_thread_message_queue_recv(AVThreadMessageQueue *mq, + void *msg, + unsigned flags); + +/** + * Set the sending error code. + * + * If the error code is set to non-zero, av_thread_message_queue_send() will + * return it immediately. Conventional values, such as AVERROR_EOF or + * AVERROR(EAGAIN), can be used to cause the sending thread to stop or + * suspend its operation. + */ +void av_thread_message_queue_set_err_send(AVThreadMessageQueue *mq, + int err); + +/** + * Set the receiving error code. + * + * If the error code is set to non-zero, av_thread_message_queue_recv() will + * return it immediately when there are no longer available messages. + * Conventional values, such as AVERROR_EOF or AVERROR(EAGAIN), can be used + * to cause the receiving thread to stop or suspend its operation. + */ +void av_thread_message_queue_set_err_recv(AVThreadMessageQueue *mq, + int err); + +/** + * Set the optional free message callback function which will be called if an + * operation is removing messages from the queue. + */ +void av_thread_message_queue_set_free_func(AVThreadMessageQueue *mq, + void (*free_func)(void *msg)); + +/** + * Return the current number of messages in the queue. + * + * @return the current number of messages or AVERROR(ENOSYS) if lavu was built + * without thread support + */ +int av_thread_message_queue_nb_elems(AVThreadMessageQueue *mq); + +/** + * Flush the message queue + * + * This function is mostly equivalent to reading and free-ing every message + * except that it will be done in a single operation (no lock/unlock between + * reads). + */ +void av_thread_message_flush(AVThreadMessageQueue *mq); + +#endif /* AVUTIL_THREADMESSAGE_H */ diff --git a/libs/FFmpeg/include/libavutil/time.h b/libs/FFmpeg/include/libavutil/time.h new file mode 100644 index 0000000..dc169b0 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/time.h @@ -0,0 +1,56 @@ +/* + * Copyright (c) 2000-2003 Fabrice Bellard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_TIME_H +#define AVUTIL_TIME_H + +#include + +/** + * Get the current time in microseconds. + */ +int64_t av_gettime(void); + +/** + * Get the current time in microseconds since some unspecified starting point. + * On platforms that support it, the time comes from a monotonic clock + * This property makes this time source ideal for measuring relative time. + * The returned values may not be monotonic on platforms where a monotonic + * clock is not available. + */ +int64_t av_gettime_relative(void); + +/** + * Indicates with a boolean result if the av_gettime_relative() time source + * is monotonic. + */ +int av_gettime_relative_is_monotonic(void); + +/** + * Sleep for a period of time. Although the duration is expressed in + * microseconds, the actual delay may be rounded to the precision of the + * system timer. + * + * @param usec Number of microseconds to sleep. + * @return zero on success or (negative) error code. + */ +int av_usleep(unsigned usec); + +#endif /* AVUTIL_TIME_H */ diff --git a/libs/FFmpeg/include/libavutil/timecode.h b/libs/FFmpeg/include/libavutil/timecode.h new file mode 100644 index 0000000..060574a --- /dev/null +++ b/libs/FFmpeg/include/libavutil/timecode.h @@ -0,0 +1,199 @@ +/* + * Copyright (c) 2006 Smartjog S.A.S, Baptiste Coudurier + * Copyright (c) 2011-2012 Smartjog S.A.S, Clément Bœsch + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * Timecode helpers header + */ + +#ifndef AVUTIL_TIMECODE_H +#define AVUTIL_TIMECODE_H + +#include +#include "rational.h" + +#define AV_TIMECODE_STR_SIZE 23 + +enum AVTimecodeFlag { + AV_TIMECODE_FLAG_DROPFRAME = 1<<0, ///< timecode is drop frame + AV_TIMECODE_FLAG_24HOURSMAX = 1<<1, ///< timecode wraps after 24 hours + AV_TIMECODE_FLAG_ALLOWNEGATIVE = 1<<2, ///< negative time values are allowed +}; + +typedef struct { + int start; ///< timecode frame start (first base frame number) + uint32_t flags; ///< flags such as drop frame, +24 hours support, ... + AVRational rate; ///< frame rate in rational form + unsigned fps; ///< frame per second; must be consistent with the rate field +} AVTimecode; + +/** + * Adjust frame number for NTSC drop frame time code. + * + * @param framenum frame number to adjust + * @param fps frame per second, multiples of 30 + * @return adjusted frame number + * @warning adjustment is only valid for multiples of NTSC 29.97 + */ +int av_timecode_adjust_ntsc_framenum2(int framenum, int fps); + +/** + * Convert frame number to SMPTE 12M binary representation. + * + * @param tc timecode data correctly initialized + * @param framenum frame number + * @return the SMPTE binary representation + * + * See SMPTE ST 314M-2005 Sec 4.4.2.2.1 "Time code pack (TC)" + * the format description as follows: + * bits 0-5: hours, in BCD(6bits) + * bits 6: BGF1 + * bits 7: BGF2 (NTSC) or FIELD (PAL) + * bits 8-14: minutes, in BCD(7bits) + * bits 15: BGF0 (NTSC) or BGF2 (PAL) + * bits 16-22: seconds, in BCD(7bits) + * bits 23: FIELD (NTSC) or BGF0 (PAL) + * bits 24-29: frames, in BCD(6bits) + * bits 30: drop frame flag (0: non drop, 1: drop) + * bits 31: color frame flag (0: unsync mode, 1: sync mode) + * @note BCD numbers (6 or 7 bits): 4 or 5 lower bits for units, 2 higher bits for tens. + * @note Frame number adjustment is automatically done in case of drop timecode, + * you do NOT have to call av_timecode_adjust_ntsc_framenum2(). + * @note The frame number is relative to tc->start. + * @note Color frame (CF) and binary group flags (BGF) bits are set to zero. + */ +uint32_t av_timecode_get_smpte_from_framenum(const AVTimecode *tc, int framenum); + +/** + * Convert sei info to SMPTE 12M binary representation. + * + * @param rate frame rate in rational form + * @param drop drop flag + * @param hh hour + * @param mm minute + * @param ss second + * @param ff frame number + * @return the SMPTE binary representation + */ +uint32_t av_timecode_get_smpte(AVRational rate, int drop, int hh, int mm, int ss, int ff); + +/** + * Load timecode string in buf. + * + * @param buf destination buffer, must be at least AV_TIMECODE_STR_SIZE long + * @param tc timecode data correctly initialized + * @param framenum frame number + * @return the buf parameter + * + * @note Timecode representation can be a negative timecode and have more than + * 24 hours, but will only be honored if the flags are correctly set. + * @note The frame number is relative to tc->start. + */ +char *av_timecode_make_string(const AVTimecode *tc, char *buf, int framenum); + +/** + * Get the timecode string from the SMPTE timecode format. + * + * In contrast to av_timecode_make_smpte_tc_string this function supports 50/60 + * fps timecodes by using the field bit. + * + * @param buf destination buffer, must be at least AV_TIMECODE_STR_SIZE long + * @param rate frame rate of the timecode + * @param tcsmpte the 32-bit SMPTE timecode + * @param prevent_df prevent the use of a drop flag when it is known the DF bit + * is arbitrary + * @param skip_field prevent the use of a field flag when it is known the field + * bit is arbitrary (e.g. because it is used as PC flag) + * @return the buf parameter + */ +char *av_timecode_make_smpte_tc_string2(char *buf, AVRational rate, uint32_t tcsmpte, int prevent_df, int skip_field); + +/** + * Get the timecode string from the SMPTE timecode format. + * + * @param buf destination buffer, must be at least AV_TIMECODE_STR_SIZE long + * @param tcsmpte the 32-bit SMPTE timecode + * @param prevent_df prevent the use of a drop flag when it is known the DF bit + * is arbitrary + * @return the buf parameter + */ +char *av_timecode_make_smpte_tc_string(char *buf, uint32_t tcsmpte, int prevent_df); + +/** + * Get the timecode string from the 25-bit timecode format (MPEG GOP format). + * + * @param buf destination buffer, must be at least AV_TIMECODE_STR_SIZE long + * @param tc25bit the 25-bits timecode + * @return the buf parameter + */ +char *av_timecode_make_mpeg_tc_string(char *buf, uint32_t tc25bit); + +/** + * Init a timecode struct with the passed parameters. + * + * @param log_ctx a pointer to an arbitrary struct of which the first field + * is a pointer to an AVClass struct (used for av_log) + * @param tc pointer to an allocated AVTimecode + * @param rate frame rate in rational form + * @param flags miscellaneous flags such as drop frame, +24 hours, ... + * (see AVTimecodeFlag) + * @param frame_start the first frame number + * @return 0 on success, AVERROR otherwise + */ +int av_timecode_init(AVTimecode *tc, AVRational rate, int flags, int frame_start, void *log_ctx); + +/** + * Init a timecode struct from the passed timecode components. + * + * @param log_ctx a pointer to an arbitrary struct of which the first field + * is a pointer to an AVClass struct (used for av_log) + * @param tc pointer to an allocated AVTimecode + * @param rate frame rate in rational form + * @param flags miscellaneous flags such as drop frame, +24 hours, ... + * (see AVTimecodeFlag) + * @param hh hours + * @param mm minutes + * @param ss seconds + * @param ff frames + * @return 0 on success, AVERROR otherwise + */ +int av_timecode_init_from_components(AVTimecode *tc, AVRational rate, int flags, int hh, int mm, int ss, int ff, void *log_ctx); + +/** + * Parse timecode representation (hh:mm:ss[:;.]ff). + * + * @param log_ctx a pointer to an arbitrary struct of which the first field is a + * pointer to an AVClass struct (used for av_log). + * @param tc pointer to an allocated AVTimecode + * @param rate frame rate in rational form + * @param str timecode string which will determine the frame start + * @return 0 on success, AVERROR otherwise + */ +int av_timecode_init_from_string(AVTimecode *tc, AVRational rate, const char *str, void *log_ctx); + +/** + * Check if the timecode feature is available for the given frame rate + * + * @return 0 if supported, <0 otherwise + */ +int av_timecode_check_frame_rate(AVRational rate); + +#endif /* AVUTIL_TIMECODE_H */ diff --git a/libs/FFmpeg/include/libavutil/timestamp.h b/libs/FFmpeg/include/libavutil/timestamp.h new file mode 100644 index 0000000..9ae64da --- /dev/null +++ b/libs/FFmpeg/include/libavutil/timestamp.h @@ -0,0 +1,78 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * timestamp utils, mostly useful for debugging/logging purposes + */ + +#ifndef AVUTIL_TIMESTAMP_H +#define AVUTIL_TIMESTAMP_H + +#include "avutil.h" + +#if defined(__cplusplus) && !defined(__STDC_FORMAT_MACROS) && !defined(PRId64) +#error missing -D__STDC_FORMAT_MACROS / #define __STDC_FORMAT_MACROS +#endif + +#define AV_TS_MAX_STRING_SIZE 32 + +/** + * Fill the provided buffer with a string containing a timestamp + * representation. + * + * @param buf a buffer with size in bytes of at least AV_TS_MAX_STRING_SIZE + * @param ts the timestamp to represent + * @return the buffer in input + */ +static inline char *av_ts_make_string(char *buf, int64_t ts) +{ + if (ts == AV_NOPTS_VALUE) snprintf(buf, AV_TS_MAX_STRING_SIZE, "NOPTS"); + else snprintf(buf, AV_TS_MAX_STRING_SIZE, "%" PRId64, ts); + return buf; +} + +/** + * Convenience macro, the return value should be used only directly in + * function arguments but never stand-alone. + */ +#define av_ts2str(ts) av_ts_make_string((char[AV_TS_MAX_STRING_SIZE]){0}, ts) + +/** + * Fill the provided buffer with a string containing a timestamp time + * representation. + * + * @param buf a buffer with size in bytes of at least AV_TS_MAX_STRING_SIZE + * @param ts the timestamp to represent + * @param tb the timebase of the timestamp + * @return the buffer in input + */ +static inline char *av_ts_make_time_string(char *buf, int64_t ts, AVRational *tb) +{ + if (ts == AV_NOPTS_VALUE) snprintf(buf, AV_TS_MAX_STRING_SIZE, "NOPTS"); + else snprintf(buf, AV_TS_MAX_STRING_SIZE, "%.6g", av_q2d(*tb) * ts); + return buf; +} + +/** + * Convenience macro, the return value should be used only directly in + * function arguments but never stand-alone. + */ +#define av_ts2timestr(ts, tb) av_ts_make_time_string((char[AV_TS_MAX_STRING_SIZE]){0}, ts, tb) + +#endif /* AVUTIL_TIMESTAMP_H */ diff --git a/libs/FFmpeg/include/libavutil/tree.h b/libs/FFmpeg/include/libavutil/tree.h new file mode 100644 index 0000000..bbb8fbb --- /dev/null +++ b/libs/FFmpeg/include/libavutil/tree.h @@ -0,0 +1,137 @@ +/* + * copyright (c) 2006 Michael Niedermayer + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * A tree container. + * @author Michael Niedermayer + */ + +#ifndef AVUTIL_TREE_H +#define AVUTIL_TREE_H + +#include "attributes.h" + +/** + * @addtogroup lavu_tree AVTree + * @ingroup lavu_data + * + * Low-complexity tree container + * + * Insertion, removal, finding equal, largest which is smaller than and + * smallest which is larger than, all have O(log n) worst-case complexity. + * @{ + */ + + +struct AVTreeNode; +extern const int av_tree_node_size; + +/** + * Allocate an AVTreeNode. + */ +struct AVTreeNode *av_tree_node_alloc(void); + +/** + * Find an element. + * @param root a pointer to the root node of the tree + * @param next If next is not NULL, then next[0] will contain the previous + * element and next[1] the next element. If either does not exist, + * then the corresponding entry in next is unchanged. + * @param cmp compare function used to compare elements in the tree, + * API identical to that of Standard C's qsort + * It is guaranteed that the first and only the first argument to cmp() + * will be the key parameter to av_tree_find(), thus it could if the + * user wants, be a different type (like an opaque context). + * @return An element with cmp(key, elem) == 0 or NULL if no such element + * exists in the tree. + */ +void *av_tree_find(const struct AVTreeNode *root, void *key, + int (*cmp)(const void *key, const void *b), void *next[2]); + +/** + * Insert or remove an element. + * + * If *next is NULL, then the supplied element will be removed if it exists. + * If *next is non-NULL, then the supplied element will be inserted, unless + * it already exists in the tree. + * + * @param rootp A pointer to a pointer to the root node of the tree; note that + * the root node can change during insertions, this is required + * to keep the tree balanced. + * @param key pointer to the element key to insert in the tree + * @param next Used to allocate and free AVTreeNodes. For insertion the user + * must set it to an allocated and zeroed object of at least + * av_tree_node_size bytes size. av_tree_insert() will set it to + * NULL if it has been consumed. + * For deleting elements *next is set to NULL by the user and + * av_tree_insert() will set it to the AVTreeNode which was + * used for the removed element. + * This allows the use of flat arrays, which have + * lower overhead compared to many malloced elements. + * You might want to define a function like: + * @code + * void *tree_insert(struct AVTreeNode **rootp, void *key, + * int (*cmp)(void *key, const void *b), + * AVTreeNode **next) + * { + * if (!*next) + * *next = av_mallocz(av_tree_node_size); + * return av_tree_insert(rootp, key, cmp, next); + * } + * void *tree_remove(struct AVTreeNode **rootp, void *key, + * int (*cmp)(void *key, const void *b, AVTreeNode **next)) + * { + * av_freep(next); + * return av_tree_insert(rootp, key, cmp, next); + * } + * @endcode + * @param cmp compare function used to compare elements in the tree, API identical + * to that of Standard C's qsort + * @return If no insertion happened, the found element; if an insertion or + * removal happened, then either key or NULL will be returned. + * Which one it is depends on the tree state and the implementation. You + * should make no assumptions that it's one or the other in the code. + */ +void *av_tree_insert(struct AVTreeNode **rootp, void *key, + int (*cmp)(const void *key, const void *b), + struct AVTreeNode **next); + +void av_tree_destroy(struct AVTreeNode *t); + +/** + * Apply enu(opaque, &elem) to all the elements in the tree in a given range. + * + * @param cmp a comparison function that returns < 0 for an element below the + * range, > 0 for an element above the range and == 0 for an + * element inside the range + * + * @note The cmp function should use the same ordering used to construct the + * tree. + */ +void av_tree_enumerate(struct AVTreeNode *t, void *opaque, + int (*cmp)(void *opaque, void *elem), + int (*enu)(void *opaque, void *elem)); + +/** + * @} + */ + +#endif /* AVUTIL_TREE_H */ diff --git a/libs/FFmpeg/include/libavutil/twofish.h b/libs/FFmpeg/include/libavutil/twofish.h new file mode 100644 index 0000000..67f359e --- /dev/null +++ b/libs/FFmpeg/include/libavutil/twofish.h @@ -0,0 +1,70 @@ +/* + * An implementation of the TwoFish algorithm + * Copyright (c) 2015 Supraja Meedinti + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_TWOFISH_H +#define AVUTIL_TWOFISH_H + +#include + + +/** + * @file + * @brief Public header for libavutil TWOFISH algorithm + * @defgroup lavu_twofish TWOFISH + * @ingroup lavu_crypto + * @{ + */ + +extern const int av_twofish_size; + +struct AVTWOFISH; + +/** + * Allocate an AVTWOFISH context + * To free the struct: av_free(ptr) + */ +struct AVTWOFISH *av_twofish_alloc(void); + +/** + * Initialize an AVTWOFISH context. + * + * @param ctx an AVTWOFISH context + * @param key a key of size ranging from 1 to 32 bytes used for encryption/decryption + * @param key_bits number of keybits: 128, 192, 256 If less than the required, padded with zeroes to nearest valid value; return value is 0 if key_bits is 128/192/256, -1 if less than 0, 1 otherwise + */ +int av_twofish_init(struct AVTWOFISH *ctx, const uint8_t *key, int key_bits); + +/** + * Encrypt or decrypt a buffer using a previously initialized context + * + * @param ctx an AVTWOFISH context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 16 byte blocks + * @param iv initialization vector for CBC mode, NULL for ECB mode + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_twofish_crypt(struct AVTWOFISH *ctx, uint8_t *dst, const uint8_t *src, int count, uint8_t* iv, int decrypt); + +/** + * @} + */ +#endif /* AVUTIL_TWOFISH_H */ diff --git a/libs/FFmpeg/include/libavutil/tx.h b/libs/FFmpeg/include/libavutil/tx.h new file mode 100644 index 0000000..4696988 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/tx.h @@ -0,0 +1,210 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_TX_H +#define AVUTIL_TX_H + +#include +#include + +typedef struct AVTXContext AVTXContext; + +typedef struct AVComplexFloat { + float re, im; +} AVComplexFloat; + +typedef struct AVComplexDouble { + double re, im; +} AVComplexDouble; + +typedef struct AVComplexInt32 { + int32_t re, im; +} AVComplexInt32; + +enum AVTXType { + /** + * Standard complex to complex FFT with sample data type of AVComplexFloat, + * AVComplexDouble or AVComplexInt32, for each respective variant. + * + * Output is not 1/len normalized. Scaling currently unsupported. + * The stride parameter must be set to the size of a single sample in bytes. + */ + AV_TX_FLOAT_FFT = 0, + AV_TX_DOUBLE_FFT = 2, + AV_TX_INT32_FFT = 4, + + /** + * Standard MDCT with a sample data type of float, double or int32_t, + * respecively. For the float and int32 variants, the scale type is + * 'float', while for the double variant, it's 'double'. + * If scale is NULL, 1.0 will be used as a default. + * + * Length is the frame size, not the window size (which is 2x frame). + * For forward transforms, the stride specifies the spacing between each + * sample in the output array in bytes. The input must be a flat array. + * + * For inverse transforms, the stride specifies the spacing between each + * sample in the input array in bytes. The output must be a flat array. + * + * NOTE: the inverse transform is half-length, meaning the output will not + * contain redundant data. This is what most codecs work with. To do a full + * inverse transform, set the AV_TX_FULL_IMDCT flag on init. + */ + AV_TX_FLOAT_MDCT = 1, + AV_TX_DOUBLE_MDCT = 3, + AV_TX_INT32_MDCT = 5, + + /** + * Real to complex and complex to real DFTs. + * For the float and int32 variants, the scale type is 'float', while for + * the double variant, it's a 'double'. If scale is NULL, 1.0 will be used + * as a default. + * + * For forward transforms (R2C), stride must be the spacing between two + * samples in bytes. For inverse transforms, the stride must be set + * to the spacing between two complex values in bytes. + * + * The forward transform performs a real-to-complex DFT of N samples to + * N/2+1 complex values. + * + * The inverse transform performs a complex-to-real DFT of N/2+1 complex + * values to N real samples. The output is not normalized, but can be + * made so by setting the scale value to 1.0/len. + * NOTE: the inverse transform always overwrites the input. + */ + AV_TX_FLOAT_RDFT = 6, + AV_TX_DOUBLE_RDFT = 7, + AV_TX_INT32_RDFT = 8, + + /** + * Real to real (DCT) transforms. + * + * The forward transform is a DCT-II. + * The inverse transform is a DCT-III. + * + * The input array is always overwritten. DCT-III requires that the + * input be padded with 2 extra samples. Stride must be set to the + * spacing between two samples in bytes. + */ + AV_TX_FLOAT_DCT = 9, + AV_TX_DOUBLE_DCT = 10, + AV_TX_INT32_DCT = 11, + + /** + * Discrete Cosine Transform I + * + * The forward transform is a DCT-I. + * The inverse transform is a DCT-I multiplied by 2/(N + 1). + * + * The input array is always overwritten. + */ + AV_TX_FLOAT_DCT_I = 12, + AV_TX_DOUBLE_DCT_I = 13, + AV_TX_INT32_DCT_I = 14, + + /** + * Discrete Sine Transform I + * + * The forward transform is a DST-I. + * The inverse transform is a DST-I multiplied by 2/(N + 1). + * + * The input array is always overwritten. + */ + AV_TX_FLOAT_DST_I = 15, + AV_TX_DOUBLE_DST_I = 16, + AV_TX_INT32_DST_I = 17, + + /* Not part of the API, do not use */ + AV_TX_NB, +}; + +/** + * Function pointer to a function to perform the transform. + * + * @note Using a different context than the one allocated during av_tx_init() + * is not allowed. + * + * @param s the transform context + * @param out the output array + * @param in the input array + * @param stride the input or output stride in bytes + * + * The out and in arrays must be aligned to the maximum required by the CPU + * architecture unless the AV_TX_UNALIGNED flag was set in av_tx_init(). + * The stride must follow the constraints the transform type has specified. + */ +typedef void (*av_tx_fn)(AVTXContext *s, void *out, void *in, ptrdiff_t stride); + +/** + * Flags for av_tx_init() + */ +enum AVTXFlags { + /** + * Allows for in-place transformations, where input == output. + * May be unsupported or slower for some transform types. + */ + AV_TX_INPLACE = 1ULL << 0, + + /** + * Relaxes alignment requirement for the in and out arrays of av_tx_fn(). + * May be slower with certain transform types. + */ + AV_TX_UNALIGNED = 1ULL << 1, + + /** + * Performs a full inverse MDCT rather than leaving out samples that can be + * derived through symmetry. Requires an output array of 'len' floats, + * rather than the usual 'len/2' floats. + * Ignored for all transforms but inverse MDCTs. + */ + AV_TX_FULL_IMDCT = 1ULL << 2, + + /** + * Perform a real to half-complex RDFT. + * Only the real, or imaginary coefficients will + * be output, depending on the flag used. Only available for forward RDFTs. + * Output array must have enough space to hold N complex values + * (regular size for a real to complex transform). + */ + AV_TX_REAL_TO_REAL = 1ULL << 3, + AV_TX_REAL_TO_IMAGINARY = 1ULL << 4, +}; + +/** + * Initialize a transform context with the given configuration + * (i)MDCTs with an odd length are currently not supported. + * + * @param ctx the context to allocate, will be NULL on error + * @param tx pointer to the transform function pointer to set + * @param type type the type of transform + * @param inv whether to do an inverse or a forward transform + * @param len the size of the transform in samples + * @param scale pointer to the value to scale the output if supported by type + * @param flags a bitmask of AVTXFlags or 0 + * + * @return 0 on success, negative error code on failure + */ +int av_tx_init(AVTXContext **ctx, av_tx_fn *tx, enum AVTXType type, + int inv, int len, const void *scale, uint64_t flags); + +/** + * Frees a context and sets *ctx to NULL, does nothing when *ctx == NULL. + */ +void av_tx_uninit(AVTXContext **ctx); + +#endif /* AVUTIL_TX_H */ diff --git a/libs/FFmpeg/include/libavutil/uuid.h b/libs/FFmpeg/include/libavutil/uuid.h new file mode 100644 index 0000000..748b7ed --- /dev/null +++ b/libs/FFmpeg/include/libavutil/uuid.h @@ -0,0 +1,146 @@ +/* + * Copyright (c) 2022 Pierre-Anthony Lemieux + * Zane van Iperen + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * UUID parsing and serialization utilities. + * The library treats the UUID as an opaque sequence of 16 unsigned bytes, + * i.e. ignoring the internal layout of the UUID, which depends on the type + * of the UUID. + * + * @author Pierre-Anthony Lemieux + * @author Zane van Iperen + */ + +#ifndef AVUTIL_UUID_H +#define AVUTIL_UUID_H + +#include +#include + +#define AV_PRI_UUID \ + "%02hhx%02hhx%02hhx%02hhx-%02hhx%02hhx-" \ + "%02hhx%02hhx-%02hhx%02hhx-%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx" + +#define AV_PRI_URN_UUID \ + "urn:uuid:%02hhx%02hhx%02hhx%02hhx-%02hhx%02hhx-" \ + "%02hhx%02hhx-%02hhx%02hhx-%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx" + +/* AV_UUID_ARG() is used together with AV_PRI_UUID() or AV_PRI_URN_UUID + * to print UUIDs, e.g. + * av_log(NULL, AV_LOG_DEBUG, "UUID: " AV_PRI_UUID, AV_UUID_ARG(uuid)); + */ +#define AV_UUID_ARG(x) \ + (x)[ 0], (x)[ 1], (x)[ 2], (x)[ 3], \ + (x)[ 4], (x)[ 5], (x)[ 6], (x)[ 7], \ + (x)[ 8], (x)[ 9], (x)[10], (x)[11], \ + (x)[12], (x)[13], (x)[14], (x)[15] + +#define AV_UUID_LEN 16 + +/* Binary representation of a UUID */ +typedef uint8_t AVUUID[AV_UUID_LEN]; + +/** + * Parses a string representation of a UUID formatted according to IETF RFC 4122 + * into an AVUUID. The parsing is case-insensitive. The string must be 37 + * characters long, including the terminating NUL character. + * + * Example string representation: "2fceebd0-7017-433d-bafb-d073a7116696" + * + * @param[in] in String representation of a UUID, + * e.g. 2fceebd0-7017-433d-bafb-d073a7116696 + * @param[out] uu AVUUID + * @return A non-zero value in case of an error. + */ +int av_uuid_parse(const char *in, AVUUID uu); + +/** + * Parses a URN representation of a UUID, as specified at IETF RFC 4122, + * into an AVUUID. The parsing is case-insensitive. The string must be 46 + * characters long, including the terminating NUL character. + * + * Example string representation: "urn:uuid:2fceebd0-7017-433d-bafb-d073a7116696" + * + * @param[in] in URN UUID + * @param[out] uu AVUUID + * @return A non-zero value in case of an error. + */ +int av_uuid_urn_parse(const char *in, AVUUID uu); + +/** + * Parses a string representation of a UUID formatted according to IETF RFC 4122 + * into an AVUUID. The parsing is case-insensitive. + * + * @param[in] in_start Pointer to the first character of the string representation + * @param[in] in_end Pointer to the character after the last character of the + * string representation. That memory location is never + * accessed. It is an error if `in_end - in_start != 36`. + * @param[out] uu AVUUID + * @return A non-zero value in case of an error. + */ +int av_uuid_parse_range(const char *in_start, const char *in_end, AVUUID uu); + +/** + * Serializes a AVUUID into a string representation according to IETF RFC 4122. + * The string is lowercase and always 37 characters long, including the + * terminating NUL character. + * + * @param[in] uu AVUUID + * @param[out] out Pointer to an array of no less than 37 characters. + */ +void av_uuid_unparse(const AVUUID uu, char *out); + +/** + * Compares two UUIDs for equality. + * + * @param[in] uu1 AVUUID + * @param[in] uu2 AVUUID + * @return Nonzero if uu1 and uu2 are identical, 0 otherwise + */ +static inline int av_uuid_equal(const AVUUID uu1, const AVUUID uu2) +{ + return memcmp(uu1, uu2, AV_UUID_LEN) == 0; +} + +/** + * Copies the bytes of src into dest. + * + * @param[out] dest AVUUID + * @param[in] src AVUUID + */ +static inline void av_uuid_copy(AVUUID dest, const AVUUID src) +{ + memcpy(dest, src, AV_UUID_LEN); +} + +/** + * Sets a UUID to the nil UUID, i.e. a UUID with have all + * its 128 bits set to zero. + * + * @param[in,out] uu UUID to be set to the nil UUID + */ +static inline void av_uuid_nil(AVUUID uu) +{ + memset(uu, 0, AV_UUID_LEN); +} + +#endif /* AVUTIL_UUID_H */ diff --git a/libs/FFmpeg/include/libavutil/version.h b/libs/FFmpeg/include/libavutil/version.h new file mode 100644 index 0000000..589a42b --- /dev/null +++ b/libs/FFmpeg/include/libavutil/version.h @@ -0,0 +1,128 @@ +/* + * copyright (c) 2003 Fabrice Bellard + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +/** + * @file + * @ingroup lavu + * Libavutil version macros + */ + +#ifndef AVUTIL_VERSION_H +#define AVUTIL_VERSION_H + +#include "macros.h" + +/** + * @addtogroup version_utils + * + * Useful to check and match library version in order to maintain + * backward compatibility. + * + * The FFmpeg libraries follow a versioning sheme very similar to + * Semantic Versioning (http://semver.org/) + * The difference is that the component called PATCH is called MICRO in FFmpeg + * and its value is reset to 100 instead of 0 to keep it above or equal to 100. + * Also we do not increase MICRO for every bugfix or change in git master. + * + * Prior to FFmpeg 3.2 point releases did not change any lib version number to + * avoid aliassing different git master checkouts. + * Starting with FFmpeg 3.2, the released library versions will occupy + * a separate MAJOR.MINOR that is not used on the master development branch. + * That is if we branch a release of master 55.10.123 we will bump to 55.11.100 + * for the release and master will continue at 55.12.100 after it. Each new + * point release will then bump the MICRO improving the usefulness of the lib + * versions. + * + * @{ + */ + +#define AV_VERSION_INT(a, b, c) ((a)<<16 | (b)<<8 | (c)) +#define AV_VERSION_DOT(a, b, c) a ##.## b ##.## c +#define AV_VERSION(a, b, c) AV_VERSION_DOT(a, b, c) + +/** + * Extract version components from the full ::AV_VERSION_INT int as returned + * by functions like ::avformat_version() and ::avcodec_version() + */ +#define AV_VERSION_MAJOR(a) ((a) >> 16) +#define AV_VERSION_MINOR(a) (((a) & 0x00FF00) >> 8) +#define AV_VERSION_MICRO(a) ((a) & 0xFF) + +/** + * @} + */ + +/** + * @defgroup lavu_ver Version and Build diagnostics + * + * Macros and function useful to check at compiletime and at runtime + * which version of libavutil is in use. + * + * @{ + */ + +#define LIBAVUTIL_VERSION_MAJOR 58 +#define LIBAVUTIL_VERSION_MINOR 31 +#define LIBAVUTIL_VERSION_MICRO 100 + +#define LIBAVUTIL_VERSION_INT AV_VERSION_INT(LIBAVUTIL_VERSION_MAJOR, \ + LIBAVUTIL_VERSION_MINOR, \ + LIBAVUTIL_VERSION_MICRO) +#define LIBAVUTIL_VERSION AV_VERSION(LIBAVUTIL_VERSION_MAJOR, \ + LIBAVUTIL_VERSION_MINOR, \ + LIBAVUTIL_VERSION_MICRO) +#define LIBAVUTIL_BUILD LIBAVUTIL_VERSION_INT + +#define LIBAVUTIL_IDENT "Lavu" AV_STRINGIFY(LIBAVUTIL_VERSION) + +/** + * @defgroup lavu_depr_guards Deprecation Guards + * FF_API_* defines may be placed below to indicate public API that will be + * dropped at a future version bump. The defines themselves are not part of + * the public API and may change, break or disappear at any time. + * + * @note, when bumping the major version it is recommended to manually + * disable each FF_API_* in its own commit instead of disabling them all + * at once through the bump. This improves the git bisect-ability of the change. + * + * @{ + */ + +#define FF_API_FIFO_PEEK2 (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_FIFO_OLD_API (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_XVMC (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_OLD_CHANNEL_LAYOUT (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_AV_FOPEN_UTF8 (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_PKT_DURATION (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_REORDERED_OPAQUE (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_FRAME_PICTURE_NUMBER (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_HDR_VIVID_THREE_SPLINE (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_FRAME_PKT (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_INTERLACED_FRAME (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_FRAME_KEY (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_PALETTE_HAS_CHANGED (LIBAVUTIL_VERSION_MAJOR < 59) +#define FF_API_VULKAN_CONTIGUOUS_MEMORY (LIBAVUTIL_VERSION_MAJOR < 59) + +/** + * @} + * @} + */ + +#endif /* AVUTIL_VERSION_H */ diff --git a/libs/FFmpeg/include/libavutil/video_enc_params.h b/libs/FFmpeg/include/libavutil/video_enc_params.h new file mode 100644 index 0000000..62265a5 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/video_enc_params.h @@ -0,0 +1,171 @@ +/* + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_VIDEO_ENC_PARAMS_H +#define AVUTIL_VIDEO_ENC_PARAMS_H + +#include +#include + +#include "libavutil/avassert.h" +#include "libavutil/frame.h" + +enum AVVideoEncParamsType { + AV_VIDEO_ENC_PARAMS_NONE = -1, + /** + * VP9 stores: + * - per-frame base (luma AC) quantizer index, exported as AVVideoEncParams.qp + * - deltas for luma DC, chroma AC and chroma DC, exported in the + * corresponding entries in AVVideoEncParams.delta_qp + * - per-segment delta, exported as for each block as AVVideoBlockParams.delta_qp + * + * To compute the resulting quantizer index for a block: + * - for luma AC, add the base qp and the per-block delta_qp, saturating to + * unsigned 8-bit. + * - for luma DC and chroma AC/DC, add the corresponding + * AVVideoBlockParams.delta_qp to the luma AC index, again saturating to + * unsigned 8-bit. + */ + AV_VIDEO_ENC_PARAMS_VP9, + + /** + * H.264 stores: + * - in PPS (per-picture): + * * initial QP_Y (luma) value, exported as AVVideoEncParams.qp + * * delta(s) for chroma QP values (same for both, or each separately), + * exported as in the corresponding entries in AVVideoEncParams.delta_qp + * - per-slice QP delta, not exported directly, added to the per-MB value + * - per-MB delta; not exported directly; the final per-MB quantizer + * parameter - QP_Y - minus the value in AVVideoEncParams.qp is exported + * as AVVideoBlockParams.qp_delta. + */ + AV_VIDEO_ENC_PARAMS_H264, + + /* + * MPEG-2-compatible quantizer. + * + * Summing the frame-level qp with the per-block delta_qp gives the + * resulting quantizer for the block. + */ + AV_VIDEO_ENC_PARAMS_MPEG2, +}; + +/** + * Video encoding parameters for a given frame. This struct is allocated along + * with an optional array of per-block AVVideoBlockParams descriptors. + * Must be allocated with av_video_enc_params_alloc(). + */ +typedef struct AVVideoEncParams { + /** + * Number of blocks in the array. + * + * May be 0, in which case no per-block information is present. In this case + * the values of blocks_offset / block_size are unspecified and should not + * be accessed. + */ + unsigned int nb_blocks; + /** + * Offset in bytes from the beginning of this structure at which the array + * of blocks starts. + */ + size_t blocks_offset; + /* + * Size of each block in bytes. May not match sizeof(AVVideoBlockParams). + */ + size_t block_size; + + /** + * Type of the parameters (the codec they are used with). + */ + enum AVVideoEncParamsType type; + + /** + * Base quantisation parameter for the frame. The final quantiser for a + * given block in a given plane is obtained from this value, possibly + * combined with {@code delta_qp} and the per-block delta in a manner + * documented for each type. + */ + int32_t qp; + + /** + * Quantisation parameter offset from the base (per-frame) qp for a given + * plane (first index) and AC/DC coefficients (second index). + */ + int32_t delta_qp[4][2]; +} AVVideoEncParams; + +/** + * Data structure for storing block-level encoding information. + * It is allocated as a part of AVVideoEncParams and should be retrieved with + * av_video_enc_params_block(). + * + * sizeof(AVVideoBlockParams) is not a part of the ABI and new fields may be + * added to it. + */ +typedef struct AVVideoBlockParams { + /** + * Distance in luma pixels from the top-left corner of the visible frame + * to the top-left corner of the block. + * Can be negative if top/right padding is present on the coded frame. + */ + int src_x, src_y; + /** + * Width and height of the block in luma pixels. + */ + int w, h; + + /** + * Difference between this block's final quantization parameter and the + * corresponding per-frame value. + */ + int32_t delta_qp; +} AVVideoBlockParams; + +/** + * Get the block at the specified {@code idx}. Must be between 0 and nb_blocks - 1. + */ +static av_always_inline AVVideoBlockParams* +av_video_enc_params_block(AVVideoEncParams *par, unsigned int idx) +{ + av_assert0(idx < par->nb_blocks); + return (AVVideoBlockParams *)((uint8_t *)par + par->blocks_offset + + idx * par->block_size); +} + +/** + * Allocates memory for AVVideoEncParams of the given type, plus an array of + * {@code nb_blocks} AVVideoBlockParams and initializes the variables. Can be + * freed with a normal av_free() call. + * + * @param out_size if non-NULL, the size in bytes of the resulting data array is + * written here. + */ +AVVideoEncParams *av_video_enc_params_alloc(enum AVVideoEncParamsType type, + unsigned int nb_blocks, size_t *out_size); + +/** + * Allocates memory for AVEncodeInfoFrame plus an array of + * {@code nb_blocks} AVEncodeInfoBlock in the given AVFrame {@code frame} + * as AVFrameSideData of type AV_FRAME_DATA_VIDEO_ENC_PARAMS + * and initializes the variables. + */ +AVVideoEncParams* +av_video_enc_params_create_side_data(AVFrame *frame, enum AVVideoEncParamsType type, + unsigned int nb_blocks); + +#endif /* AVUTIL_VIDEO_ENC_PARAMS_H */ diff --git a/libs/FFmpeg/include/libavutil/video_hint.h b/libs/FFmpeg/include/libavutil/video_hint.h new file mode 100644 index 0000000..1b21960 --- /dev/null +++ b/libs/FFmpeg/include/libavutil/video_hint.h @@ -0,0 +1,107 @@ +/** + * Copyright 2023 Elias Carotti + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_VIDEO_HINT_H +#define AVUTIL_VIDEO_HINT_H + +#include +#include +#include "libavutil/avassert.h" +#include "libavutil/frame.h" + +typedef struct AVVideoRect { + uint32_t x, y; + uint32_t width, height; +} AVVideoRect; + +typedef enum AVVideoHintType { + /* rectangled delimit the constant areas (unchanged), default is changed */ + AV_VIDEO_HINT_TYPE_CONSTANT, + + /* rectangled delimit the constant areas (changed), default is not changed */ + AV_VIDEO_HINT_TYPE_CHANGED, +} AVVideoHintType; + +typedef struct AVVideoHint { + /** + * Number of AVVideoRect present. + * + * May be 0, in which case no per-rectangle information is present. In this + * case the values of rect_offset / rect_size are unspecified and should + * not be accessed. + */ + size_t nb_rects; + + /** + * Offset in bytes from the beginning of this structure at which the array + * of AVVideoRect starts. + */ + size_t rect_offset; + + /** + * Size in bytes of AVVideoRect. + */ + size_t rect_size; + + AVVideoHintType type; +} AVVideoHint; + +static av_always_inline AVVideoRect * +av_video_hint_rects(const AVVideoHint *hints) { + return (AVVideoRect *)((uint8_t *)hints + hints->rect_offset); +} + +static av_always_inline AVVideoRect * +av_video_hint_get_rect(const AVVideoHint *hints, size_t idx) { + return (AVVideoRect *)((uint8_t *)hints + hints->rect_offset + idx * hints->rect_size); +} + +/** + * Allocate memory for the AVVideoHint struct along with an nb_rects-sized + * arrays of AVVideoRect. + * + * The side data contains a list of rectangles for the portions of the frame + * which changed from the last encoded one (and the remainder are assumed to be + * changed), or, alternately (depending on the type parameter) the unchanged + * ones (and the remanining ones are those which changed). + * Macroblocks will thus be hinted either to be P_SKIP-ped or go through the + * regular encoding procedure. + * + * It's responsibility of the caller to fill the AVRects accordingly, and to set + * the proper AVVideoHintType field. + * + * @param out_size if non-NULL, the size in bytes of the resulting data array is + * written here + * + * @return newly allocated AVVideoHint struct (must be freed by the caller using + * av_free()) on success, NULL on memory allocation failure + */ +AVVideoHint *av_video_hint_alloc(size_t nb_rects, + size_t *out_size); + +/** + * Same as av_video_hint_alloc(), except newly-allocated AVVideoHint is attached + * as side data of type AV_FRAME_DATA_VIDEO_HINT_INFO to frame. + */ +AVVideoHint *av_video_hint_create_side_data(AVFrame *frame, + size_t nb_rects); + + +#endif /* AVUTIL_VIDEO_HINT_H */ diff --git a/libs/FFmpeg/include/libavutil/xtea.h b/libs/FFmpeg/include/libavutil/xtea.h new file mode 100644 index 0000000..735427c --- /dev/null +++ b/libs/FFmpeg/include/libavutil/xtea.h @@ -0,0 +1,94 @@ +/* + * A 32-bit implementation of the XTEA algorithm + * Copyright (c) 2012 Samuel Pitoiset + * + * This file is part of FFmpeg. + * + * FFmpeg is free software; you can redistribute it and/or + * modify it under the terms of the GNU Lesser General Public + * License as published by the Free Software Foundation; either + * version 2.1 of the License, or (at your option) any later version. + * + * FFmpeg is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + * Lesser General Public License for more details. + * + * You should have received a copy of the GNU Lesser General Public + * License along with FFmpeg; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA + */ + +#ifndef AVUTIL_XTEA_H +#define AVUTIL_XTEA_H + +#include + +/** + * @file + * @brief Public header for libavutil XTEA algorithm + * @defgroup lavu_xtea XTEA + * @ingroup lavu_crypto + * @{ + */ + +typedef struct AVXTEA { + uint32_t key[16]; +} AVXTEA; + +/** + * Allocate an AVXTEA context. + */ +AVXTEA *av_xtea_alloc(void); + +/** + * Initialize an AVXTEA context. + * + * @param ctx an AVXTEA context + * @param key a key of 16 bytes used for encryption/decryption, + * interpreted as big endian 32 bit numbers + */ +void av_xtea_init(struct AVXTEA *ctx, const uint8_t key[16]); + +/** + * Initialize an AVXTEA context. + * + * @param ctx an AVXTEA context + * @param key a key of 16 bytes used for encryption/decryption, + * interpreted as little endian 32 bit numbers + */ +void av_xtea_le_init(struct AVXTEA *ctx, const uint8_t key[16]); + +/** + * Encrypt or decrypt a buffer using a previously initialized context, + * in big endian format. + * + * @param ctx an AVXTEA context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 8 byte blocks + * @param iv initialization vector for CBC mode, if NULL then ECB will be used + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_xtea_crypt(struct AVXTEA *ctx, uint8_t *dst, const uint8_t *src, + int count, uint8_t *iv, int decrypt); + +/** + * Encrypt or decrypt a buffer using a previously initialized context, + * in little endian format. + * + * @param ctx an AVXTEA context + * @param dst destination array, can be equal to src + * @param src source array, can be equal to dst + * @param count number of 8 byte blocks + * @param iv initialization vector for CBC mode, if NULL then ECB will be used + * @param decrypt 0 for encryption, 1 for decryption + */ +void av_xtea_le_crypt(struct AVXTEA *ctx, uint8_t *dst, const uint8_t *src, + int count, uint8_t *iv, int decrypt); + +/** + * @} + */ + +#endif /* AVUTIL_XTEA_H */ diff --git a/libs/FFmpeg/lib/iOS-Sim/libavcodec.a b/libs/FFmpeg/lib/iOS-Sim/libavcodec.a new file mode 100644 index 0000000..91cbbe1 Binary files /dev/null and b/libs/FFmpeg/lib/iOS-Sim/libavcodec.a differ diff --git a/libs/FFmpeg/lib/iOS-Sim/libavformat.a b/libs/FFmpeg/lib/iOS-Sim/libavformat.a new file mode 100644 index 0000000..c72fccc Binary files /dev/null and b/libs/FFmpeg/lib/iOS-Sim/libavformat.a differ diff --git a/libs/FFmpeg/lib/iOS-Sim/libavutil.a b/libs/FFmpeg/lib/iOS-Sim/libavutil.a new file mode 100644 index 0000000..82e534b Binary files /dev/null and b/libs/FFmpeg/lib/iOS-Sim/libavutil.a differ diff --git a/libs/FFmpeg/lib/iOS/libavcodec.a b/libs/FFmpeg/lib/iOS/libavcodec.a new file mode 100644 index 0000000..eca8c26 Binary files /dev/null and b/libs/FFmpeg/lib/iOS/libavcodec.a differ diff --git a/libs/FFmpeg/lib/iOS/libavformat.a b/libs/FFmpeg/lib/iOS/libavformat.a new file mode 100644 index 0000000..f97fc24 Binary files /dev/null and b/libs/FFmpeg/lib/iOS/libavformat.a differ diff --git a/libs/FFmpeg/lib/iOS/libavutil.a b/libs/FFmpeg/lib/iOS/libavutil.a new file mode 100644 index 0000000..4660598 Binary files /dev/null and b/libs/FFmpeg/lib/iOS/libavutil.a differ diff --git a/libs/FFmpeg/lib/tvOS-Sim/libavcodec.a b/libs/FFmpeg/lib/tvOS-Sim/libavcodec.a new file mode 100644 index 0000000..9b263ae Binary files /dev/null and b/libs/FFmpeg/lib/tvOS-Sim/libavcodec.a differ diff --git a/libs/FFmpeg/lib/tvOS-Sim/libavformat.a b/libs/FFmpeg/lib/tvOS-Sim/libavformat.a new file mode 100644 index 0000000..8802fec Binary files /dev/null and b/libs/FFmpeg/lib/tvOS-Sim/libavformat.a differ diff --git a/libs/FFmpeg/lib/tvOS-Sim/libavutil.a b/libs/FFmpeg/lib/tvOS-Sim/libavutil.a new file mode 100644 index 0000000..c342e57 Binary files /dev/null and b/libs/FFmpeg/lib/tvOS-Sim/libavutil.a differ diff --git a/libs/FFmpeg/lib/tvOS/libavcodec.a b/libs/FFmpeg/lib/tvOS/libavcodec.a new file mode 100644 index 0000000..4cc1203 Binary files /dev/null and b/libs/FFmpeg/lib/tvOS/libavcodec.a differ diff --git a/libs/FFmpeg/lib/tvOS/libavformat.a b/libs/FFmpeg/lib/tvOS/libavformat.a new file mode 100644 index 0000000..3112c09 Binary files /dev/null and b/libs/FFmpeg/lib/tvOS/libavformat.a differ diff --git a/libs/FFmpeg/lib/tvOS/libavutil.a b/libs/FFmpeg/lib/tvOS/libavutil.a new file mode 100644 index 0000000..9f48916 Binary files /dev/null and b/libs/FFmpeg/lib/tvOS/libavutil.a differ diff --git a/libs/SDL2/include/SDL.h b/libs/SDL2/include/SDL.h index 7cdd324..9ba8f68 100644 --- a/libs/SDL2/include/SDL.h +++ b/libs/SDL2/include/SDL.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -41,6 +41,7 @@ #include "SDL_events.h" #include "SDL_filesystem.h" #include "SDL_gamecontroller.h" +#include "SDL_guid.h" #include "SDL_haptic.h" #include "SDL_hidapi.h" #include "SDL_hints.h" diff --git a/libs/SDL2/include/SDL_assert.h b/libs/SDL2/include/SDL_assert.h index defadf1..7ce823e 100644 --- a/libs/SDL2/include/SDL_assert.h +++ b/libs/SDL2/include/SDL_assert.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -22,7 +22,7 @@ #ifndef SDL_assert_h_ #define SDL_assert_h_ -#include "SDL_config.h" +#include "SDL_stdinc.h" #include "begin_code.h" /* Set up for C function definitions, even when using C++ */ @@ -51,8 +51,12 @@ assert can have unique static variables associated with it. /* Don't include intrin.h here because it contains C++ code */ extern void __cdecl __debugbreak(void); #define SDL_TriggerBreakpoint() __debugbreak() +#elif _SDL_HAS_BUILTIN(__builtin_debugtrap) + #define SDL_TriggerBreakpoint() __builtin_debugtrap() #elif ( (!defined(__NACL__)) && ((defined(__GNUC__) || defined(__clang__)) && (defined(__i386__) || defined(__x86_64__))) ) #define SDL_TriggerBreakpoint() __asm__ __volatile__ ( "int $3\n\t" ) +#elif (defined(__GNUC__) || defined(__clang__)) && defined(__riscv) + #define SDL_TriggerBreakpoint() __asm__ __volatile__ ( "ebreak\n\t" ) #elif ( defined(__APPLE__) && (defined(__arm64__) || defined(__aarch64__)) ) /* this might work on other ARM targets, but this is a known quantity... */ #define SDL_TriggerBreakpoint() __asm__ __volatile__ ( "brk #22\n\t" ) #elif defined(__APPLE__) && defined(__arm__) @@ -69,7 +73,7 @@ assert can have unique static variables associated with it. #if defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 199901L) /* C99 supports __func__ as a standard. */ # define SDL_FUNCTION __func__ -#elif ((__GNUC__ >= 2) || defined(_MSC_VER) || defined (__WATCOMC__)) +#elif ((defined(__GNUC__) && (__GNUC__ >= 2)) || defined(_MSC_VER) || defined (__WATCOMC__)) # define SDL_FUNCTION __FUNCTION__ #else # define SDL_FUNCTION "???" @@ -123,12 +127,10 @@ typedef struct SDL_AssertData const struct SDL_AssertData *next; } SDL_AssertData; -#if (SDL_ASSERT_LEVEL > 0) - /* Never call this directly. Use the SDL_assert* macros. */ extern DECLSPEC SDL_AssertState SDLCALL SDL_ReportAssertion(SDL_AssertData *, - const char *, - const char *, int) + const char *, + const char *, int) #if defined(__clang__) #if __has_feature(attribute_analyzer_noreturn) /* this tells Clang's static analysis that we're a custom assert function, @@ -149,9 +151,7 @@ extern DECLSPEC SDL_AssertState SDLCALL SDL_ReportAssertion(SDL_AssertData *, #define SDL_enabled_assert(condition) \ do { \ while ( !(condition) ) { \ - static struct SDL_AssertData sdl_assert_data = { \ - 0, 0, #condition, 0, 0, 0, 0 \ - }; \ + static struct SDL_AssertData sdl_assert_data = { 0, 0, #condition, 0, 0, 0, 0 }; \ const SDL_AssertState sdl_assert_state = SDL_ReportAssertion(&sdl_assert_data, SDL_FUNCTION, SDL_FILE, SDL_LINE); \ if (sdl_assert_state == SDL_ASSERTION_RETRY) { \ continue; /* go again. */ \ @@ -162,8 +162,6 @@ extern DECLSPEC SDL_AssertState SDLCALL SDL_ReportAssertion(SDL_AssertData *, } \ } while (SDL_NULL_WHILE_LOOP_CONDITION) -#endif /* enabled assertions support code */ - /* Enable various levels of assertions. */ #if SDL_ASSERT_LEVEL == 0 /* assertions disabled */ # define SDL_assert(condition) SDL_disabled_assert(condition) diff --git a/libs/SDL2/include/SDL_atomic.h b/libs/SDL2/include/SDL_atomic.h index b29ceea..1dd816a 100644 --- a/libs/SDL2/include/SDL_atomic.h +++ b/libs/SDL2/include/SDL_atomic.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -237,6 +237,25 @@ typedef void (*SDL_KernelMemoryBarrierFunc)(); #endif #endif +/* "REP NOP" is PAUSE, coded for tools that don't know it by that name. */ +#if (defined(__GNUC__) || defined(__clang__)) && (defined(__i386__) || defined(__x86_64__)) + #define SDL_CPUPauseInstruction() __asm__ __volatile__("pause\n") /* Some assemblers can't do REP NOP, so go with PAUSE. */ +#elif (defined(__arm__) && defined(__ARM_ARCH) && __ARM_ARCH >= 7) || defined(__aarch64__) + #define SDL_CPUPauseInstruction() __asm__ __volatile__("yield" ::: "memory") +#elif (defined(__powerpc__) || defined(__powerpc64__)) + #define SDL_CPUPauseInstruction() __asm__ __volatile__("or 27,27,27"); +#elif defined(_MSC_VER) && (defined(_M_IX86) || defined(_M_X64)) + #define SDL_CPUPauseInstruction() _mm_pause() /* this is actually "rep nop" and not a SIMD instruction. No inline asm in MSVC x86-64! */ +#elif defined(_MSC_VER) && (defined(_M_ARM) || defined(_M_ARM64)) + #define SDL_CPUPauseInstruction() __yield() +#elif defined(__WATCOMC__) && defined(__386__) + extern __inline void SDL_CPUPauseInstruction(void); + #pragma aux SDL_CPUPauseInstruction = ".686p" ".xmm2" "pause" +#else + #define SDL_CPUPauseInstruction() +#endif + + /** * \brief A type representing an atomic integer value. It is a struct * so people don't accidentally use numeric operations on it. diff --git a/libs/SDL2/include/SDL_audio.h b/libs/SDL2/include/SDL_audio.h index 181f66c..ccd3598 100644 --- a/libs/SDL2/include/SDL_audio.h +++ b/libs/SDL2/include/SDL_audio.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -169,13 +169,13 @@ typedef void (SDLCALL * SDL_AudioCallback) (void *userdata, Uint8 * stream, * The calculated values in this structure are calculated by SDL_OpenAudio(). * * For multi-channel audio, the default SDL channel mapping is: - * 2: FL FR (stereo) - * 3: FL FR LFE (2.1 surround) - * 4: FL FR BL BR (quad) - * 5: FL FR FC BL BR (quad + center) - * 6: FL FR FC LFE SL SR (5.1 surround - last two can also be BL BR) - * 7: FL FR FC LFE BC SL SR (6.1 surround) - * 8: FL FR FC LFE BL BR SL SR (7.1 surround) + * 2: FL FR (stereo) + * 3: FL FR LFE (2.1 surround) + * 4: FL FR BL BR (quad) + * 5: FL FR LFE BL BR (4.1 surround) + * 6: FL FR FC LFE SL SR (5.1 surround - last two can also be BL BR) + * 7: FL FR FC LFE BC SL SR (6.1 surround) + * 8: FL FR FC LFE BL BR SL SR (7.1 surround) */ typedef struct SDL_AudioSpec { @@ -487,6 +487,7 @@ extern DECLSPEC int SDLCALL SDL_GetNumAudioDevices(int iscapture); * \since This function is available since SDL 2.0.0. * * \sa SDL_GetNumAudioDevices + * \sa SDL_GetDefaultAudioInfo */ extern DECLSPEC const char *SDLCALL SDL_GetAudioDeviceName(int index, int iscapture); @@ -500,9 +501,7 @@ extern DECLSPEC const char *SDLCALL SDL_GetAudioDeviceName(int index, * hardware. * * `spec` will be filled with the sample rate, sample format, and channel - * count. All other values in the structure are filled with 0. When the - * supported struct members are 0, SDL was unable to get the property from the - * backend. + * count. * * \param index the index of the audio device; valid values range from 0 to * SDL_GetNumAudioDevices() - 1 @@ -514,12 +513,48 @@ extern DECLSPEC const char *SDLCALL SDL_GetAudioDeviceName(int index, * \since This function is available since SDL 2.0.16. * * \sa SDL_GetNumAudioDevices + * \sa SDL_GetDefaultAudioInfo */ extern DECLSPEC int SDLCALL SDL_GetAudioDeviceSpec(int index, int iscapture, SDL_AudioSpec *spec); +/** + * Get the name and preferred format of the default audio device. + * + * Some (but not all!) platforms have an isolated mechanism to get information + * about the "default" device. This can actually be a completely different + * device that's not in the list you get from SDL_GetAudioDeviceSpec(). It can + * even be a network address! (This is discussed in SDL_OpenAudioDevice().) + * + * As a result, this call is not guaranteed to be performant, as it can query + * the sound server directly every time, unlike the other query functions. You + * should call this function sparingly! + * + * `spec` will be filled with the sample rate, sample format, and channel + * count, if a default device exists on the system. If `name` is provided, + * will be filled with either a dynamically-allocated UTF-8 string or NULL. + * + * \param name A pointer to be filled with the name of the default device (can + * be NULL). Please call SDL_free() when you are done with this + * pointer! + * \param spec The SDL_AudioSpec to be initialized by this function. + * \param iscapture non-zero to query the default recording device, zero to + * query the default output device. + * \returns 0 on success, nonzero on error + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GetAudioDeviceName + * \sa SDL_GetAudioDeviceSpec + * \sa SDL_OpenAudioDevice + */ +extern DECLSPEC int SDLCALL SDL_GetDefaultAudioInfo(char **name, + SDL_AudioSpec *spec, + int iscapture); + + /** * Open a specific audio device. * @@ -586,6 +621,7 @@ extern DECLSPEC int SDLCALL SDL_GetAudioDeviceSpec(int index, * - `SDL_AUDIO_ALLOW_FREQUENCY_CHANGE` * - `SDL_AUDIO_ALLOW_FORMAT_CHANGE` * - `SDL_AUDIO_ALLOW_CHANNELS_CHANGE` + * - `SDL_AUDIO_ALLOW_SAMPLES_CHANGE` * - `SDL_AUDIO_ALLOW_ANY_CHANGE` * * These flags specify how SDL should behave when a device cannot offer a diff --git a/libs/SDL2/include/SDL_bits.h b/libs/SDL2/include/SDL_bits.h index 22cb853..81161ae 100644 --- a/libs/SDL2/include/SDL_bits.h +++ b/libs/SDL2/include/SDL_bits.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_blendmode.h b/libs/SDL2/include/SDL_blendmode.h index b6d140d..4ecbe50 100644 --- a/libs/SDL2/include/SDL_blendmode.h +++ b/libs/SDL2/include/SDL_blendmode.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -52,7 +52,7 @@ typedef enum dstA = dstA */ SDL_BLENDMODE_MUL = 0x00000008, /**< color multiply dstRGB = (srcRGB * dstRGB) + (dstRGB * (1-srcA)) - dstA = (srcA * dstA) + (dstA * (1-srcA)) */ + dstA = dstA */ SDL_BLENDMODE_INVALID = 0x7FFFFFFF /* Additional custom blend modes can be returned by SDL_ComposeCustomBlendMode() */ @@ -67,9 +67,8 @@ typedef enum SDL_BLENDOPERATION_ADD = 0x1, /**< dst + src: supported by all renderers */ SDL_BLENDOPERATION_SUBTRACT = 0x2, /**< dst - src : supported by D3D9, D3D11, OpenGL, OpenGLES */ SDL_BLENDOPERATION_REV_SUBTRACT = 0x3, /**< src - dst : supported by D3D9, D3D11, OpenGL, OpenGLES */ - SDL_BLENDOPERATION_MINIMUM = 0x4, /**< min(dst, src) : supported by D3D11 */ - SDL_BLENDOPERATION_MAXIMUM = 0x5 /**< max(dst, src) : supported by D3D11 */ - + SDL_BLENDOPERATION_MINIMUM = 0x4, /**< min(dst, src) : supported by D3D9, D3D11 */ + SDL_BLENDOPERATION_MAXIMUM = 0x5 /**< max(dst, src) : supported by D3D9, D3D11 */ } SDL_BlendOperation; /** @@ -87,7 +86,6 @@ typedef enum SDL_BLENDFACTOR_ONE_MINUS_DST_COLOR = 0x8, /**< 1-dstR, 1-dstG, 1-dstB, 1-dstA */ SDL_BLENDFACTOR_DST_ALPHA = 0x9, /**< dstA, dstA, dstA, dstA */ SDL_BLENDFACTOR_ONE_MINUS_DST_ALPHA = 0xA /**< 1-dstA, 1-dstA, 1-dstA, 1-dstA */ - } SDL_BlendFactor; /** @@ -135,10 +133,10 @@ typedef enum * SDL 2.0.6. All renderers support the four blend modes listed in the * SDL_BlendMode enumeration. * - * - **direct3d**: Supports `SDL_BLENDOPERATION_ADD` with all factors. - * - **direct3d11**: Supports all operations with all factors. However, some + * - **direct3d**: Supports all operations with all factors. However, some * factors produce unexpected results with `SDL_BLENDOPERATION_MINIMUM` and * `SDL_BLENDOPERATION_MAXIMUM`. + * - **direct3d11**: Same as Direct3D 9. * - **opengl**: Supports the `SDL_BLENDOPERATION_ADD` operation with all * factors. OpenGL versions 1.1, 1.2, and 1.3 do not work correctly with SDL * 2.0.6. diff --git a/libs/SDL2/include/SDL_clipboard.h b/libs/SDL2/include/SDL_clipboard.h index 9351363..7c351fb 100644 --- a/libs/SDL2/include/SDL_clipboard.h +++ b/libs/SDL2/include/SDL_clipboard.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -82,6 +82,53 @@ extern DECLSPEC char * SDLCALL SDL_GetClipboardText(void); */ extern DECLSPEC SDL_bool SDLCALL SDL_HasClipboardText(void); +/** + * Put UTF-8 text into the primary selection. + * + * \param text the text to store in the primary selection + * \returns 0 on success or a negative error code on failure; call + * SDL_GetError() for more information. + * + * \since This function is available since SDL 2.26.0. + * + * \sa SDL_GetPrimarySelectionText + * \sa SDL_HasPrimarySelectionText + */ +extern DECLSPEC int SDLCALL SDL_SetPrimarySelectionText(const char *text); + +/** + * Get UTF-8 text from the primary selection, which must be freed with + * SDL_free(). + * + * This functions returns empty string if there was not enough memory left for + * a copy of the primary selection's content. + * + * \returns the primary selection text on success or an empty string on + * failure; call SDL_GetError() for more information. Caller must + * call SDL_free() on the returned pointer when done with it (even if + * there was an error). + * + * \since This function is available since SDL 2.26.0. + * + * \sa SDL_HasPrimarySelectionText + * \sa SDL_SetPrimarySelectionText + */ +extern DECLSPEC char * SDLCALL SDL_GetPrimarySelectionText(void); + +/** + * Query whether the primary selection exists and contains a non-empty text + * string. + * + * \returns SDL_TRUE if the primary selection has text, or SDL_FALSE if it + * does not. + * + * \since This function is available since SDL 2.26.0. + * + * \sa SDL_GetPrimarySelectionText + * \sa SDL_SetPrimarySelectionText + */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasPrimarySelectionText(void); + /* Ends C function definitions when using C++ */ #ifdef __cplusplus diff --git a/libs/SDL2/include/SDL_config.h b/libs/SDL2/include/SDL_config.h index 13014df..fd2fe88 100644 --- a/libs/SDL2/include/SDL_config.h +++ b/libs/SDL2/include/SDL_config.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -33,18 +33,22 @@ #include "SDL_config_windows.h" #elif defined(__WINRT__) #include "SDL_config_winrt.h" +#elif defined(__WINGDK__) +#include "SDL_config_wingdk.h" +#elif defined(__XBOXONE__) || defined(__XBOXSERIES__) +#include "SDL_config_xbox.h" #elif defined(__MACOSX__) #include "SDL_config_macosx.h" #elif defined(__IPHONEOS__) #include "SDL_config_iphoneos.h" #elif defined(__ANDROID__) #include "SDL_config_android.h" -#elif defined(__PSP__) -#include "SDL_config_psp.h" #elif defined(__OS2__) #include "SDL_config_os2.h" #elif defined(__EMSCRIPTEN__) #include "SDL_config_emscripten.h" +#elif defined(__NGAGE__) +#include "SDL_config_ngage.h" #else /* This is a minimal configuration just to get SDL running on new platforms. */ #include "SDL_config_minimal.h" diff --git a/libs/SDL2/include/SDL_config_android.h b/libs/SDL2/include/SDL_config_android.h index 4a13a3a..d88c026 100644 --- a/libs/SDL2/include/SDL_config_android.h +++ b/libs/SDL2/include/SDL_config_android.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -60,6 +60,7 @@ #define HAVE_SETENV 1 #define HAVE_UNSETENV 1 #define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 #define HAVE_ABS 1 #define HAVE_BCOPY 1 #define HAVE_MEMSET 1 @@ -84,6 +85,7 @@ #define HAVE_STRNCMP 1 #define HAVE_STRCASECMP 1 #define HAVE_STRNCASECMP 1 +#define HAVE_STRCASESTR 1 #define HAVE_VSSCANF 1 #define HAVE_VSNPRINTF 1 #define HAVE_ACOS 1 diff --git a/libs/SDL2/include/SDL_config_emscripten.h b/libs/SDL2/include/SDL_config_emscripten.h index 7efe323..68660a1 100644 --- a/libs/SDL2/include/SDL_config_emscripten.h +++ b/libs/SDL2/include/SDL_config_emscripten.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -69,6 +69,7 @@ #define HAVE_PUTENV 1 #define HAVE_UNSETENV 1 #define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 #define HAVE_ABS 1 #define HAVE_BCOPY 1 #define HAVE_MEMSET 1 @@ -185,6 +186,7 @@ /* Enable various threading systems */ #ifdef __EMSCRIPTEN_PTHREADS__ #define SDL_THREAD_PTHREAD 1 +#define SDL_THREAD_PTHREAD_RECURSIVE_MUTEX 1 #endif /* Enable various timer systems */ diff --git a/libs/SDL2/include/SDL_config_iphoneos.h b/libs/SDL2/include/SDL_config_iphoneos.h index 0aa2425..02011c4 100644 --- a/libs/SDL2/include/SDL_config_iphoneos.h +++ b/libs/SDL2/include/SDL_config_iphoneos.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -60,6 +60,7 @@ #define HAVE_SETENV 1 #define HAVE_UNSETENV 1 #define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 #define HAVE_ABS 1 #define HAVE_BCOPY 1 #define HAVE_MEMSET 1 @@ -84,6 +85,7 @@ #define HAVE_STRNCMP 1 #define HAVE_STRCASECMP 1 #define HAVE_STRNCASECMP 1 +#define HAVE_STRCASESTR 1 #define HAVE_VSSCANF 1 #define HAVE_VSNPRINTF 1 #define HAVE_M_PI 1 @@ -117,7 +119,7 @@ #define HAVE_LROUNDF 1 #define HAVE_POW 1 #define HAVE_POWF 1 -#define HAVE_ROUND 1 +#define HAVE_ROUND 1 #define HAVE_ROUNDF 1 #define HAVE_SCALBN 1 #define HAVE_SCALBNF 1 diff --git a/libs/SDL2/include/SDL_config_macosx.h b/libs/SDL2/include/SDL_config_macosx.h index ff42e3d..d7ad6cc 100644 --- a/libs/SDL2/include/SDL_config_macosx.h +++ b/libs/SDL2/include/SDL_config_macosx.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -63,6 +63,7 @@ #define HAVE_PUTENV 1 #define HAVE_UNSETENV 1 #define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 #define HAVE_ABS 1 #define HAVE_BCOPY 1 #define HAVE_MEMSET 1 @@ -87,6 +88,7 @@ #define HAVE_STRNCMP 1 #define HAVE_STRCASECMP 1 #define HAVE_STRNCASECMP 1 +#define HAVE_STRCASESTR 1 #define HAVE_VSSCANF 1 #define HAVE_VSNPRINTF 1 #define HAVE_M_PI 1 @@ -120,7 +122,7 @@ #define HAVE_LROUNDF 1 #define HAVE_POW 1 #define HAVE_POWF 1 -#define HAVE_ROUND 1 +#define HAVE_ROUND 1 #define HAVE_ROUNDF 1 #define HAVE_SCALBN 1 #define HAVE_SCALBNF 1 @@ -185,17 +187,13 @@ #undef SDL_VIDEO_DRIVER_X11 #define SDL_VIDEO_DRIVER_X11_DYNAMIC "/opt/X11/lib/libX11.6.dylib" #define SDL_VIDEO_DRIVER_X11_DYNAMIC_XEXT "/opt/X11/lib/libXext.6.dylib" -#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XINERAMA "/opt/X11/lib/libXinerama.1.dylib" #define SDL_VIDEO_DRIVER_X11_DYNAMIC_XINPUT2 "/opt/X11/lib/libXi.6.dylib" #define SDL_VIDEO_DRIVER_X11_DYNAMIC_XRANDR "/opt/X11/lib/libXrandr.2.dylib" #define SDL_VIDEO_DRIVER_X11_DYNAMIC_XSS "/opt/X11/lib/libXss.1.dylib" -#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XVIDMODE "/opt/X11/lib/libXxf86vm.1.dylib" #define SDL_VIDEO_DRIVER_X11_XDBE 1 -#define SDL_VIDEO_DRIVER_X11_XINERAMA 1 #define SDL_VIDEO_DRIVER_X11_XRANDR 1 #define SDL_VIDEO_DRIVER_X11_XSCRNSAVER 1 #define SDL_VIDEO_DRIVER_X11_XSHAPE 1 -#define SDL_VIDEO_DRIVER_X11_XVIDMODE 1 #define SDL_VIDEO_DRIVER_X11_HAS_XKBKEYCODETOKEYSYM 1 #ifdef MAC_OS_X_VERSION_10_8 @@ -272,7 +270,6 @@ #define SDL_FILESYSTEM_COCOA 1 /* Enable assembly routines */ -#define SDL_ASSEMBLY_ROUTINES 1 #ifdef __ppc__ #define SDL_ALTIVEC_BLITTERS 1 #endif diff --git a/libs/SDL2/include/SDL_config_minimal.h b/libs/SDL2/include/SDL_config_minimal.h index 4df92f7..d6dee64 100644 --- a/libs/SDL2/include/SDL_config_minimal.h +++ b/libs/SDL2/include/SDL_config_minimal.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -34,22 +34,29 @@ #define HAVE_STDARG_H 1 #define HAVE_STDDEF_H 1 +#if !defined(HAVE_STDINT_H) && !defined(_STDINT_H_) /* Most everything except Visual Studio 2008 and earlier has stdint.h now */ #if defined(_MSC_VER) && (_MSC_VER < 1600) -/* Here are some reasonable defaults */ -typedef unsigned int size_t; -typedef signed char int8_t; -typedef unsigned char uint8_t; -typedef signed short int16_t; -typedef unsigned short uint16_t; -typedef signed int int32_t; -typedef unsigned int uint32_t; -typedef signed long long int64_t; -typedef unsigned long long uint64_t; -typedef unsigned long uintptr_t; +typedef signed __int8 int8_t; +typedef unsigned __int8 uint8_t; +typedef signed __int16 int16_t; +typedef unsigned __int16 uint16_t; +typedef signed __int32 int32_t; +typedef unsigned __int32 uint32_t; +typedef signed __int64 int64_t; +typedef unsigned __int64 uint64_t; +#ifndef _UINTPTR_T_DEFINED +#ifdef _WIN64 +typedef unsigned __int64 uintptr_t; +#else +typedef unsigned int uintptr_t; +#endif +#define _UINTPTR_T_DEFINED +#endif #else #define HAVE_STDINT_H 1 #endif /* Visual Studio 2008 */ +#endif /* !_STDINT_H_ && !HAVE_STDINT_H */ #ifdef __GNUC__ #define HAVE_GCC_SYNC_LOCK_TEST_AND_SET 1 diff --git a/libs/SDL2/include/SDL_config_ngage.h b/libs/SDL2/include/SDL_config_ngage.h new file mode 100644 index 0000000..25453b3 --- /dev/null +++ b/libs/SDL2/include/SDL_config_ngage.h @@ -0,0 +1,89 @@ +/* + Simple DirectMedia Layer + Copyright (C) 1997-2023 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifndef SDL_config_ngage_h_ +#define SDL_config_ngage_h_ +#define SDL_config_h_ + +#include "SDL_platform.h" + +typedef signed char int8_t; +typedef unsigned char uint8_t; +typedef signed short int16_t; +typedef unsigned short uint16_t; +typedef signed int int32_t; +typedef unsigned int uint32_t; +typedef signed long long int64_t; +typedef unsigned long long uint64_t; +typedef unsigned long uintptr_t; + +#define HAVE_STDARG_H 1 +#define HAVE_STDDEF_H 1 +#define HAVE_STDIO_H 1 +#define HAVE_STDLIB_H 1 +#define HAVE_MATH_H 1 +#define HAVE_CEIL 1 +#define HAVE_COPYSIGN 1 +#define HAVE_COS 1 +#define HAVE_EXP 1 +#define HAVE_FABS 1 +#define HAVE_FLOOR 1 +#define HAVE_LOG 1 +#define HAVE_LOG10 1 +#define HAVE_SCALBN 1 +#define HAVE_SIN 1 +#define HAVE_SQRT 1 +#define HAVE_TAN 1 +#define HAVE_MALLOC 1 +#define SDL_MAIN_NEEDED 1 +#define LACKS_SYS_MMAN_H 1 + +/* Enable the N-Gage thread support (src/thread/ngage/\*.c) */ +#define SDL_THREAD_NGAGE 1 + +/* Enable the N-Gage timer support (src/timer/ngage/\*.c) */ +#define SDL_TIMER_NGAGE 1 + +/* Enable the N-Gage video driver (src/video/ngage/\*.c) */ +#define SDL_VIDEO_DRIVER_NGAGE 1 + +/* Enable the dummy audio driver (src/audio/dummy/\*.c) */ +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable the stub joystick driver (src/joystick/dummy/\*.c) */ +#define SDL_JOYSTICK_DISABLED 1 + +/* Enable the stub haptic driver (src/haptic/dummy/\*.c) */ +#define SDL_HAPTIC_DISABLED 1 + +/* Enable the stub HIDAPI */ +#define SDL_HIDAPI_DISABLED 1 + +/* Enable the stub sensor driver (src/sensor/dummy/\*.c) */ +#define SDL_SENSOR_DISABLED 1 + +/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */ +#define SDL_LOADSO_DISABLED 1 + +/* Enable the dummy filesystem driver (src/filesystem/dummy/\*.c) */ +#define SDL_FILESYSTEM_DUMMY 1 + +#endif /* SDL_config_ngage_h_ */ diff --git a/libs/SDL2/include/SDL_config_os2.h b/libs/SDL2/include/SDL_config_os2.h index 1728bd7..2effe1a 100644 --- a/libs/SDL2/include/SDL_config_os2.h +++ b/libs/SDL2/include/SDL_config_os2.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -43,6 +43,7 @@ /*#undef SDL_JOYSTICK_HIDAPI */ #else #define SDL_JOYSTICK_HIDAPI 1 +#define HAVE_LIBUSB 1 /* dynamically loaded libusb-1.0 dll: */ #define SDL_LIBUSB_DYNAMIC "usb100.dll" #endif @@ -56,9 +57,6 @@ #define SDL_TIMER_OS2 1 #define SDL_FILESYSTEM_OS2 1 -/* Enable assembly routines */ -#define SDL_ASSEMBLY_ROUTINES 1 - /* use libsamplerate for audio rate conversion. */ /*#define HAVE_LIBSAMPLERATE_H 1 */ @@ -105,7 +103,11 @@ #define HAVE_GETENV 1 #define HAVE_SETENV 1 #define HAVE_PUTENV 1 +/* OpenWatcom requires specific calling conventions for qsort and bsearch */ +#ifndef __WATCOMC__ #define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 +#endif #define HAVE_ABS 1 #define HAVE_BCOPY 1 #define HAVE_MEMSET 1 diff --git a/libs/SDL2/include/SDL_config_pandora.h b/libs/SDL2/include/SDL_config_pandora.h index e0be390..c74fa0c 100644 --- a/libs/SDL2/include/SDL_config_pandora.h +++ b/libs/SDL2/include/SDL_config_pandora.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -65,6 +65,7 @@ #define HAVE_PUTENV 1 #define HAVE_UNSETENV 1 #define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 #define HAVE_ABS 1 #define HAVE_BCOPY 1 #define HAVE_MEMSET 1 diff --git a/libs/SDL2/include/SDL_config_psp.h b/libs/SDL2/include/SDL_config_psp.h deleted file mode 100644 index 72c1eb6..0000000 --- a/libs/SDL2/include/SDL_config_psp.h +++ /dev/null @@ -1,165 +0,0 @@ -/* - Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga - - This software is provided 'as-is', without any express or implied - warranty. In no event will the authors be held liable for any damages - arising from the use of this software. - - Permission is granted to anyone to use this software for any purpose, - including commercial applications, and to alter it and redistribute it - freely, subject to the following restrictions: - - 1. The origin of this software must not be misrepresented; you must not - claim that you wrote the original software. If you use this software - in a product, an acknowledgment in the product documentation would be - appreciated but is not required. - 2. Altered source versions must be plainly marked as such, and must not be - misrepresented as being the original software. - 3. This notice may not be removed or altered from any source distribution. -*/ - -#ifndef SDL_config_psp_h_ -#define SDL_config_psp_h_ -#define SDL_config_h_ - -#include "SDL_platform.h" - -#ifdef __GNUC__ -#define HAVE_GCC_SYNC_LOCK_TEST_AND_SET 1 -#endif - -#define HAVE_GCC_ATOMICS 1 - -#define STDC_HEADERS 1 -#define HAVE_ALLOCA_H 1 -#define HAVE_CTYPE_H 1 -#define HAVE_INTTYPES_H 1 -#define HAVE_LIMITS_H 1 -#define HAVE_MATH_H 1 -#define HAVE_SIGNAL_H 1 -#define HAVE_STDINT_H 1 -#define HAVE_STDIO_H 1 -#define HAVE_STRING_H 1 -#define HAVE_SYS_TYPES_H 1 - -/* C library functions */ -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -#define HAVE_ALLOCA 1 -#define HAVE_GETENV 1 -#define HAVE_SETENV 1 -#define HAVE_PUTENV 1 -#define HAVE_SETENV 1 -#define HAVE_UNSETENV 1 -#define HAVE_QSORT 1 -#define HAVE_ABS 1 -#define HAVE_BCOPY 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_MEMCMP 1 -#define HAVE_STRLEN 1 -#define HAVE_STRLCPY 1 -#define HAVE_STRLCAT 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_STRTOL 1 -#define HAVE_STRTOUL 1 -#define HAVE_STRTOLL 1 -#define HAVE_STRTOULL 1 -#define HAVE_STRTOD 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -#define HAVE_STRCASECMP 1 -#define HAVE_STRNCASECMP 1 -#define HAVE_VSSCANF 1 -#define HAVE_VSNPRINTF 1 -#define HAVE_M_PI 1 -#define HAVE_ACOS 1 -#define HAVE_ACOSF 1 -#define HAVE_ASIN 1 -#define HAVE_ASINF 1 -#define HAVE_ATAN 1 -#define HAVE_ATANF 1 -#define HAVE_ATAN2 1 -#define HAVE_ATAN2F 1 -#define HAVE_CEIL 1 -#define HAVE_CEILF 1 -#define HAVE_COPYSIGN 1 -#define HAVE_COPYSIGNF 1 -#define HAVE_COS 1 -#define HAVE_COSF 1 -#define HAVE_EXP 1 -#define HAVE_EXPF 1 -#define HAVE_FABS 1 -#define HAVE_FABSF 1 -#define HAVE_FLOOR 1 -#define HAVE_FLOORF 1 -#define HAVE_FMOD 1 -#define HAVE_FMODF 1 -#define HAVE_LOG 1 -#define HAVE_LOGF 1 -#define HAVE_LOG10 1 -#define HAVE_LOG10F 1 -#define HAVE_POW 1 -#define HAVE_POWF 1 -#define HAVE_SCALBN 1 -#define HAVE_SCALBNF 1 -#define HAVE_SIN 1 -#define HAVE_SINF 1 -#define HAVE_SQRT 1 -#define HAVE_SQRTF 1 -#define HAVE_TAN 1 -#define HAVE_TANF 1 -#define HAVE_SETJMP 1 -#define HAVE_NANOSLEEP 1 -/* #define HAVE_SYSCONF 1 */ -/* #define HAVE_SIGACTION 1 */ - - -/* PSP isn't that sophisticated */ -#define LACKS_SYS_MMAN_H 1 - -/* Enable the PSP thread support (src/thread/psp/\*.c) */ -#define SDL_THREAD_PSP 1 - -/* Enable the PSP timer support (src/timer/psp/\*.c) */ -#define SDL_TIMER_PSP 1 - -/* Enable the PSP joystick driver (src/joystick/psp/\*.c) */ -#define SDL_JOYSTICK_PSP 1 -#define SDL_JOYSTICK_VIRTUAL 1 - -/* Enable the dummy sensor driver */ -#define SDL_SENSOR_DUMMY 1 - -/* Enable the PSP audio driver (src/audio/psp/\*.c) */ -#define SDL_AUDIO_DRIVER_PSP 1 - -/* PSP video driver */ -#define SDL_VIDEO_DRIVER_PSP 1 - -/* PSP render driver */ -#define SDL_VIDEO_RENDER_PSP 1 - -#define SDL_POWER_PSP 1 - -/* Enable the PSP filesystem support (src/filesystem/psp/\*.c) */ -#define SDL_FILESYSTEM_PSP 1 - -/* PSP doesn't have haptic device (src/haptic/dummy/\*.c) */ -#define SDL_HAPTIC_DISABLED 1 - -/* PSP doesn't have HIDAPI available */ -#define SDL_HIDAPI_DISABLED 1 - -/* PSP can't load shared object (src/loadso/dummy/\*.c) */ -#define SDL_LOADSO_DISABLED 1 - -#endif /* SDL_config_psp_h_ */ diff --git a/libs/SDL2/include/SDL_config_windows.h b/libs/SDL2/include/SDL_config_windows.h index c9ed1cf..01322c1 100644 --- a/libs/SDL2/include/SDL_config_windows.h +++ b/libs/SDL2/include/SDL_config_windows.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -38,12 +38,23 @@ #include #endif +/* sdkddkver.h defines more specific SDK version numbers. This is needed because older versions of the + * Windows 10 SDK have broken declarations for the C API for DirectX 12. */ +#if !defined(HAVE_SDKDDKVER_H) && defined(__has_include) +#if __has_include() +#define HAVE_SDKDDKVER_H 1 +#endif +#endif + +#ifdef HAVE_SDKDDKVER_H +#include +#endif + /* This is a set of defines to configure the SDL features */ -#if !defined(_STDINT_H_) && (!defined(HAVE_STDINT_H) || !_HAVE_STDINT_H) -#if defined(__GNUC__) || defined(__DMC__) || defined(__WATCOMC__) || defined(__clang__) || defined(__BORLANDC__) || defined(__CODEGEARC__) -#define HAVE_STDINT_H 1 -#elif defined(_MSC_VER) +#if !defined(HAVE_STDINT_H) && !defined(_STDINT_H_) +/* Most everything except Visual Studio 2008 and earlier has stdint.h now */ +#if defined(_MSC_VER) && (_MSC_VER < 1600) typedef signed __int8 int8_t; typedef unsigned __int8 uint8_t; typedef signed __int16 int16_t; @@ -60,28 +71,9 @@ typedef unsigned int uintptr_t; #endif #define _UINTPTR_T_DEFINED #endif -/* Older Visual C++ headers don't have the Win64-compatible typedefs... */ -#if ((_MSC_VER <= 1200) && (!defined(DWORD_PTR))) -#define DWORD_PTR DWORD -#endif -#if ((_MSC_VER <= 1200) && (!defined(LONG_PTR))) -#define LONG_PTR LONG -#endif -#else /* !__GNUC__ && !_MSC_VER */ -typedef signed char int8_t; -typedef unsigned char uint8_t; -typedef signed short int16_t; -typedef unsigned short uint16_t; -typedef signed int int32_t; -typedef unsigned int uint32_t; -typedef signed long long int64_t; -typedef unsigned long long uint64_t; -#ifndef _SIZE_T_DEFINED_ -#define _SIZE_T_DEFINED_ -typedef unsigned int size_t; -#endif -typedef unsigned int uintptr_t; -#endif /* __GNUC__ || _MSC_VER */ +#else +#define HAVE_STDINT_H 1 +#endif /* Visual Studio 2008 */ #endif /* !_STDINT_H_ && !HAVE_STDINT_H */ #ifdef _WIN64 @@ -90,9 +82,14 @@ typedef unsigned int uintptr_t; # define SIZEOF_VOIDP 4 #endif +#ifdef __clang__ +# define HAVE_GCC_ATOMICS 1 +#endif + #define HAVE_DDRAW_H 1 #define HAVE_DINPUT_H 1 #define HAVE_DSOUND_H 1 +#ifndef __WATCOMC__ #define HAVE_DXGI_H 1 #define HAVE_XINPUT_H 1 #if defined(_WIN32_MAXVER) && _WIN32_MAXVER >= 0x0A00 /* Windows 10 SDK */ @@ -100,11 +97,19 @@ typedef unsigned int uintptr_t; #endif #if defined(_WIN32_MAXVER) && _WIN32_MAXVER >= 0x0602 /* Windows 8 SDK */ #define HAVE_D3D11_H 1 +#define HAVE_ROAPI_H 1 +#endif +#if defined(WDK_NTDDI_VERSION) && WDK_NTDDI_VERSION > 0x0A000008 /* 10.0.19041.0 */ +#define HAVE_D3D12_H 1 +#endif +#if defined(_WIN32_MAXVER) && _WIN32_MAXVER >= 0x0603 /* Windows 8.1 SDK */ +#define HAVE_SHELLSCALINGAPI_H 1 #endif #define HAVE_MMDEVICEAPI_H 1 #define HAVE_AUDIOCLIENT_H 1 #define HAVE_TPCSHRD_H 1 #define HAVE_SENSORSAPI_H 1 +#endif #if (defined(_M_IX86) || defined(_M_X64) || defined(_M_AMD64)) && (defined(_MSC_VER) && _MSC_VER >= 1600) #define HAVE_IMMINTRIN_H 1 #elif defined(__has_include) && (defined(__i386__) || defined(__x86_64)) @@ -131,7 +136,11 @@ typedef unsigned int uintptr_t; #define HAVE_REALLOC 1 #define HAVE_FREE 1 #define HAVE_ALLOCA 1 +/* OpenWatcom requires specific calling conventions for qsort and bsearch */ +#ifndef __WATCOMC__ #define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 +#endif #define HAVE_ABS 1 #define HAVE_MEMSET 1 #define HAVE_MEMCPY 1 @@ -162,37 +171,40 @@ typedef unsigned int uintptr_t; #define HAVE__WCSNICMP 1 #define HAVE__WCSDUP 1 #define HAVE_ACOS 1 -#define HAVE_ACOSF 1 #define HAVE_ASIN 1 -#define HAVE_ASINF 1 #define HAVE_ATAN 1 -#define HAVE_ATANF 1 #define HAVE_ATAN2 1 +#define HAVE_CEIL 1 +#define HAVE_COS 1 +#define HAVE_EXP 1 +#define HAVE_FABS 1 +#define HAVE_FLOOR 1 +#define HAVE_FMOD 1 +#define HAVE_LOG 1 +#define HAVE_LOG10 1 +#define HAVE_POW 1 +#define HAVE_SIN 1 +#define HAVE_SQRT 1 +#define HAVE_TAN 1 +#ifndef __WATCOMC__ +#define HAVE_ACOSF 1 +#define HAVE_ASINF 1 +#define HAVE_ATANF 1 #define HAVE_ATAN2F 1 #define HAVE_CEILF 1 #define HAVE__COPYSIGN 1 -#define HAVE_COS 1 #define HAVE_COSF 1 -#define HAVE_EXP 1 #define HAVE_EXPF 1 -#define HAVE_FABS 1 #define HAVE_FABSF 1 -#define HAVE_FLOOR 1 #define HAVE_FLOORF 1 -#define HAVE_FMOD 1 #define HAVE_FMODF 1 -#define HAVE_LOG 1 #define HAVE_LOGF 1 -#define HAVE_LOG10 1 #define HAVE_LOG10F 1 -#define HAVE_POW 1 #define HAVE_POWF 1 -#define HAVE_SIN 1 #define HAVE_SINF 1 -#define HAVE_SQRT 1 #define HAVE_SQRTF 1 -#define HAVE_TAN 1 #define HAVE_TANF 1 +#endif #if defined(_MSC_VER) /* These functions were added with the VC++ 2013 C runtime library */ #if _MSC_VER >= 1800 @@ -212,8 +224,18 @@ typedef unsigned int uintptr_t; #if _MSC_VER >= 1400 #define HAVE__FSEEKI64 1 #endif +#ifdef _USE_MATH_DEFINES +#define HAVE_M_PI 1 #endif -#if !defined(_MSC_VER) || defined(_USE_MATH_DEFINES) +#elif defined(__WATCOMC__) +#define HAVE__FSEEKI64 1 +#define HAVE_STRTOLL 1 +#define HAVE_STRTOULL 1 +#define HAVE_VSSCANF 1 +#define HAVE_ROUND 1 +#define HAVE_SCALBN 1 +#define HAVE_TRUNC 1 +#else #define HAVE_M_PI 1 #endif #else @@ -222,7 +244,9 @@ typedef unsigned int uintptr_t; #endif /* Enable various audio drivers */ +#if defined(HAVE_MMDEVICEAPI_H) && defined(HAVE_AUDIOCLIENT_H) #define SDL_AUDIO_DRIVER_WASAPI 1 +#endif #define SDL_AUDIO_DRIVER_DSOUND 1 #define SDL_AUDIO_DRIVER_WINMM 1 #define SDL_AUDIO_DRIVER_DISK 1 @@ -243,7 +267,11 @@ typedef unsigned int uintptr_t; #define SDL_HAPTIC_XINPUT 1 /* Enable the sensor driver */ +#ifdef HAVE_SENSORSAPI_H #define SDL_SENSOR_WINDOWS 1 +#else +#define SDL_SENSOR_DUMMY 1 +#endif /* Enable various shared object loading systems */ #define SDL_LOADSO_WINDOWS 1 @@ -265,6 +293,9 @@ typedef unsigned int uintptr_t; #if !defined(SDL_VIDEO_RENDER_D3D11) && defined(HAVE_D3D11_H) #define SDL_VIDEO_RENDER_D3D11 1 #endif +#if !defined(SDL_VIDEO_RENDER_D3D12) && defined(HAVE_D3D12_H) +#define SDL_VIDEO_RENDER_D3D12 1 +#endif /* Enable OpenGL support */ #ifndef SDL_VIDEO_OPENGL @@ -295,11 +326,6 @@ typedef unsigned int uintptr_t; /* Enable filesystem support */ #define SDL_FILESYSTEM_WINDOWS 1 -/* Enable assembly routines (Win64 doesn't have inline asm) */ -#ifndef _WIN64 -#define SDL_ASSEMBLY_ROUTINES 1 -#endif - #endif /* SDL_config_windows_h_ */ /* vi: set ts=4 sw=4 expandtab: */ diff --git a/libs/SDL2/include/SDL_config_wingdk.h b/libs/SDL2/include/SDL_config_wingdk.h new file mode 100644 index 0000000..f9d3ff4 --- /dev/null +++ b/libs/SDL2/include/SDL_config_wingdk.h @@ -0,0 +1,253 @@ +/* + Simple DirectMedia Layer + Copyright (C) 1997-2023 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifndef SDL_config_wingdk_h_ +#define SDL_config_wingdk_h_ +#define SDL_config_h_ + +#include "SDL_platform.h" + +/* Windows GDK does not need Windows SDK version checks because it requires + * a recent version of the Windows 10 SDK. */ + +/* GDK only supports 64-bit */ +# define SIZEOF_VOIDP 8 + +#ifdef __clang__ +# define HAVE_GCC_ATOMICS 1 +#endif + +#define HAVE_DDRAW_H 1 +#define HAVE_DINPUT_H 1 +#define HAVE_DSOUND_H 1 +/* No SDK version checks needed for these because the SDK has to be new. */ +#define HAVE_DXGI_H 1 +#define HAVE_XINPUT_H 1 +#define HAVE_WINDOWS_GAMING_INPUT_H 1 +#define HAVE_D3D11_H 1 +#define HAVE_ROAPI_H 1 +#define HAVE_D3D12_H 1 +#define HAVE_SHELLSCALINGAPI_H 1 +#define HAVE_MMDEVICEAPI_H 1 +#define HAVE_AUDIOCLIENT_H 1 +#define HAVE_TPCSHRD_H 1 +#define HAVE_SENSORSAPI_H 1 +#if (defined(_M_IX86) || defined(_M_X64) || defined(_M_AMD64)) && (defined(_MSC_VER) && _MSC_VER >= 1600) +#define HAVE_IMMINTRIN_H 1 +#elif defined(__has_include) && (defined(__i386__) || defined(__x86_64)) +# if __has_include() +# define HAVE_IMMINTRIN_H 1 +# endif +#endif + +/* This is disabled by default to avoid C runtime dependencies and manifest requirements */ +#ifdef HAVE_LIBC +/* Useful headers */ +#define STDC_HEADERS 1 +#define HAVE_CTYPE_H 1 +#define HAVE_FLOAT_H 1 +#define HAVE_LIMITS_H 1 +#define HAVE_MATH_H 1 +#define HAVE_SIGNAL_H 1 +#define HAVE_STDINT_H 1 +#define HAVE_STDIO_H 1 +#define HAVE_STRING_H 1 + +/* C library functions */ +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +#define HAVE_ALLOCA 1 +#define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 +#define HAVE_ABS 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_MEMCMP 1 +#define HAVE_STRLEN 1 +#define HAVE__STRREV 1 +/* These functions have security warnings, so we won't use them */ +/* #undef HAVE__STRUPR */ +/* #undef HAVE__STRLWR */ +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +/* #undef HAVE_STRTOK_R */ +/* These functions have security warnings, so we won't use them */ +/* #undef HAVE__LTOA */ +/* #undef HAVE__ULTOA */ +#define HAVE_STRTOL 1 +#define HAVE_STRTOUL 1 +#define HAVE_STRTOD 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +#define HAVE__STRICMP 1 +#define HAVE__STRNICMP 1 +#define HAVE__WCSICMP 1 +#define HAVE__WCSNICMP 1 +#define HAVE__WCSDUP 1 +#define HAVE_ACOS 1 +#define HAVE_ASIN 1 +#define HAVE_ATAN 1 +#define HAVE_ATAN2 1 +#define HAVE_CEIL 1 +#define HAVE_COS 1 +#define HAVE_EXP 1 +#define HAVE_FABS 1 +#define HAVE_FLOOR 1 +#define HAVE_FMOD 1 +#define HAVE_LOG 1 +#define HAVE_LOG10 1 +#define HAVE_POW 1 +#define HAVE_SIN 1 +#define HAVE_SQRT 1 +#define HAVE_TAN 1 +#define HAVE_ACOSF 1 +#define HAVE_ASINF 1 +#define HAVE_ATANF 1 +#define HAVE_ATAN2F 1 +#define HAVE_CEILF 1 +#define HAVE__COPYSIGN 1 +#define HAVE_COSF 1 +#define HAVE_EXPF 1 +#define HAVE_FABSF 1 +#define HAVE_FLOORF 1 +#define HAVE_FMODF 1 +#define HAVE_LOGF 1 +#define HAVE_LOG10F 1 +#define HAVE_POWF 1 +#define HAVE_SINF 1 +#define HAVE_SQRTF 1 +#define HAVE_TANF 1 +#if defined(_MSC_VER) +/* These functions were added with the VC++ 2013 C runtime library */ +#define HAVE_STRTOLL 1 +#define HAVE_STRTOULL 1 +#define HAVE_VSSCANF 1 +#define HAVE_LROUND 1 +#define HAVE_LROUNDF 1 +#define HAVE_ROUND 1 +#define HAVE_ROUNDF 1 +#define HAVE_SCALBN 1 +#define HAVE_SCALBNF 1 +#define HAVE_TRUNC 1 +#define HAVE_TRUNCF 1 +#define HAVE__FSEEKI64 1 +#ifdef _USE_MATH_DEFINES +#define HAVE_M_PI 1 +#endif +#else +#define HAVE_M_PI 1 +#endif +#else +#define HAVE_STDARG_H 1 +#define HAVE_STDDEF_H 1 +#define HAVE_STDINT_H 1 +#endif + +/* Enable various audio drivers */ +#if defined(HAVE_MMDEVICEAPI_H) && defined(HAVE_AUDIOCLIENT_H) +#define SDL_AUDIO_DRIVER_WASAPI 1 +#endif +#define SDL_AUDIO_DRIVER_DSOUND 1 +#define SDL_AUDIO_DRIVER_WINMM 1 +#define SDL_AUDIO_DRIVER_DISK 1 +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable various input drivers */ +#define SDL_JOYSTICK_DINPUT 1 +#define SDL_JOYSTICK_HIDAPI 1 +#define SDL_JOYSTICK_RAWINPUT 1 +#define SDL_JOYSTICK_VIRTUAL 1 +#ifdef HAVE_WINDOWS_GAMING_INPUT_H +#define SDL_JOYSTICK_WGI 1 +#endif +#define SDL_JOYSTICK_XINPUT 1 +#define SDL_HAPTIC_DINPUT 1 +#define SDL_HAPTIC_XINPUT 1 + +/* Enable the sensor driver */ +#ifdef HAVE_SENSORSAPI_H +#define SDL_SENSOR_WINDOWS 1 +#else +#define SDL_SENSOR_DUMMY 1 +#endif + +/* Enable various shared object loading systems */ +#define SDL_LOADSO_WINDOWS 1 + +/* Enable various threading systems */ +#define SDL_THREAD_GENERIC_COND_SUFFIX 1 +#define SDL_THREAD_WINDOWS 1 + +/* Enable various timer systems */ +#define SDL_TIMER_WINDOWS 1 + +/* Enable various video drivers */ +#define SDL_VIDEO_DRIVER_DUMMY 1 +#define SDL_VIDEO_DRIVER_WINDOWS 1 + +#ifndef SDL_VIDEO_RENDER_D3D +#define SDL_VIDEO_RENDER_D3D 1 +#endif +#if !defined(SDL_VIDEO_RENDER_D3D11) && defined(HAVE_D3D11_H) +#define SDL_VIDEO_RENDER_D3D11 1 +#endif +#if !defined(SDL_VIDEO_RENDER_D3D12) && defined(HAVE_D3D12_H) +#define SDL_VIDEO_RENDER_D3D12 1 +#endif + +/* Enable OpenGL support */ +#ifndef SDL_VIDEO_OPENGL +#define SDL_VIDEO_OPENGL 1 +#endif +#ifndef SDL_VIDEO_OPENGL_WGL +#define SDL_VIDEO_OPENGL_WGL 1 +#endif +#ifndef SDL_VIDEO_RENDER_OGL +#define SDL_VIDEO_RENDER_OGL 1 +#endif +#ifndef SDL_VIDEO_RENDER_OGL_ES2 +#define SDL_VIDEO_RENDER_OGL_ES2 1 +#endif +#ifndef SDL_VIDEO_OPENGL_ES2 +#define SDL_VIDEO_OPENGL_ES2 1 +#endif +#ifndef SDL_VIDEO_OPENGL_EGL +#define SDL_VIDEO_OPENGL_EGL 1 +#endif + +/* Enable Vulkan support */ +#define SDL_VIDEO_VULKAN 1 + +/* Enable system power support */ +#define SDL_POWER_WINDOWS 1 + +/* Enable filesystem support */ +#define SDL_FILESYSTEM_WINDOWS 1 + +#endif /* SDL_config_wingdk_h_ */ + +/* vi: set ts=4 sw=4 expandtab: */ diff --git a/libs/SDL2/include/SDL_config_winrt.h b/libs/SDL2/include/SDL_config_winrt.h index 690ffe1..8efde90 100644 --- a/libs/SDL2/include/SDL_config_winrt.h +++ b/libs/SDL2/include/SDL_config_winrt.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -42,56 +42,16 @@ /* This is a set of defines to configure the SDL features */ -#if !defined(_STDINT_H_) && (!defined(HAVE_STDINT_H) || !_HAVE_STDINT_H) -#if defined(__GNUC__) || defined(__DMC__) || defined(__WATCOMC__) -#define HAVE_STDINT_H 1 -#elif defined(_MSC_VER) -typedef signed __int8 int8_t; -typedef unsigned __int8 uint8_t; -typedef signed __int16 int16_t; -typedef unsigned __int16 uint16_t; -typedef signed __int32 int32_t; -typedef unsigned __int32 uint32_t; -typedef signed __int64 int64_t; -typedef unsigned __int64 uint64_t; -#ifndef _UINTPTR_T_DEFINED -#ifdef _WIN64 -typedef unsigned __int64 uintptr_t; -#else -typedef unsigned int uintptr_t; -#endif -#define _UINTPTR_T_DEFINED -#endif -/* Older Visual C++ headers don't have the Win64-compatible typedefs... */ -#if ((_MSC_VER <= 1200) && (!defined(DWORD_PTR))) -#define DWORD_PTR DWORD -#endif -#if ((_MSC_VER <= 1200) && (!defined(LONG_PTR))) -#define LONG_PTR LONG -#endif -#else /* !__GNUC__ && !_MSC_VER */ -typedef signed char int8_t; -typedef unsigned char uint8_t; -typedef signed short int16_t; -typedef unsigned short uint16_t; -typedef signed int int32_t; -typedef unsigned int uint32_t; -typedef signed long long int64_t; -typedef unsigned long long uint64_t; -#ifndef _SIZE_T_DEFINED_ -#define _SIZE_T_DEFINED_ -typedef unsigned int size_t; -#endif -typedef unsigned int uintptr_t; -#endif /* __GNUC__ || _MSC_VER */ -#endif /* !_STDINT_H_ && !HAVE_STDINT_H */ - #ifdef _WIN64 # define SIZEOF_VOIDP 8 #else # define SIZEOF_VOIDP 4 #endif +#ifdef __clang__ +# define HAVE_GCC_ATOMICS 1 +#endif + /* Useful headers */ #define HAVE_DXGI_H 1 #if WINAPI_FAMILY != WINAPI_FAMILY_PHONE_APP @@ -109,6 +69,7 @@ typedef unsigned int uintptr_t; #define HAVE_LIMITS_H 1 #define HAVE_MATH_H 1 #define HAVE_SIGNAL_H 1 +#define HAVE_STDINT_H 1 #define HAVE_STDIO_H 1 #define HAVE_STRING_H 1 @@ -119,6 +80,7 @@ typedef unsigned int uintptr_t; #define HAVE_FREE 1 #define HAVE_ALLOCA 1 #define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 #define HAVE_ABS 1 #define HAVE_MEMSET 1 #define HAVE_MEMCPY 1 @@ -191,6 +153,8 @@ typedef unsigned int uintptr_t; #define HAVE_TRUNCF 1 #define HAVE__FSEEKI64 1 +#define HAVE_ROAPI_H 1 + /* Enable various audio drivers */ #define SDL_AUDIO_DRIVER_WASAPI 1 #define SDL_AUDIO_DRIVER_DISK 1 @@ -243,6 +207,9 @@ typedef unsigned int uintptr_t; /* Enable appropriate renderer(s) */ #define SDL_VIDEO_RENDER_D3D11 1 +/* Disable D3D12 as it's not implemented for WinRT */ +#define SDL_VIDEO_RENDER_D3D12 0 + #if SDL_VIDEO_OPENGL_ES2 #define SDL_VIDEO_RENDER_OGL_ES2 1 #endif @@ -250,9 +217,4 @@ typedef unsigned int uintptr_t; /* Enable system power support */ #define SDL_POWER_WINRT 1 -/* Enable assembly routines (Win64 doesn't have inline asm) */ -#ifndef _WIN64 -#define SDL_ASSEMBLY_ROUTINES 1 -#endif - #endif /* SDL_config_winrt_h_ */ diff --git a/libs/SDL2/include/SDL_config_wiz.h b/libs/SDL2/include/SDL_config_wiz.h deleted file mode 100644 index 29b8242..0000000 --- a/libs/SDL2/include/SDL_config_wiz.h +++ /dev/null @@ -1,154 +0,0 @@ -/* - Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga - - This software is provided 'as-is', without any express or implied - warranty. In no event will the authors be held liable for any damages - arising from the use of this software. - - Permission is granted to anyone to use this software for any purpose, - including commercial applications, and to alter it and redistribute it - freely, subject to the following restrictions: - - 1. The origin of this software must not be misrepresented; you must not - claim that you wrote the original software. If you use this software - in a product, an acknowledgment in the product documentation would be - appreciated but is not required. - 2. Altered source versions must be plainly marked as such, and must not be - misrepresented as being the original software. - 3. This notice may not be removed or altered from any source distribution. -*/ - -#ifndef SDL_config_wiz_h_ -#define SDL_config_wiz_h_ -#define SDL_config_h_ - -/* This is a set of defines to configure the SDL features */ - -/* General platform specific identifiers */ -#include "SDL_platform.h" - -#define SDL_BYTEORDER 1234 - -#define STDC_HEADERS 1 -#define HAVE_ALLOCA_H 1 -#define HAVE_CTYPE_H 1 -#define HAVE_ICONV_H 1 -#define HAVE_INTTYPES_H 1 -#define HAVE_LIMITS_H 1 -#define HAVE_MALLOC_H 1 -#define HAVE_MATH_H 1 -#define HAVE_MEMORY_H 1 -#define HAVE_SIGNAL_H 1 -#define HAVE_STDARG_H 1 -#define HAVE_STDINT_H 1 -#define HAVE_STDIO_H 1 -#define HAVE_STDLIB_H 1 -#define HAVE_STRINGS_H 1 -#define HAVE_STRING_H 1 -#define HAVE_SYS_TYPES_H 1 - -#define HAVE_DLOPEN 1 -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -#define HAVE_ALLOCA 1 -#define HAVE_GETENV 1 -#define HAVE_SETENV 1 -#define HAVE_PUTENV 1 -#define HAVE_UNSETENV 1 -#define HAVE_QSORT 1 -#define HAVE_ABS 1 -#define HAVE_BCOPY 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_STRLEN 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_STRTOK_R 1 -#define HAVE_STRTOL 1 -#define HAVE_STRTOUL 1 -#define HAVE_STRTOLL 1 -#define HAVE_STRTOULL 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -#define HAVE_STRCASECMP 1 -#define HAVE_STRNCASECMP 1 -#define HAVE_VSSCANF 1 -#define HAVE_VSNPRINTF 1 -#define HAVE_M_PI 1 -#define HAVE_ACOS 1 -#define HAVE_ACOSF 1 -#define HAVE_ASIN 1 -#define HAVE_ASINF 1 -#define HAVE_ATAN 1 -#define HAVE_ATANF 1 -#define HAVE_ATAN2 1 -#define HAVE_ATAN2F 1 -#define HAVE_CEIL 1 -#define HAVE_CEILF 1 -#define HAVE_COPYSIGN 1 -#define HAVE_COPYSIGNF 1 -#define HAVE_COS 1 -#define HAVE_COSF 1 -#define HAVE_EXP 1 -#define HAVE_EXPF 1 -#define HAVE_FABS 1 -#define HAVE_FABSF 1 -#define HAVE_FLOOR 1 -#define HAVE_FLOORF 1 -#define HAVE_FMOD 1 -#define HAVE_FMODF 1 -#define HAVE_LOG 1 -#define HAVE_LOGF 1 -#define HAVE_LOG10 1 -#define HAVE_LOG10F 1 -#define HAVE_LROUND 1 -#define HAVE_LROUNDF 1 -#define HAVE_POW 1 -#define HAVE_POWF 1 -#define HAVE_ROUND 1 -#define HAVE_ROUNDF 1 -#define HAVE_SCALBN 1 -#define HAVE_SCALBNF 1 -#define HAVE_SIN 1 -#define HAVE_SINF 1 -#define HAVE_SQRT 1 -#define HAVE_SQRTF 1 -#define HAVE_TAN 1 -#define HAVE_TANF 1 -#define HAVE_TRUNC 1 -#define HAVE_TRUNCF 1 -#define HAVE_SIGACTION 1 -#define HAVE_SETJMP 1 -#define HAVE_NANOSLEEP 1 -#define HAVE_POW 1 - -#define SDL_AUDIO_DRIVER_DUMMY 1 -#define SDL_AUDIO_DRIVER_OSS 1 - -#define SDL_INPUT_LINUXEV 1 -#define SDL_JOYSTICK_LINUX 1 -#define SDL_JOYSTICK_VIRTUAL 1 -#define SDL_HAPTIC_LINUX 1 - -#define SDL_SENSOR_DUMMY 1 - -#define SDL_LOADSO_DLOPEN 1 - -#define SDL_THREAD_PTHREAD 1 -#define SDL_THREAD_PTHREAD_RECURSIVE_MUTEX_NP 1 - -#define SDL_TIMER_UNIX 1 - -#define SDL_VIDEO_DRIVER_DUMMY 1 -#define SDL_VIDEO_DRIVER_PANDORA 1 -#define SDL_VIDEO_RENDER_OGL_ES 1 -#define SDL_VIDEO_OPENGL_ES 1 - -#endif /* SDL_config_wiz_h_ */ diff --git a/libs/SDL2/include/SDL_config_xbox.h b/libs/SDL2/include/SDL_config_xbox.h new file mode 100644 index 0000000..8baf78e --- /dev/null +++ b/libs/SDL2/include/SDL_config_xbox.h @@ -0,0 +1,240 @@ +/* + Simple DirectMedia Layer + Copyright (C) 1997-2023 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifndef SDL_config_wingdk_h_ +#define SDL_config_wingdk_h_ +#define SDL_config_h_ + +#include "SDL_platform.h" + +/* Windows GDK does not need Windows SDK version checks because it requires + * a recent version of the Windows 10 SDK. */ + +/* GDK only supports 64-bit */ +# define SIZEOF_VOIDP 8 + +#ifdef __clang__ +# define HAVE_GCC_ATOMICS 1 +#endif + +/*#define HAVE_DDRAW_H 1*/ +/*#define HAVE_DINPUT_H 1*/ +/*#define HAVE_DSOUND_H 1*/ +/* No SDK version checks needed for these because the SDK has to be new. */ +/* #define HAVE_DXGI_H 1 */ +#define HAVE_XINPUT_H 1 +/*#define HAVE_WINDOWS_GAMING_INPUT_H 1*/ +/*#define HAVE_D3D11_H 1*/ +/*#define HAVE_ROAPI_H 1*/ +#define HAVE_D3D12_H 1 +/*#define HAVE_SHELLSCALINGAPI_H 1*/ +#define HAVE_MMDEVICEAPI_H 1 +#define HAVE_AUDIOCLIENT_H 1 +/*#define HAVE_TPCSHRD_H 1*/ +/*#define HAVE_SENSORSAPI_H 1*/ +#if (defined(_M_IX86) || defined(_M_X64) || defined(_M_AMD64)) && (defined(_MSC_VER) && _MSC_VER >= 1600) +#define HAVE_IMMINTRIN_H 1 +#elif defined(__has_include) && (defined(__i386__) || defined(__x86_64)) +# if __has_include() +# define HAVE_IMMINTRIN_H 1 +# endif +#endif + +/* This is disabled by default to avoid C runtime dependencies and manifest requirements */ +#ifdef HAVE_LIBC +/* Useful headers */ +#define STDC_HEADERS 1 +#define HAVE_CTYPE_H 1 +#define HAVE_FLOAT_H 1 +#define HAVE_LIMITS_H 1 +#define HAVE_MATH_H 1 +#define HAVE_SIGNAL_H 1 +#define HAVE_STDINT_H 1 +#define HAVE_STDIO_H 1 +#define HAVE_STRING_H 1 + +/* C library functions */ +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +#define HAVE_ALLOCA 1 +#define HAVE_QSORT 1 +#define HAVE_BSEARCH 1 +#define HAVE_ABS 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_MEMCMP 1 +#define HAVE_STRLEN 1 +#define HAVE__STRREV 1 +/* These functions have security warnings, so we won't use them */ +/* #undef HAVE__STRUPR */ +/* #undef HAVE__STRLWR */ +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +/* #undef HAVE_STRTOK_R */ +/* These functions have security warnings, so we won't use them */ +/* #undef HAVE__LTOA */ +/* #undef HAVE__ULTOA */ +#define HAVE_STRTOL 1 +#define HAVE_STRTOUL 1 +#define HAVE_STRTOD 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +#define HAVE__STRICMP 1 +#define HAVE__STRNICMP 1 +#define HAVE__WCSICMP 1 +#define HAVE__WCSNICMP 1 +#define HAVE__WCSDUP 1 +#define HAVE_ACOS 1 +#define HAVE_ASIN 1 +#define HAVE_ATAN 1 +#define HAVE_ATAN2 1 +#define HAVE_CEIL 1 +#define HAVE_COS 1 +#define HAVE_EXP 1 +#define HAVE_FABS 1 +#define HAVE_FLOOR 1 +#define HAVE_FMOD 1 +#define HAVE_LOG 1 +#define HAVE_LOG10 1 +#define HAVE_POW 1 +#define HAVE_SIN 1 +#define HAVE_SQRT 1 +#define HAVE_TAN 1 +#define HAVE_ACOSF 1 +#define HAVE_ASINF 1 +#define HAVE_ATANF 1 +#define HAVE_ATAN2F 1 +#define HAVE_CEILF 1 +#define HAVE__COPYSIGN 1 +#define HAVE_COSF 1 +#define HAVE_EXPF 1 +#define HAVE_FABSF 1 +#define HAVE_FLOORF 1 +#define HAVE_FMODF 1 +#define HAVE_LOGF 1 +#define HAVE_LOG10F 1 +#define HAVE_POWF 1 +#define HAVE_SINF 1 +#define HAVE_SQRTF 1 +#define HAVE_TANF 1 +#if defined(_MSC_VER) +/* These functions were added with the VC++ 2013 C runtime library */ +#define HAVE_STRTOLL 1 +#define HAVE_STRTOULL 1 +#define HAVE_VSSCANF 1 +#define HAVE_LROUND 1 +#define HAVE_LROUNDF 1 +#define HAVE_ROUND 1 +#define HAVE_ROUNDF 1 +#define HAVE_SCALBN 1 +#define HAVE_SCALBNF 1 +#define HAVE_TRUNC 1 +#define HAVE_TRUNCF 1 +#define HAVE__FSEEKI64 1 +#ifdef _USE_MATH_DEFINES +#define HAVE_M_PI 1 +#endif +#else +#define HAVE_M_PI 1 +#endif +#else +#define HAVE_STDARG_H 1 +#define HAVE_STDDEF_H 1 +#define HAVE_STDINT_H 1 +#endif + +/* Enable various audio drivers */ +#if defined(HAVE_MMDEVICEAPI_H) && defined(HAVE_AUDIOCLIENT_H) +#define SDL_AUDIO_DRIVER_WASAPI 1 +#endif +/*#define SDL_AUDIO_DRIVER_DSOUND 1*/ +/*#define SDL_AUDIO_DRIVER_WINMM 1*/ +#define SDL_AUDIO_DRIVER_DISK 1 +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable various input drivers */ +/*#define SDL_JOYSTICK_DINPUT 1*/ +/*#define SDL_JOYSTICK_HIDAPI 1*/ +/*#define SDL_JOYSTICK_RAWINPUT 1*/ +#define SDL_JOYSTICK_VIRTUAL 1 +#ifdef HAVE_WINDOWS_GAMING_INPUT_H +#define SDL_JOYSTICK_WGI 1 +#endif +#define SDL_JOYSTICK_XINPUT 1 +/*#define SDL_HAPTIC_DINPUT 1*/ +#define SDL_HAPTIC_XINPUT 1 + +/* Enable the sensor driver */ +#ifdef HAVE_SENSORSAPI_H +#define SDL_SENSOR_WINDOWS 1 +#else +#define SDL_SENSOR_DUMMY 1 +#endif + +/* Enable various shared object loading systems */ +#define SDL_LOADSO_WINDOWS 1 + +/* Enable various threading systems */ +#define SDL_THREAD_GENERIC_COND_SUFFIX 1 +#define SDL_THREAD_WINDOWS 1 + +/* Enable various timer systems */ +#define SDL_TIMER_WINDOWS 1 + +/* Enable various video drivers */ +#define SDL_VIDEO_DRIVER_DUMMY 1 +#define SDL_VIDEO_DRIVER_WINDOWS 1 + +#if !defined(SDL_VIDEO_RENDER_D3D12) && defined(HAVE_D3D12_H) +#define SDL_VIDEO_RENDER_D3D12 1 +#endif + +/* Enable OpenGL support */ +#ifndef SDL_VIDEO_OPENGL +#define SDL_VIDEO_OPENGL 1 +#endif +#ifndef SDL_VIDEO_OPENGL_WGL +#define SDL_VIDEO_OPENGL_WGL 1 +#endif +#ifndef SDL_VIDEO_RENDER_OGL +#define SDL_VIDEO_RENDER_OGL 1 +#endif + +/* Enable system power support */ +/*#define SDL_POWER_WINDOWS 1*/ +#define SDL_POWER_HARDWIRED 1 + +/* Enable filesystem support */ +/* #define SDL_FILESYSTEM_WINDOWS 1*/ +#define SDL_FILESYSTEM_XBOX 1 + +/* Disable IME as not supported yet (TODO: Xbox IME?) */ +#define SDL_DISABLE_WINDOWS_IME 1 + +#endif /* SDL_config_wingdk_h_ */ + +/* vi: set ts=4 sw=4 expandtab: */ diff --git a/libs/SDL2/include/SDL_copying.h b/libs/SDL2/include/SDL_copying.h index 49e3f9d..b6028ba 100644 --- a/libs/SDL2/include/SDL_copying.h +++ b/libs/SDL2/include/SDL_copying.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_cpuinfo.h b/libs/SDL2/include/SDL_cpuinfo.h index 1fc4099..ed5e979 100644 --- a/libs/SDL2/include/SDL_cpuinfo.h +++ b/libs/SDL2/include/SDL_cpuinfo.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -79,7 +79,7 @@ _m_prefetch(void *__P) #if !defined(SDL_DISABLE_ARM_NEON_H) # if defined(__ARM_NEON) # include -# elif defined(__WINDOWS__) || defined(__WINRT__) +# elif defined(__WINDOWS__) || defined(__WINRT__) || defined(__GDK__) /* Visual Studio doesn't define __ARM_ARCH, but _M_ARM (if set, always 7), and _M_ARM64 (if set, always 1). */ # if defined(_M_ARM) # include @@ -90,6 +90,7 @@ _m_prefetch(void *__P) # include # include # define __ARM_NEON 1 /* Set __ARM_NEON so that it can be used elsewhere, at compile time */ +# define __ARM_ARCH 8 # endif # endif #endif @@ -98,6 +99,14 @@ _m_prefetch(void *__P) #if defined(__3dNOW__) && !defined(SDL_DISABLE_MM3DNOW_H) #include #endif +#if defined(__loongarch_sx) && !defined(SDL_DISABLE_LSX_H) +#include +#define __LSX__ +#endif +#if defined(__loongarch_asx) && !defined(SDL_DISABLE_LASX_H) +#include +#define __LASX__ +#endif #if defined(HAVE_IMMINTRIN_H) && !defined(SDL_DISABLE_IMMINTRIN_H) #include #else @@ -433,10 +442,36 @@ extern DECLSPEC SDL_bool SDLCALL SDL_HasARMSIMD(void); */ extern DECLSPEC SDL_bool SDLCALL SDL_HasNEON(void); +/** + * Determine whether the CPU has LSX (LOONGARCH SIMD) features. + * + * This always returns false on CPUs that aren't using LOONGARCH instruction + * sets. + * + * \returns SDL_TRUE if the CPU has LOONGARCH LSX features or SDL_FALSE if + * not. + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasLSX(void); + +/** + * Determine whether the CPU has LASX (LOONGARCH SIMD) features. + * + * This always returns false on CPUs that aren't using LOONGARCH instruction + * sets. + * + * \returns SDL_TRUE if the CPU has LOONGARCH LASX features or SDL_FALSE if + * not. + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasLASX(void); + /** * Get the amount of RAM configured in the system. * - * \returns the amount of RAM configured in the system in MB. + * \returns the amount of RAM configured in the system in MiB. * * \since This function is available since SDL 2.0.1. */ @@ -494,7 +529,7 @@ extern DECLSPEC size_t SDLCALL SDL_SIMDGetAlignment(void); * * \since This function is available since SDL 2.0.10. * - * \sa SDL_SIMDAlignment + * \sa SDL_SIMDGetAlignment * \sa SDL_SIMDRealloc * \sa SDL_SIMDFree */ @@ -518,7 +553,7 @@ extern DECLSPEC void * SDLCALL SDL_SIMDAlloc(const size_t len); * * \since This function is available since SDL 2.0.14. * - * \sa SDL_SIMDAlignment + * \sa SDL_SIMDGetAlignment * \sa SDL_SIMDAlloc * \sa SDL_SIMDFree */ diff --git a/libs/SDL2/include/SDL_egl.h b/libs/SDL2/include/SDL_egl.h index f90e27b..6f51c08 100644 --- a/libs/SDL2/include/SDL_egl.h +++ b/libs/SDL2/include/SDL_egl.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -192,6 +192,20 @@ typedef int64_t khronos_int64_t; typedef uint64_t khronos_uint64_t; #define KHRONOS_SUPPORT_INT64 1 #define KHRONOS_SUPPORT_FLOAT 1 +/* + * To support platform where unsigned long cannot be used interchangeably with + * inptr_t (e.g. CHERI-extended ISAs), we can use the stdint.h intptr_t. + * Ideally, we could just use (u)intptr_t everywhere, but this could result in + * ABI breakage if khronos_uintptr_t is changed from unsigned long to + * unsigned long long or similar (this results in different C++ name mangling). + * To avoid changes for existing platforms, we restrict usage of intptr_t to + * platforms where the size of a pointer is larger than the size of long. + */ +#if defined(__SIZEOF_LONG__) && defined(__SIZEOF_POINTER__) +#if __SIZEOF_POINTER__ > __SIZEOF_LONG__ +#define KHRONOS_USE_INTPTR_T +#endif +#endif #elif defined(__VMS ) || defined(__sgi) @@ -274,14 +288,21 @@ typedef unsigned short int khronos_uint16_t; * pointers are 64 bits, but 'long' is still 32 bits. Win64 appears * to be the only LLP64 architecture in current use. */ -#ifdef _WIN64 +#ifdef KHRONOS_USE_INTPTR_T +typedef intptr_t khronos_intptr_t; +typedef uintptr_t khronos_uintptr_t; +#elif defined(_WIN64) typedef signed long long int khronos_intptr_t; typedef unsigned long long int khronos_uintptr_t; -typedef signed long long int khronos_ssize_t; -typedef unsigned long long int khronos_usize_t; #else typedef signed long int khronos_intptr_t; typedef unsigned long int khronos_uintptr_t; +#endif + +#if defined(_WIN64) +typedef signed long long int khronos_ssize_t; +typedef unsigned long long int khronos_usize_t; +#else typedef signed long int khronos_ssize_t; typedef unsigned long int khronos_usize_t; #endif @@ -516,7 +537,7 @@ extern "C" { ** used to make the header, and the header can be found at ** http://www.khronos.org/registry/egl ** -** Khronos $Git commit SHA1: b35e89ca9a $ on $Git commit date: 2021-09-01 09:34:00 +0530 $ +** Khronos $Git commit SHA1: 6fb1daea15 $ on $Git commit date: 2022-05-25 09:41:13 -0600 $ */ /*#include */ @@ -525,7 +546,7 @@ extern "C" { #define EGL_EGL_PROTOTYPES 1 #endif -/* Generated on date 20210901 */ +/* Generated on date 20220525 */ /* Generated C header for: * API: egl @@ -860,12 +881,12 @@ extern "C" { ** used to make the header, and the header can be found at ** http://www.khronos.org/registry/egl ** -** Khronos $Git commit SHA1: b35e89ca9a $ on $Git commit date: 2021-09-01 09:34:00 +0530 $ +** Khronos $Git commit SHA1: 6fb1daea15 $ on $Git commit date: 2022-05-25 09:41:13 -0600 $ */ /*#include */ -#define EGL_EGLEXT_VERSION 20210901 +#define EGL_EGLEXT_VERSION 20220525 /* Generated C header for: * API: egl @@ -1569,6 +1590,10 @@ EGLAPI EGLBoolean EGLAPIENTRY eglQueryDeviceBinaryEXT (EGLDeviceEXT device, EGLi #define EGL_RENDERER_EXT 0x335F #endif /* EGL_EXT_device_query_name */ +#ifndef EGL_EXT_explicit_device +#define EGL_EXT_explicit_device 1 +#endif /* EGL_EXT_explicit_device */ + #ifndef EGL_EXT_gl_colorspace_bt2020_linear #define EGL_EXT_gl_colorspace_bt2020_linear 1 #define EGL_GL_COLORSPACE_BT2020_LINEAR_EXT 0x333F @@ -1794,6 +1819,31 @@ EGLAPI EGLBoolean EGLAPIENTRY eglStreamConsumerOutputEXT (EGLDisplay dpy, EGLStr #define EGL_METADATA_SCALING_EXT 50000 #endif /* EGL_EXT_surface_SMPTE2086_metadata */ +#ifndef EGL_EXT_surface_compression +#define EGL_EXT_surface_compression 1 +#define EGL_SURFACE_COMPRESSION_EXT 0x34B0 +#define EGL_SURFACE_COMPRESSION_PLANE1_EXT 0x328E +#define EGL_SURFACE_COMPRESSION_PLANE2_EXT 0x328F +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_NONE_EXT 0x34B1 +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_DEFAULT_EXT 0x34B2 +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_1BPC_EXT 0x34B4 +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_2BPC_EXT 0x34B5 +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_3BPC_EXT 0x34B6 +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_4BPC_EXT 0x34B7 +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_5BPC_EXT 0x34B8 +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_6BPC_EXT 0x34B9 +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_7BPC_EXT 0x34BA +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_8BPC_EXT 0x34BB +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_9BPC_EXT 0x34BC +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_10BPC_EXT 0x34BD +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_11BPC_EXT 0x34BE +#define EGL_SURFACE_COMPRESSION_FIXED_RATE_12BPC_EXT 0x34BF +typedef EGLBoolean (EGLAPIENTRYP PFNEGLQUERYSUPPORTEDCOMPRESSIONRATESEXTPROC) (EGLDisplay dpy, EGLConfig config, const EGLAttrib *attrib_list, EGLint *rates, EGLint rate_size, EGLint *num_rates); +#ifdef EGL_EGLEXT_PROTOTYPES +EGLAPI EGLBoolean EGLAPIENTRY eglQuerySupportedCompressionRatesEXT (EGLDisplay dpy, EGLConfig config, const EGLAttrib *attrib_list, EGLint *rates, EGLint rate_size, EGLint *num_rates); +#endif +#endif /* EGL_EXT_surface_compression */ + #ifndef EGL_EXT_swap_buffers_with_damage #define EGL_EXT_swap_buffers_with_damage 1 typedef EGLBoolean (EGLAPIENTRYP PFNEGLSWAPBUFFERSWITHDAMAGEEXTPROC) (EGLDisplay dpy, EGLSurface surface, const EGLint *rects, EGLint n_rects); @@ -2028,12 +2078,12 @@ EGLAPI EGLBoolean EGLAPIENTRY eglPostSubBufferNV (EGLDisplay dpy, EGLSurface sur #define EGL_STREAM_IMAGE_ADD_NV 0x3374 #define EGL_STREAM_IMAGE_REMOVE_NV 0x3375 #define EGL_STREAM_IMAGE_AVAILABLE_NV 0x3376 -typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMIMAGECONSUMERCONNECTNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLint num_modifiers, EGLuint64KHR *modifiers, EGLAttrib *attrib_list); +typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMIMAGECONSUMERCONNECTNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLint num_modifiers, const EGLuint64KHR *modifiers, const EGLAttrib *attrib_list); typedef EGLint (EGLAPIENTRYP PFNEGLQUERYSTREAMCONSUMEREVENTNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLTime timeout, EGLenum *event, EGLAttrib *aux); typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMACQUIREIMAGENVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLImage *pImage, EGLSync sync); typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMRELEASEIMAGENVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLImage image, EGLSync sync); #ifdef EGL_EGLEXT_PROTOTYPES -EGLAPI EGLBoolean EGLAPIENTRY eglStreamImageConsumerConnectNV (EGLDisplay dpy, EGLStreamKHR stream, EGLint num_modifiers, EGLuint64KHR *modifiers, EGLAttrib *attrib_list); +EGLAPI EGLBoolean EGLAPIENTRY eglStreamImageConsumerConnectNV (EGLDisplay dpy, EGLStreamKHR stream, EGLint num_modifiers, const EGLuint64KHR *modifiers, const EGLAttrib *attrib_list); EGLAPI EGLint EGLAPIENTRY eglQueryStreamConsumerEventNV (EGLDisplay dpy, EGLStreamKHR stream, EGLTime timeout, EGLenum *event, EGLAttrib *aux); EGLAPI EGLBoolean EGLAPIENTRY eglStreamAcquireImageNV (EGLDisplay dpy, EGLStreamKHR stream, EGLImage *pImage, EGLSync sync); EGLAPI EGLBoolean EGLAPIENTRY eglStreamReleaseImageNV (EGLDisplay dpy, EGLStreamKHR stream, EGLImage image, EGLSync sync); diff --git a/libs/SDL2/include/SDL_endian.h b/libs/SDL2/include/SDL_endian.h index 46c2962..71bc067 100644 --- a/libs/SDL2/include/SDL_endian.h +++ b/libs/SDL2/include/SDL_endian.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -39,7 +39,7 @@ static __inline__ void __attribute__((__always_inline__, __nodebug__)) _m_prefetch(void *__P) { - __builtin_prefetch (__P, 0, 3 /* _MM_HINT_T0 */); + __builtin_prefetch(__P, 0, 3 /* _MM_HINT_T0 */); } #endif /* __PRFCHWINTRIN_H */ #endif /* __clang__ */ @@ -59,17 +59,26 @@ _m_prefetch(void *__P) #ifdef __linux__ #include #define SDL_BYTEORDER __BYTE_ORDER -#elif defined(__OpenBSD__) +#elif defined(__OpenBSD__) || defined(__DragonFly__) #include #define SDL_BYTEORDER BYTE_ORDER #elif defined(__FreeBSD__) || defined(__NetBSD__) #include #define SDL_BYTEORDER BYTE_ORDER +/* predefs from newer gcc and clang versions: */ +#elif defined(__ORDER_LITTLE_ENDIAN__) && defined(__ORDER_BIG_ENDIAN__) && defined(__BYTE_ORDER__) +#if (__BYTE_ORDER__ == __ORDER_LITTLE_ENDIAN__) +#define SDL_BYTEORDER SDL_LIL_ENDIAN +#elif (__BYTE_ORDER__ == __ORDER_BIG_ENDIAN__) +#define SDL_BYTEORDER SDL_BIG_ENDIAN +#else +#error Unsupported endianness +#endif /**/ #else #if defined(__hppa__) || \ defined(__m68k__) || defined(mc68000) || defined(_M_M68K) || \ (defined(__MIPS__) && defined(__MIPSEB__)) || \ - defined(__ppc__) || defined(__POWERPC__) || defined(_M_PPC) || \ + defined(__ppc__) || defined(__POWERPC__) || defined(__powerpc__) || defined(__PPC__) || \ defined(__sparc__) #define SDL_BYTEORDER SDL_BIG_ENDIAN #else @@ -78,6 +87,28 @@ _m_prefetch(void *__P) #endif /* __linux__ */ #endif /* !SDL_BYTEORDER */ +#ifndef SDL_FLOATWORDORDER /* Not defined in SDL_config.h? */ +/* predefs from newer gcc versions: */ +#if defined(__ORDER_LITTLE_ENDIAN__) && defined(__ORDER_BIG_ENDIAN__) && defined(__FLOAT_WORD_ORDER__) +#if (__FLOAT_WORD_ORDER__ == __ORDER_LITTLE_ENDIAN__) +#define SDL_FLOATWORDORDER SDL_LIL_ENDIAN +#elif (__FLOAT_WORD_ORDER__ == __ORDER_BIG_ENDIAN__) +#define SDL_FLOATWORDORDER SDL_BIG_ENDIAN +#else +#error Unsupported endianness +#endif /**/ +#elif defined(__MAVERICK__) +/* For Maverick, float words are always little-endian. */ +#define SDL_FLOATWORDORDER SDL_LIL_ENDIAN +#elif (defined(__arm__) || defined(__thumb__)) && !defined(__VFP_FP__) && !defined(__ARM_EABI__) +/* For FPA, float words are always big-endian. */ +#define SDL_FLOATWORDORDER SDL_BIG_ENDIAN +#else +/* By default, assume that floats words follow the memory system mode. */ +#define SDL_FLOATWORDORDER SDL_BYTEORDER +#endif /* __FLOAT_WORD_ORDER__ */ +#endif /* !SDL_FLOATWORDORDER */ + #include "begin_code.h" /* Set up for C function definitions, even when using C++ */ @@ -109,7 +140,7 @@ extern "C" { #if HAS_BUILTIN_BSWAP16 #define SDL_Swap16(x) __builtin_bswap16(x) -#elif defined(_MSC_VER) && (_MSC_VER >= 1400) +#elif (defined(_MSC_VER) && (_MSC_VER >= 1400)) && !defined(__ICL) #pragma intrinsic(_byteswap_ushort) #define SDL_Swap16(x) _byteswap_ushort(x) #elif defined(__i386__) && !HAS_BROKEN_BSWAP @@ -158,7 +189,7 @@ SDL_Swap16(Uint16 x) #if HAS_BUILTIN_BSWAP32 #define SDL_Swap32(x) __builtin_bswap32(x) -#elif defined(_MSC_VER) && (_MSC_VER >= 1400) +#elif (defined(_MSC_VER) && (_MSC_VER >= 1400)) && !defined(__ICL) #pragma intrinsic(_byteswap_ulong) #define SDL_Swap32(x) _byteswap_ulong(x) #elif defined(__i386__) && !HAS_BROKEN_BSWAP @@ -210,7 +241,7 @@ SDL_Swap32(Uint32 x) #if HAS_BUILTIN_BSWAP64 #define SDL_Swap64(x) __builtin_bswap64(x) -#elif defined(_MSC_VER) && (_MSC_VER >= 1400) +#elif (defined(_MSC_VER) && (_MSC_VER >= 1400)) && !defined(__ICL) #pragma intrinsic(_byteswap_uint64) #define SDL_Swap64(x) _byteswap_uint64(x) #elif defined(__i386__) && !HAS_BROKEN_BSWAP diff --git a/libs/SDL2/include/SDL_error.h b/libs/SDL2/include/SDL_error.h index 5c961e4..31c2261 100644 --- a/libs/SDL2/include/SDL_error.h +++ b/libs/SDL2/include/SDL_error.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_events.h b/libs/SDL2/include/SDL_events.h index 3722a63..9d09703 100644 --- a/libs/SDL2/include/SDL_events.h +++ b/libs/SDL2/include/SDL_events.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -102,6 +102,7 @@ typedef enum SDL_KEYMAPCHANGED, /**< Keymap changed due to a system event such as an input language or keyboard layout change. */ + SDL_TEXTEDITING_EXT, /**< Extended keyboard text editing (composition) */ /* Mouse events */ SDL_MOUSEMOTION = 0x400, /**< Mouse moved */ @@ -117,6 +118,7 @@ typedef enum SDL_JOYBUTTONUP, /**< Joystick button released */ SDL_JOYDEVICEADDED, /**< A new joystick has been inserted into the system */ SDL_JOYDEVICEREMOVED, /**< An opened joystick has been removed */ + SDL_JOYBATTERYUPDATED, /**< Joystick battery level change */ /* Game controller events */ SDL_CONTROLLERAXISMOTION = 0x650, /**< Game controller axis motion */ @@ -141,7 +143,7 @@ typedef enum SDL_MULTIGESTURE, /* Clipboard events */ - SDL_CLIPBOARDUPDATE = 0x900, /**< The clipboard changed */ + SDL_CLIPBOARDUPDATE = 0x900, /**< The clipboard or primary selection changed */ /* Drag and drop events */ SDL_DROPFILE = 0x1000, /**< The system requests a file open */ @@ -243,6 +245,19 @@ typedef struct SDL_TextEditingEvent Sint32 length; /**< The length of selected editing text */ } SDL_TextEditingEvent; +/** + * \brief Extended keyboard text editing event structure (event.editExt.*) when text would be + * truncated if stored in the text buffer SDL_TextEditingEvent + */ +typedef struct SDL_TextEditingExtEvent +{ + Uint32 type; /**< ::SDL_TEXTEDITING_EXT */ + Uint32 timestamp; /**< In milliseconds, populated using SDL_GetTicks() */ + Uint32 windowID; /**< The window with keyboard focus, if any */ + char* text; /**< The editing text, which should be freed with SDL_free(), and will not be NULL */ + Sint32 start; /**< The start cursor of selected editing text */ + Sint32 length; /**< The length of selected editing text */ +} SDL_TextEditingExtEvent; #define SDL_TEXTINPUTEVENT_TEXT_SIZE (32) /** @@ -303,6 +318,8 @@ typedef struct SDL_MouseWheelEvent Uint32 direction; /**< Set to one of the SDL_MOUSEWHEEL_* defines. When FLIPPED the values in X and Y will be opposite. Multiply by -1 to change them back */ float preciseX; /**< The amount scrolled horizontally, positive to the right and negative to the left, with float precision (added in 2.0.18) */ float preciseY; /**< The amount scrolled vertically, positive away from the user and negative toward the user, with float precision (added in 2.0.18) */ + Sint32 mouseX; /**< X coordinate, relative to window (added in 2.26.0) */ + Sint32 mouseY; /**< Y coordinate, relative to window (added in 2.26.0) */ } SDL_MouseWheelEvent; /** @@ -381,6 +398,16 @@ typedef struct SDL_JoyDeviceEvent Sint32 which; /**< The joystick device index for the ADDED event, instance id for the REMOVED event */ } SDL_JoyDeviceEvent; +/** + * \brief Joysick battery level change event structure (event.jbattery.*) + */ +typedef struct SDL_JoyBatteryEvent +{ + Uint32 type; /**< ::SDL_JOYBATTERYUPDATED */ + Uint32 timestamp; /**< In milliseconds, populated using SDL_GetTicks() */ + SDL_JoystickID which; /**< The joystick instance id */ + SDL_JoystickPowerLevel level; /**< The joystick battery level */ +} SDL_JoyBatteryEvent; /** * \brief Game controller axis motion event structure (event.caxis.*) @@ -449,6 +476,7 @@ typedef struct SDL_ControllerSensorEvent SDL_JoystickID which; /**< The joystick instance id */ Sint32 sensor; /**< The type of the sensor, one of the values of ::SDL_SensorType */ float data[3]; /**< Up to 3 values from the sensor, as defined in SDL_sensor.h */ + Uint64 timestamp_us; /**< The timestamp of the sensor reading in microseconds, if the hardware provides this information. */ } SDL_ControllerSensorEvent; /** @@ -540,6 +568,7 @@ typedef struct SDL_SensorEvent Uint32 timestamp; /**< In milliseconds, populated using SDL_GetTicks() */ Sint32 which; /**< The instance ID of the sensor */ float data[6]; /**< Up to 6 values from the sensor - additional values can be queried using SDL_SensorGetData() */ + Uint64 timestamp_us; /**< The timestamp of the sensor reading in microseconds, if the hardware provides this information. */ } SDL_SensorEvent; /** @@ -601,6 +630,7 @@ typedef union SDL_Event SDL_WindowEvent window; /**< Window event data */ SDL_KeyboardEvent key; /**< Keyboard event data */ SDL_TextEditingEvent edit; /**< Text editing event data */ + SDL_TextEditingExtEvent editExt; /**< Extended text editing event data */ SDL_TextInputEvent text; /**< Text input event data */ SDL_MouseMotionEvent motion; /**< Mouse motion event data */ SDL_MouseButtonEvent button; /**< Mouse button event data */ @@ -610,6 +640,7 @@ typedef union SDL_Event SDL_JoyHatEvent jhat; /**< Joystick hat event data */ SDL_JoyButtonEvent jbutton; /**< Joystick button event data */ SDL_JoyDeviceEvent jdevice; /**< Joystick device change event data */ + SDL_JoyBatteryEvent jbattery; /**< Joystick battery event data */ SDL_ControllerAxisEvent caxis; /**< Game Controller axis event data */ SDL_ControllerButtonEvent cbutton; /**< Game Controller button event data */ SDL_ControllerDeviceEvent cdevice; /**< Game Controller device event data */ diff --git a/libs/SDL2/include/SDL_filesystem.h b/libs/SDL2/include/SDL_filesystem.h index 16f02e2..4cad657 100644 --- a/libs/SDL2/include/SDL_filesystem.h +++ b/libs/SDL2/include/SDL_filesystem.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -60,6 +60,10 @@ extern "C" { * - `parent`: the containing directory of the bundle. For example: * `/Applications/SDLApp/` * + * **Nintendo 3DS Specific Functionality**: This function returns "romfs" + * directory of the application as it is uncommon to store resources outside + * the executable. As such it is not a writable directory. + * * The returned path is guaranteed to end with a path separator ('\' on * Windows, '/' on most other platforms). * @@ -92,7 +96,7 @@ extern DECLSPEC char *SDLCALL SDL_GetBasePath(void); * * `C:\\Users\\bob\\AppData\\Roaming\\My Company\\My Program Name\\` * - * On Linux, the string might look like" + * On Linux, the string might look like: * * `/home/bob/.local/share/My Program Name/` * diff --git a/libs/SDL2/include/SDL_gamecontroller.h b/libs/SDL2/include/SDL_gamecontroller.h index bdd9b89..140054d 100644 --- a/libs/SDL2/include/SDL_gamecontroller.h +++ b/libs/SDL2/include/SDL_gamecontroller.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -69,7 +69,11 @@ typedef enum SDL_CONTROLLER_TYPE_VIRTUAL, SDL_CONTROLLER_TYPE_PS5, SDL_CONTROLLER_TYPE_AMAZON_LUNA, - SDL_CONTROLLER_TYPE_GOOGLE_STADIA + SDL_CONTROLLER_TYPE_GOOGLE_STADIA, + SDL_CONTROLLER_TYPE_NVIDIA_SHIELD, + SDL_CONTROLLER_TYPE_NINTENDO_SWITCH_JOYCON_LEFT, + SDL_CONTROLLER_TYPE_NINTENDO_SWITCH_JOYCON_RIGHT, + SDL_CONTROLLER_TYPE_NINTENDO_SWITCH_JOYCON_PAIR } SDL_GameControllerType; typedef enum @@ -289,6 +293,25 @@ extern DECLSPEC SDL_bool SDLCALL SDL_IsGameController(int joystick_index); */ extern DECLSPEC const char *SDLCALL SDL_GameControllerNameForIndex(int joystick_index); +/** + * Get the implementation dependent path for the game controller. + * + * This function can be called before any controllers are opened. + * + * `joystick_index` is the same as the `device_index` passed to + * SDL_JoystickOpen(). + * + * \param joystick_index the device_index of a device, from zero to + * SDL_NumJoysticks()-1 + * \returns the implementation-dependent path for the game controller, or NULL + * if there is no path or the index is invalid. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GameControllerPath + */ +extern DECLSPEC const char *SDLCALL SDL_GameControllerPathForIndex(int joystick_index); + /** * Get the type of a game controller. * @@ -386,6 +409,23 @@ extern DECLSPEC SDL_GameController *SDLCALL SDL_GameControllerFromPlayerIndex(in */ extern DECLSPEC const char *SDLCALL SDL_GameControllerName(SDL_GameController *gamecontroller); +/** + * Get the implementation-dependent path for an opened game controller. + * + * This is the same path as returned by SDL_GameControllerNameForIndex(), but + * it takes a controller identifier instead of the (unstable) device index. + * + * \param gamecontroller a game controller identifier previously returned by + * SDL_GameControllerOpen() + * \returns the implementation dependent path for the game controller, or NULL + * if there is no path or the identifier passed is invalid. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GameControllerPathForIndex + */ +extern DECLSPEC const char *SDLCALL SDL_GameControllerPath(SDL_GameController *gamecontroller); + /** * Get the type of this currently opened controller * @@ -415,7 +455,8 @@ extern DECLSPEC int SDLCALL SDL_GameControllerGetPlayerIndex(SDL_GameController * Set the player index of an opened game controller. * * \param gamecontroller the game controller object to adjust. - * \param player_index Player index to assign to this controller. + * \param player_index Player index to assign to this controller, or -1 to + * clear the player index and turn off player LEDs. * * \since This function is available since SDL 2.0.12. */ @@ -457,6 +498,18 @@ extern DECLSPEC Uint16 SDLCALL SDL_GameControllerGetProduct(SDL_GameController * */ extern DECLSPEC Uint16 SDLCALL SDL_GameControllerGetProductVersion(SDL_GameController *gamecontroller); +/** + * Get the firmware version of an opened controller, if available. + * + * If the firmware version isn't available this function returns 0. + * + * \param gamecontroller the game controller object to query. + * \return the controller firmware version, or zero if unavailable. + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC Uint16 SDLCALL SDL_GameControllerGetFirmwareVersion(SDL_GameController *gamecontroller); + /** * Get the serial number of an opened controller, if available. * @@ -671,10 +724,10 @@ typedef enum SDL_CONTROLLER_BUTTON_DPAD_LEFT, SDL_CONTROLLER_BUTTON_DPAD_RIGHT, SDL_CONTROLLER_BUTTON_MISC1, /* Xbox Series X share button, PS5 microphone button, Nintendo Switch Pro capture button, Amazon Luna microphone button */ - SDL_CONTROLLER_BUTTON_PADDLE1, /* Xbox Elite paddle P1 */ - SDL_CONTROLLER_BUTTON_PADDLE2, /* Xbox Elite paddle P3 */ - SDL_CONTROLLER_BUTTON_PADDLE3, /* Xbox Elite paddle P2 */ - SDL_CONTROLLER_BUTTON_PADDLE4, /* Xbox Elite paddle P4 */ + SDL_CONTROLLER_BUTTON_PADDLE1, /* Xbox Elite paddle P1 (upper left, facing the back) */ + SDL_CONTROLLER_BUTTON_PADDLE2, /* Xbox Elite paddle P3 (upper right, facing the back) */ + SDL_CONTROLLER_BUTTON_PADDLE3, /* Xbox Elite paddle P2 (lower left, facing the back) */ + SDL_CONTROLLER_BUTTON_PADDLE4, /* Xbox Elite paddle P4 (lower right, facing the back) */ SDL_CONTROLLER_BUTTON_TOUCHPAD, /* PS4/PS5 touchpad button */ SDL_CONTROLLER_BUTTON_MAX } SDL_GameControllerButton; @@ -701,7 +754,7 @@ extern DECLSPEC SDL_GameControllerButton SDLCALL SDL_GameControllerGetButtonFrom * The caller should not SDL_free() the returned string. * * \param button an enum value for a given SDL_GameControllerButton - * \returns a string for the given button, or NULL if an invalid axis is + * \returns a string for the given button, or NULL if an invalid button is * specified. The string returned is of the format used by * SDL_GameController mapping strings. * @@ -842,6 +895,25 @@ extern DECLSPEC float SDLCALL SDL_GameControllerGetSensorDataRate(SDL_GameContro */ extern DECLSPEC int SDLCALL SDL_GameControllerGetSensorData(SDL_GameController *gamecontroller, SDL_SensorType type, float *data, int num_values); +/** + * Get the current state of a game controller sensor with the timestamp of the + * last update. + * + * The number of values and interpretation of the data is sensor dependent. + * See SDL_sensor.h for the details for each type of sensor. + * + * \param gamecontroller The controller to query + * \param type The type of sensor to query + * \param timestamp A pointer filled with the timestamp in microseconds of the + * current sensor reading if available, or 0 if not + * \param data A pointer filled with the current sensor state + * \param num_values The number of values to write to data + * \return 0 or -1 if an error occurred. + * + * \since This function is available since SDL 2.26.0. + */ +extern DECLSPEC int SDLCALL SDL_GameControllerGetSensorDataWithTimestamp(SDL_GameController *gamecontroller, SDL_SensorType type, Uint64 *timestamp, float *data, int num_values); + /** * Start a rumble effect on a game controller. * @@ -869,8 +941,9 @@ extern DECLSPEC int SDLCALL SDL_GameControllerRumble(SDL_GameController *gamecon * calling it with 0 intensity stops any rumbling. * * Note that this is rumbling of the _triggers_ and not the game controller as - * a whole. The first controller to offer this feature was the PlayStation 5's - * DualShock 5. + * a whole. This is currently only supported on Xbox One controllers. If you + * want the (more common) whole-controller rumble, use + * SDL_GameControllerRumble() instead. * * \param gamecontroller The controller to vibrate * \param left_rumble The intensity of the left trigger rumble motor, from 0 diff --git a/libs/SDL2/include/SDL_gesture.h b/libs/SDL2/include/SDL_gesture.h index e2caea2..db70b4d 100644 --- a/libs/SDL2/include/SDL_gesture.h +++ b/libs/SDL2/include/SDL_gesture.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_guid.h b/libs/SDL2/include/SDL_guid.h new file mode 100644 index 0000000..d964223 --- /dev/null +++ b/libs/SDL2/include/SDL_guid.h @@ -0,0 +1,100 @@ +/* + Simple DirectMedia Layer + Copyright (C) 1997-2023 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/** + * \file SDL_guid.h + * + * Include file for handling ::SDL_GUID values. + */ + +#ifndef SDL_guid_h_ +#define SDL_guid_h_ + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** + * An SDL_GUID is a 128-bit identifier for an input device that + * identifies that device across runs of SDL programs on the same + * platform. If the device is detached and then re-attached to a + * different port, or if the base system is rebooted, the device + * should still report the same GUID. + * + * GUIDs are as precise as possible but are not guaranteed to + * distinguish physically distinct but equivalent devices. For + * example, two game controllers from the same vendor with the same + * product ID and revision may have the same GUID. + * + * GUIDs may be platform-dependent (i.e., the same device may report + * different GUIDs on different operating systems). + */ +typedef struct { + Uint8 data[16]; +} SDL_GUID; + +/* Function prototypes */ + +/** + * Get an ASCII string representation for a given ::SDL_GUID. + * + * You should supply at least 33 bytes for pszGUID. + * + * \param guid the ::SDL_GUID you wish to convert to string + * \param pszGUID buffer in which to write the ASCII string + * \param cbGUID the size of pszGUID + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GUIDFromString + */ +extern DECLSPEC void SDLCALL SDL_GUIDToString(SDL_GUID guid, char *pszGUID, int cbGUID); + +/** + * Convert a GUID string into a ::SDL_GUID structure. + * + * Performs no error checking. If this function is given a string containing + * an invalid GUID, the function will silently succeed, but the GUID generated + * will not be useful. + * + * \param pchGUID string containing an ASCII representation of a GUID + * \returns a ::SDL_GUID structure. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GUIDToString + */ +extern DECLSPEC SDL_GUID SDLCALL SDL_GUIDFromString(const char *pchGUID); + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* SDL_guid_h_ */ + +/* vi: set ts=4 sw=4 expandtab: */ diff --git a/libs/SDL2/include/SDL_haptic.h b/libs/SDL2/include/SDL_haptic.h index f240ae9..2462a1e 100644 --- a/libs/SDL2/include/SDL_haptic.h +++ b/libs/SDL2/include/SDL_haptic.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_hidapi.h b/libs/SDL2/include/SDL_hidapi.h index 354af5c..0575100 100644 --- a/libs/SDL2/include/SDL_hidapi.h +++ b/libs/SDL2/include/SDL_hidapi.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_hints.h b/libs/SDL2/include/SDL_hints.h index 1185f42..00beef5 100644 --- a/libs/SDL2/include/SDL_hints.h +++ b/libs/SDL2/include/SDL_hints.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -92,7 +92,7 @@ extern "C" { * By default this hint is not set and the APK expansion files are not searched. */ #define SDL_HINT_ANDROID_APK_EXPANSION_MAIN_FILE_VERSION "SDL_ANDROID_APK_EXPANSION_MAIN_FILE_VERSION" - + /** * \brief Android APK expansion patch file version. Should be a string number like "1", "2" etc. * @@ -132,13 +132,13 @@ extern "C" { * \brief A variable to control whether we trap the Android back button to handle it manually. * This is necessary for the right mouse button to work on some Android devices, or * to be able to trap the back button for use in your code reliably. If set to true, - * the back button will show up as an SDL_KEYDOWN / SDL_KEYUP pair with a keycode of + * the back button will show up as an SDL_KEYDOWN / SDL_KEYUP pair with a keycode of * SDL_SCANCODE_AC_BACK. * * The variable can be set to the following values: * "0" - Back button will be handled as usual for system. (default) * "1" - Back button will be trapped, allowing you to handle the key press - * manually. (This will also let right mouse click work on systems + * manually. (This will also let right mouse click work on systems * where the right mouse button functions as back.) * * The value of this hint is used at runtime, so it can be changed at any time. @@ -147,7 +147,7 @@ extern "C" { /** * \brief Specify an application name. - * + * * This hint lets you specify the application name sent to the OS when * required. For example, this will often appear in volume control applets for * audio streams, and in lists of applications which are inhibiting the @@ -278,10 +278,7 @@ extern "C" { * If this hint isn't specified to a valid setting, or libsamplerate isn't * available, SDL will use the default, internal resampling algorithm. * - * Note that this is currently only applicable to resampling audio that is - * being written to a device for playback or audio being read from a device - * for capture. SDL_AudioCVT always uses the default resampler (although this - * might change for SDL 2.1). + * As of SDL 2.26, SDL_ConvertAudio() respects this hint when libsamplerate is available. * * This hint is currently only checked at audio subsystem initialization. * @@ -380,6 +377,17 @@ extern "C" { */ #define SDL_HINT_EMSCRIPTEN_KEYBOARD_ELEMENT "SDL_EMSCRIPTEN_KEYBOARD_ELEMENT" +/** + * \brief A variable that controls whether the on-screen keyboard should be shown when text input is active + * + * The variable can be set to the following values: + * "0" - Do not show the on-screen keyboard + * "1" - Show the on-screen keyboard + * + * The default value is "1". This hint must be set before text input is activated. + */ +#define SDL_HINT_ENABLE_SCREEN_KEYBOARD "SDL_ENABLE_SCREEN_KEYBOARD" + /** * \brief A variable that controls whether Steam Controllers should be exposed using the SDL joystick and game controller APIs * @@ -392,13 +400,14 @@ extern "C" { #define SDL_HINT_ENABLE_STEAM_CONTROLLERS "SDL_ENABLE_STEAM_CONTROLLERS" /** - * \brief A variable controlling whether SDL logs all events pushed onto its internal queue. + * \brief A variable controlling verbosity of the logging of SDL events pushed onto the internal queue. * - * This variable can be set to the following values: + * This variable can be set to the following values, from least to most verbose: * * "0" - Don't log any events (default) - * "1" - Log all events except mouse and finger motion, which are pretty spammy. - * "2" - Log all events. + * "1" - Log most events (other than the really spammy ones). + * "2" - Include mouse and finger motion events. + * "3" - Include SDL_SysWMEvent events. * * This is generally meant to be used to debug SDL itself, but can be useful * for application developers that need better visibility into what is going @@ -412,6 +421,19 @@ extern "C" { */ #define SDL_HINT_EVENT_LOGGING "SDL_EVENT_LOGGING" +/** + * \brief A variable controlling whether raising the window should be done more forcefully + * + * This variable can be set to the following values: + * "0" - No forcing (the default) + * "1" - Extra level of forcing + * + * At present, this is only an issue under MS Windows, which makes it nearly impossible to + * programmatically move a window to the foreground, for "security" reasons. See + * http://stackoverflow.com/a/34414846 for a discussion. + */ +#define SDL_HINT_FORCE_RAISEWINDOW "SDL_HINT_FORCE_RAISEWINDOW" + /** * \brief A variable controlling how 3D acceleration is used to accelerate the SDL screen surface. * @@ -496,7 +518,7 @@ extern "C" { /** * \brief If set, game controller face buttons report their values according to their labels instead of their positional layout. - * + * * For example, on Nintendo Switch controllers, normally you'd get: * * (Y) @@ -528,6 +550,14 @@ extern "C" { */ #define SDL_HINT_GRAB_KEYBOARD "SDL_GRAB_KEYBOARD" +/** + * \brief A variable containing a list of devices to ignore in SDL_hid_enumerate() + * + * For example, to ignore the Shanwan DS3 controller and any Valve controller, you might + * have the string "0x2563/0x0523,0x28de/0x0000" + */ +#define SDL_HINT_HIDAPI_IGNORE_DEVICES "SDL_HIDAPI_IGNORE_DEVICES" + /** * \brief A variable controlling whether the idle timer is disabled on iOS. * @@ -550,9 +580,9 @@ extern "C" { * * The variable can be set to the following values: * "0" - SDL_TEXTEDITING events are sent, and it is the application's - * responsibility to render the text from these events and + * responsibility to render the text from these events and * differentiate it somehow from committed text. (default) - * "1" - If supported by the IME then SDL_TEXTEDITING events are not sent, + * "1" - If supported by the IME then SDL_TEXTEDITING events are not sent, * and text that is being composed will be rendered in its own UI. */ #define SDL_HINT_IME_INTERNAL_EDITING "SDL_IME_INTERNAL_EDITING" @@ -566,6 +596,17 @@ extern "C" { */ #define SDL_HINT_IME_SHOW_UI "SDL_IME_SHOW_UI" +/** + * \brief A variable to control if extended IME text support is enabled. + * If enabled then SDL_TextEditingExtEvent will be issued if the text would be truncated otherwise. + * Additionally SDL_TextInputEvent will be dispatched multiple times so that it is not truncated. + * + * The variable can be set to the following values: + * "0" - Legacy behavior. Text can be truncated, no heap allocations. (default) + * "1" - Modern behavior. + */ +#define SDL_HINT_IME_SUPPORT_EXTENDED_TEXT "SDL_IME_SUPPORT_EXTENDED_TEXT" + /** * \brief A variable controlling whether the home indicator bar on iPhone X * should be hidden. @@ -612,18 +653,53 @@ extern "C" { */ #define SDL_HINT_JOYSTICK_HIDAPI_GAMECUBE "SDL_JOYSTICK_HIDAPI_GAMECUBE" - /** - * \brief A variable controlling whether Switch Joy-Cons should be treated the same as Switch Pro Controllers when using the HIDAPI driver. +/** + * \brief A variable controlling whether "low_frequency_rumble" and "high_frequency_rumble" is used to implement + * the GameCube controller's 3 rumble modes, Stop(0), Rumble(1), and StopHard(2) + * this is useful for applications that need full compatibility for things like ADSR envelopes. + * Stop is implemented by setting "low_frequency_rumble" to "0" and "high_frequency_rumble" ">0" + * Rumble is both at any arbitrary value, + * StopHard is implemented by setting both "low_frequency_rumble" and "high_frequency_rumble" to "0" + * + * This variable can be set to the following values: + * "0" - Normal rumble behavior is behavior is used (default) + * "1" - Proper GameCube controller rumble behavior is used + * + */ +#define SDL_HINT_JOYSTICK_GAMECUBE_RUMBLE_BRAKE "SDL_JOYSTICK_GAMECUBE_RUMBLE_BRAKE" + +/** + * \brief A variable controlling whether the HIDAPI driver for Nintendo Switch Joy-Cons should be used. * * This variable can be set to the following values: - * "0" - basic Joy-Con support with no analog input (the default) - * "1" - Joy-Cons treated as half full Pro Controllers with analog inputs and sensors + * "0" - HIDAPI driver is not used + * "1" - HIDAPI driver is used * - * This does not combine Joy-Cons into a single controller. That's up to the user. + * The default is the value of SDL_HINT_JOYSTICK_HIDAPI */ #define SDL_HINT_JOYSTICK_HIDAPI_JOY_CONS "SDL_JOYSTICK_HIDAPI_JOY_CONS" - /** +/** + * \brief A variable controlling whether Nintendo Switch Joy-Con controllers will be combined into a single Pro-like controller when using the HIDAPI driver + * + * This variable can be set to the following values: + * "0" - Left and right Joy-Con controllers will not be combined and each will be a mini-gamepad + * "1" - Left and right Joy-Con controllers will be combined into a single controller (the default) + */ +#define SDL_HINT_JOYSTICK_HIDAPI_COMBINE_JOY_CONS "SDL_JOYSTICK_HIDAPI_COMBINE_JOY_CONS" + +/** + * \brief A variable controlling whether Nintendo Switch Joy-Con controllers will be in vertical mode when using the HIDAPI driver + * + * This variable can be set to the following values: + * "0" - Left and right Joy-Con controllers will not be in vertical mode (the default) + * "1" - Left and right Joy-Con controllers will be in vertical mode + * + * This hint must be set before calling SDL_Init(SDL_INIT_GAMECONTROLLER) + */ +#define SDL_HINT_JOYSTICK_HIDAPI_VERTICAL_JOY_CONS "SDL_JOYSTICK_HIDAPI_VERTICAL_JOY_CONS" + +/** * \brief A variable controlling whether the HIDAPI driver for Amazon Luna controllers connected via Bluetooth should be used. * * This variable can be set to the following values: @@ -634,6 +710,42 @@ extern "C" { */ #define SDL_HINT_JOYSTICK_HIDAPI_LUNA "SDL_JOYSTICK_HIDAPI_LUNA" +/** + * \brief A variable controlling whether the HIDAPI driver for Nintendo Online classic controllers should be used. + * + * This variable can be set to the following values: + * "0" - HIDAPI driver is not used + * "1" - HIDAPI driver is used + * + * The default is the value of SDL_HINT_JOYSTICK_HIDAPI + */ +#define SDL_HINT_JOYSTICK_HIDAPI_NINTENDO_CLASSIC "SDL_JOYSTICK_HIDAPI_NINTENDO_CLASSIC" + +/** + * \brief A variable controlling whether the HIDAPI driver for NVIDIA SHIELD controllers should be used. + * + * This variable can be set to the following values: + * "0" - HIDAPI driver is not used + * "1" - HIDAPI driver is used + * + * The default is the value of SDL_HINT_JOYSTICK_HIDAPI + */ +#define SDL_HINT_JOYSTICK_HIDAPI_SHIELD "SDL_JOYSTICK_HIDAPI_SHIELD" + +/** + * \brief A variable controlling whether the HIDAPI driver for PS3 controllers should be used. + * + * This variable can be set to the following values: + * "0" - HIDAPI driver is not used + * "1" - HIDAPI driver is used + * + * The default is the value of SDL_HINT_JOYSTICK_HIDAPI on macOS, and "0" on other platforms. + * + * It is not possible to use this driver on Windows, due to limitations in the default drivers + * installed. See https://github.com/ViGEm/DsHidMini for an alternative driver on Windows. + */ +#define SDL_HINT_JOYSTICK_HIDAPI_PS3 "SDL_JOYSTICK_HIDAPI_PS3" + /** * \brief A variable controlling whether the HIDAPI driver for PS4 controllers should be used. * @@ -716,7 +828,7 @@ extern "C" { #define SDL_HINT_JOYSTICK_HIDAPI_STADIA "SDL_JOYSTICK_HIDAPI_STADIA" /** - * \brief A variable controlling whether the HIDAPI driver for Steam Controllers should be used. + * \brief A variable controlling whether the HIDAPI driver for Bluetooth Steam Controllers should be used. * * This variable can be set to the following values: * "0" - HIDAPI driver is not used @@ -739,16 +851,56 @@ extern "C" { #define SDL_HINT_JOYSTICK_HIDAPI_SWITCH "SDL_JOYSTICK_HIDAPI_SWITCH" /** - * \brief A variable controlling whether the Home button LED should be turned on when a Nintendo Switch controller is opened + * \brief A variable controlling whether the Home button LED should be turned on when a Nintendo Switch Pro controller is opened * * This variable can be set to the following values: * "0" - home button LED is turned off * "1" - home button LED is turned on * - * By default the Home button LED state is not changed. + * By default the Home button LED state is not changed. This hint can also be set to a floating point value between 0.0 and 1.0 which controls the brightness of the Home button LED. */ #define SDL_HINT_JOYSTICK_HIDAPI_SWITCH_HOME_LED "SDL_JOYSTICK_HIDAPI_SWITCH_HOME_LED" +/** + * \brief A variable controlling whether the Home button LED should be turned on when a Nintendo Switch Joy-Con controller is opened + * + * This variable can be set to the following values: + * "0" - home button LED is turned off + * "1" - home button LED is turned on + * + * By default the Home button LED state is not changed. This hint can also be set to a floating point value between 0.0 and 1.0 which controls the brightness of the Home button LED. + */ +#define SDL_HINT_JOYSTICK_HIDAPI_JOYCON_HOME_LED "SDL_JOYSTICK_HIDAPI_JOYCON_HOME_LED" + +/** + * \brief A variable controlling whether the player LEDs should be lit to indicate which player is associated with a Nintendo Switch controller. + * + * This variable can be set to the following values: + * "0" - player LEDs are not enabled + * "1" - player LEDs are enabled (the default) + */ +#define SDL_HINT_JOYSTICK_HIDAPI_SWITCH_PLAYER_LED "SDL_JOYSTICK_HIDAPI_SWITCH_PLAYER_LED" + +/** + * \brief A variable controlling whether the HIDAPI driver for Nintendo Wii and Wii U controllers should be used. + * + * This variable can be set to the following values: + * "0" - HIDAPI driver is not used + * "1" - HIDAPI driver is used + * + * This driver doesn't work with the dolphinbar, so the default is SDL_FALSE for now. + */ +#define SDL_HINT_JOYSTICK_HIDAPI_WII "SDL_JOYSTICK_HIDAPI_WII" + +/** + * \brief A variable controlling whether the player LEDs should be lit to indicate which player is associated with a Wii controller. + * + * This variable can be set to the following values: + * "0" - player LEDs are not enabled + * "1" - player LEDs are enabled (the default) + */ +#define SDL_HINT_JOYSTICK_HIDAPI_WII_PLAYER_LED "SDL_JOYSTICK_HIDAPI_WII_PLAYER_LED" + /** * \brief A variable controlling whether the HIDAPI driver for XBox controllers should be used. * @@ -760,17 +912,69 @@ extern "C" { */ #define SDL_HINT_JOYSTICK_HIDAPI_XBOX "SDL_JOYSTICK_HIDAPI_XBOX" - /** +/** + * \brief A variable controlling whether the HIDAPI driver for XBox 360 controllers should be used. + * + * This variable can be set to the following values: + * "0" - HIDAPI driver is not used + * "1" - HIDAPI driver is used + * + * The default is the value of SDL_HINT_JOYSTICK_HIDAPI_XBOX + */ +#define SDL_HINT_JOYSTICK_HIDAPI_XBOX_360 "SDL_JOYSTICK_HIDAPI_XBOX_360" + +/** + * \brief A variable controlling whether the player LEDs should be lit to indicate which player is associated with an Xbox 360 controller. + * + * This variable can be set to the following values: + * "0" - player LEDs are not enabled + * "1" - player LEDs are enabled (the default) + */ +#define SDL_HINT_JOYSTICK_HIDAPI_XBOX_360_PLAYER_LED "SDL_JOYSTICK_HIDAPI_XBOX_360_PLAYER_LED" + +/** + * \brief A variable controlling whether the HIDAPI driver for XBox 360 wireless controllers should be used. + * + * This variable can be set to the following values: + * "0" - HIDAPI driver is not used + * "1" - HIDAPI driver is used + * + * The default is the value of SDL_HINT_JOYSTICK_HIDAPI_XBOX_360 + */ +#define SDL_HINT_JOYSTICK_HIDAPI_XBOX_360_WIRELESS "SDL_JOYSTICK_HIDAPI_XBOX_360_WIRELESS" + +/** + * \brief A variable controlling whether the HIDAPI driver for XBox One controllers should be used. + * + * This variable can be set to the following values: + * "0" - HIDAPI driver is not used + * "1" - HIDAPI driver is used + * + * The default is the value of SDL_HINT_JOYSTICK_HIDAPI_XBOX + */ +#define SDL_HINT_JOYSTICK_HIDAPI_XBOX_ONE "SDL_JOYSTICK_HIDAPI_XBOX_ONE" + +/** + * \brief A variable controlling whether the Home button LED should be turned on when an Xbox One controller is opened + * + * This variable can be set to the following values: + * "0" - home button LED is turned off + * "1" - home button LED is turned on + * + * By default the Home button LED state is not changed. This hint can also be set to a floating point value between 0.0 and 1.0 which controls the brightness of the Home button LED. The default brightness is 0.4. + */ +#define SDL_HINT_JOYSTICK_HIDAPI_XBOX_ONE_HOME_LED "SDL_JOYSTICK_HIDAPI_XBOX_ONE_HOME_LED" + +/** * \brief A variable controlling whether the RAWINPUT joystick drivers should be used for better handling XInput-capable devices. * * This variable can be set to the following values: * "0" - RAWINPUT drivers are not used * "1" - RAWINPUT drivers are used (the default) - * */ #define SDL_HINT_JOYSTICK_RAWINPUT "SDL_JOYSTICK_RAWINPUT" - /** +/** * \brief A variable controlling whether the RAWINPUT driver should pull correlated data from XInput. * * This variable can be set to the following values: @@ -783,7 +987,16 @@ extern "C" { */ #define SDL_HINT_JOYSTICK_RAWINPUT_CORRELATE_XINPUT "SDL_JOYSTICK_RAWINPUT_CORRELATE_XINPUT" - /** +/** + * \brief A variable controlling whether the ROG Chakram mice should show up as joysticks + * + * This variable can be set to the following values: + * "0" - ROG Chakram mice do not show up as joysticks (the default) + * "1" - ROG Chakram mice show up as joysticks + */ +#define SDL_HINT_JOYSTICK_ROG_CHAKRAM "SDL_JOYSTICK_ROG_CHAKRAM" + +/** * \brief A variable controlling whether a separate thread should be used * for handling joystick detection and raw input messages on Windows * @@ -794,6 +1007,15 @@ extern "C" { */ #define SDL_HINT_JOYSTICK_THREAD "SDL_JOYSTICK_THREAD" +/** + * \brief A variable controlling whether Windows.Gaming.Input should be used for controller handling. + * + * This variable can be set to the following values: + * "0" - WGI is not used + * "1" - WGI is used (the default) + */ +#define SDL_HINT_JOYSTICK_WGI "SDL_JOYSTICK_WGI" + /** * \brief Determines whether SDL enforces that DRM master is required in order * to initialize the KMSDRM video backend. @@ -817,14 +1039,32 @@ extern "C" { */ #define SDL_HINT_KMSDRM_REQUIRE_DRM_MASTER "SDL_KMSDRM_REQUIRE_DRM_MASTER" - /** +/** * \brief A comma separated list of devices to open as joysticks * * This variable is currently only used by the Linux joystick driver. */ #define SDL_HINT_JOYSTICK_DEVICE "SDL_JOYSTICK_DEVICE" - /** +/** + * \brief A variable controlling whether joysticks on Linux will always treat 'hat' axis inputs (ABS_HAT0X - ABS_HAT3Y) as 8-way digital hats without checking whether they may be analog. + * + * This variable can be set to the following values: + * "0" - Only map hat axis inputs to digital hat outputs if the input axes appear to actually be digital (the default) + * "1" - Always handle the input axes numbered ABS_HAT0X to ABS_HAT3Y as digital hats + */ +#define SDL_HINT_LINUX_DIGITAL_HATS "SDL_LINUX_DIGITAL_HATS" + +/** + * \brief A variable controlling whether digital hats on Linux will apply deadzones to their underlying input axes or use unfiltered values. + * + * This variable can be set to the following values: + * "0" - Return digital hat values based on unfiltered input axis values + * "1" - Return digital hat values with deadzones on the input axes taken into account (the default) + */ +#define SDL_HINT_LINUX_HAT_DEADZONES "SDL_LINUX_HAT_DEADZONES" + +/** * \brief A variable controlling whether to use the classic /dev/input/js* joystick interface or the newer /dev/input/event* joystick interface on Linux * * This variable can be set to the following values: @@ -835,7 +1075,7 @@ extern "C" { */ #define SDL_HINT_LINUX_JOYSTICK_CLASSIC "SDL_LINUX_JOYSTICK_CLASSIC" - /** +/** * \brief A variable controlling whether joysticks on Linux adhere to their HID-defined deadzones or return unfiltered values. * * This variable can be set to the following values: @@ -860,6 +1100,24 @@ extern "C" { */ #define SDL_HINT_MAC_CTRL_CLICK_EMULATE_RIGHT_CLICK "SDL_MAC_CTRL_CLICK_EMULATE_RIGHT_CLICK" +/** + * \brief A variable controlling whether dispatching OpenGL context updates should block the dispatching thread until the main thread finishes processing + * + * This variable can be set to the following values: + * "0" - Dispatching OpenGL context updates will block the dispatching thread until the main thread finishes processing (default). + * "1" - Dispatching OpenGL context updates will allow the dispatching thread to continue execution. + * + * Generally you want the default, but if you have OpenGL code in a background thread on a Mac, and the main thread + * hangs because it's waiting for that background thread, but that background thread is also hanging because it's + * waiting for the main thread to do an update, this might fix your issue. + * + * This hint only applies to macOS. + * + * This hint is available since SDL 2.24.0. + * + */ +#define SDL_HINT_MAC_OPENGL_ASYNC_DISPATCH "SDL_MAC_OPENGL_ASYNC_DISPATCH" + /** * \brief A variable setting the double click radius, in pixels. */ @@ -886,6 +1144,22 @@ extern "C" { */ #define SDL_HINT_MOUSE_NORMAL_SPEED_SCALE "SDL_MOUSE_NORMAL_SPEED_SCALE" +/** + * \brief A variable controlling whether relative mouse mode constrains the mouse to the center of the window + * + * This variable can be set to the following values: + * "0" - Relative mouse mode constrains the mouse to the window + * "1" - Relative mouse mode constrains the mouse to the center of the window + * + * Constraining to the center of the window works better for FPS games and when the + * application is running over RDP. Constraining to the whole window works better + * for 2D games and increases the chance that the mouse will be in the correct + * position when using high DPI mice. + * + * By default SDL will constrain the mouse to the center of the window + */ +#define SDL_HINT_MOUSE_RELATIVE_MODE_CENTER "SDL_MOUSE_RELATIVE_MODE_CENTER" + /** * \brief A variable controlling whether relative mouse mode is implemented using mouse warping * @@ -913,6 +1187,28 @@ extern "C" { */ #define SDL_HINT_MOUSE_RELATIVE_SPEED_SCALE "SDL_MOUSE_RELATIVE_SPEED_SCALE" +/** + * \brief A variable controlling whether the system mouse acceleration curve is used for relative mouse motion. + * + * This variable can be set to the following values: + * "0" - Relative mouse motion will be unscaled (the default) + * "1" - Relative mouse motion will be scaled using the system mouse acceleration curve. + * + * If SDL_HINT_MOUSE_RELATIVE_SPEED_SCALE is set, that will override the system speed scale. + */ +#define SDL_HINT_MOUSE_RELATIVE_SYSTEM_SCALE "SDL_MOUSE_RELATIVE_SYSTEM_SCALE" + +/** + * \brief A variable controlling whether a motion event should be generated for mouse warping in relative mode. + * + * This variable can be set to the following values: + * "0" - Warping the mouse will not generate a motion event in relative mode + * "1" - Warping the mouse will generate a motion event in relative mode + * + * By default warping the mouse will not generate motion events in relative mode. This avoids the application having to filter out large relative motion due to warping. + */ +#define SDL_HINT_MOUSE_RELATIVE_WARP_MOTION "SDL_MOUSE_RELATIVE_WARP_MOTION" + /** * \brief A variable controlling whether mouse events should generate synthetic touch events * @@ -922,6 +1218,19 @@ extern "C" { */ #define SDL_HINT_MOUSE_TOUCH_EVENTS "SDL_MOUSE_TOUCH_EVENTS" +/** + * \brief A variable controlling whether the mouse is captured while mouse buttons are pressed + * + * This variable can be set to the following values: + * "0" - The mouse is not captured while mouse buttons are pressed + * "1" - The mouse is captured while mouse buttons are pressed + * + * By default the mouse is captured while mouse buttons are pressed so if the mouse is dragged + * outside the window, the application continues to receive mouse events until the button is + * released. + */ +#define SDL_HINT_MOUSE_AUTO_CAPTURE "SDL_MOUSE_AUTO_CAPTURE" + /** * \brief Tell SDL not to catch the SIGINT or SIGTERM signals. * @@ -987,7 +1296,7 @@ extern "C" { * When polling for events, SDL_PumpEvents is used to gather new events from devices. * If a device keeps producing new events between calls to SDL_PumpEvents, a poll loop will * become stuck until the new events stop. - * This is most noticable when moving a high frequency mouse. + * This is most noticeable when moving a high frequency mouse. * * By default, poll sentinels are enabled. */ @@ -1021,6 +1330,8 @@ extern "C" { * * This variable can be one of the following values: * "primary" (default), "portrait", "landscape", "inverted-portrait", "inverted-landscape" + * + * Since SDL 2.0.22 this variable accepts a comma-separated list of values above. */ #define SDL_HINT_QTWAYLAND_CONTENT_ORIENTATION "SDL_QTWAYLAND_CONTENT_ORIENTATION" @@ -1105,6 +1416,8 @@ extern "C" { * * This variable is case insensitive and can be set to the following values: * "direct3d" + * "direct3d11" + * "direct3d12" * "opengl" * "opengles2" * "opengles" @@ -1161,7 +1474,29 @@ extern "C" { */ #define SDL_HINT_RENDER_VSYNC "SDL_RENDER_VSYNC" - /** +/** + * \brief A variable controlling whether the Metal render driver select low power device over default one + * + * This variable can be set to the following values: + * "0" - Use the prefered OS device + * "1" - Select a low power one + * + * By default the prefered OS device is used. + */ +#define SDL_HINT_RENDER_METAL_PREFER_LOW_POWER_DEVICE "SDL_RENDER_METAL_PREFER_LOW_POWER_DEVICE" + +/** + * \brief A variable controlling if VSYNC is automatically disable if doesn't reach the enough FPS + * + * This variable can be set to the following values: + * "0" - It will be using VSYNC as defined in the main flag. Default + * "1" - If VSYNC was previously enabled, then it will disable VSYNC if doesn't reach enough speed + * + * By default SDL does not enable the automatic VSYNC + */ +#define SDL_HINT_PS2_DYNAMIC_VSYNC "SDL_PS2_DYNAMIC_VSYNC" + +/** * \brief A variable to control whether the return key on the soft keyboard * should hide the soft keyboard on Android and iOS. * @@ -1193,7 +1528,7 @@ extern "C" { * disabled. You should use a string that describes what your program is doing * (and, therefore, why the screensaver is disabled). For example, "Playing a * game" or "Watching a video". - * + * * Setting this to "" or leaving it unset will have SDL use a reasonable * default: "Playing a game" or something similar. * @@ -1207,13 +1542,13 @@ extern "C" { * On some platforms, like Linux, a realtime priority thread may be subject to restrictions * that require special handling by the application. This hint exists to let SDL know that * the app is prepared to handle said restrictions. - * + * * On Linux, SDL will apply the following configuration to any thread that becomes realtime: * * The SCHED_RESET_ON_FORK bit will be set on the scheduling policy, * * An RLIMIT_RTTIME budget will be configured to the rtkit specified limit. * * Exceeding this limit will result in the kernel sending SIGKILL to the app, * * Refer to the man pages for more information. - * + * * This variable can be set to the following values: * "0" - default platform specific behaviour * "1" - Force SDL_THREAD_PRIORITY_TIME_CRITICAL to a realtime scheduling policy @@ -1278,6 +1613,18 @@ extern "C" { */ #define SDL_HINT_TOUCH_MOUSE_EVENTS "SDL_TOUCH_MOUSE_EVENTS" +/** + * \brief A variable controlling which touchpad should generate synthetic mouse events + * + * This variable can be set to the following values: + * "0" - Only front touchpad should generate mouse events. Default + * "1" - Only back touchpad should generate mouse events. + * "2" - Both touchpads should generate mouse events. + * + * By default SDL will generate mouse events for all touch devices + */ +#define SDL_HINT_VITA_TOUCH_MOUSE_DEVICE "SDL_HINT_VITA_TOUCH_MOUSE_DEVICE" + /** * \brief A variable controlling whether the Android / tvOS remotes * should be listed as joystick devices, instead of sending keyboard events. @@ -1289,7 +1636,7 @@ extern "C" { #define SDL_HINT_TV_REMOTE_AS_JOYSTICK "SDL_TV_REMOTE_AS_JOYSTICK" /** - * \brief A variable controlling whether the screensaver is enabled. + * \brief A variable controlling whether the screensaver is enabled. * * This variable can be set to the following values: * "0" - Disable screensaver @@ -1302,7 +1649,7 @@ extern "C" { /** * \brief Tell the video driver that we only want a double buffer. * - * By default, most lowlevel 2D APIs will use a triple buffer scheme that + * By default, most lowlevel 2D APIs will use a triple buffer scheme that * wastes no CPU time on waiting for vsync after issuing a flip, but * introduces a frame of latency. On the other hand, using a double buffer * scheme instead is recommended for cases where low latency is an important @@ -1362,9 +1709,7 @@ extern "C" { * SDL_WINDOW_RESIZABLE windows will offer the "fullscreen" * button on their titlebars). * - * The default value is "1". Spaces are disabled regardless of this hint if - * the OS isn't at least Mac OS X Lion (10.7). This hint must be set before - * any windows are created. + * The default value is "1". This hint must be set before any windows are created. */ #define SDL_HINT_VIDEO_MAC_FULLSCREEN_SPACES "SDL_VIDEO_MAC_FULLSCREEN_SPACES" @@ -1387,11 +1732,57 @@ extern "C" { */ #define SDL_HINT_VIDEO_WAYLAND_ALLOW_LIBDECOR "SDL_VIDEO_WAYLAND_ALLOW_LIBDECOR" +/** + * \brief A variable controlling whether the libdecor Wayland backend is preferred over native decrations. + * + * When this hint is set, libdecor will be used to provide window decorations, even if xdg-decoration is + * available. (Note that, by default, libdecor will use xdg-decoration itself if available). + * + * This variable can be set to the following values: + * "0" - libdecor is enabled only if server-side decorations are unavailable. + * "1" - libdecor is always enabled if available. + * + * libdecor is used over xdg-shell when xdg-decoration protocol is unavailable. + */ +#define SDL_HINT_VIDEO_WAYLAND_PREFER_LIBDECOR "SDL_VIDEO_WAYLAND_PREFER_LIBDECOR" + +/** + * \brief A variable controlling whether video mode emulation is enabled under Wayland. + * + * When this hint is set, a standard set of emulated CVT video modes will be exposed for use by the application. + * If it is disabled, the only modes exposed will be the logical desktop size and, in the case of a scaled + * desktop, the native display resolution. + * + * This variable can be set to the following values: + * "0" - Video mode emulation is disabled. + * "1" - Video mode emulation is enabled. + * + * By default video mode emulation is enabled. + */ +#define SDL_HINT_VIDEO_WAYLAND_MODE_EMULATION "SDL_VIDEO_WAYLAND_MODE_EMULATION" + +/** + * \brief Enable or disable mouse pointer warp emulation, needed by some older games. + * + * When this hint is set, any SDL will emulate mouse warps using relative mouse mode. + * This is required for some older games (such as Source engine games), which warp the + * mouse to the centre of the screen rather than using relative mouse motion. Note that + * relative mouse mode may have different mouse acceleration behaviour than pointer warps. + * + * This variable can be set to the following values: + * "0" - All mouse warps fail, as mouse warping is not available under wayland. + * "1" - Some mouse warps will be emulated by forcing relative mouse mode. + * + * If not set, this is automatically enabled unless an application uses relative mouse + * mode directly. + */ +#define SDL_HINT_VIDEO_WAYLAND_EMULATE_MOUSE_WARP "SDL_VIDEO_WAYLAND_EMULATE_MOUSE_WARP" + /** * \brief A variable that is the address of another SDL_Window* (as a hex string formatted with "%p"). -* +* * If this hint is set before SDL_CreateWindowFrom() and the SDL_Window* it is set to has -* SDL_WINDOW_OPENGL set (and running on WGL only, currently), then two things will occur on the newly +* SDL_WINDOW_OPENGL set (and running on WGL only, currently), then two things will occur on the newly * created SDL_Window: * * 1. Its pixel format will be set to the same pixel format as this SDL_Window. This is @@ -1406,6 +1797,28 @@ extern "C" { */ #define SDL_HINT_VIDEO_WINDOW_SHARE_PIXEL_FORMAT "SDL_VIDEO_WINDOW_SHARE_PIXEL_FORMAT" +/** + * \brief When calling SDL_CreateWindowFrom(), make the window compatible with OpenGL. + * + * This variable can be set to the following values: + * "0" - Don't add any graphics flags to the SDL_WindowFlags + * "1" - Add SDL_WINDOW_OPENGL to the SDL_WindowFlags + * + * By default SDL will not make the foreign window compatible with OpenGL. + */ +#define SDL_HINT_VIDEO_FOREIGN_WINDOW_OPENGL "SDL_VIDEO_FOREIGN_WINDOW_OPENGL" + +/** + * \brief When calling SDL_CreateWindowFrom(), make the window compatible with Vulkan. + * + * This variable can be set to the following values: + * "0" - Don't add any graphics flags to the SDL_WindowFlags + * "1" - Add SDL_WINDOW_VULKAN to the SDL_WindowFlags + * + * By default SDL will not make the foreign window compatible with Vulkan. + */ +#define SDL_HINT_VIDEO_FOREIGN_WINDOW_VULKAN "SDL_VIDEO_FOREIGN_WINDOW_VULKAN" + /** * \brief A variable specifying which shader compiler to preload when using the Chrome ANGLE binaries * @@ -1435,13 +1848,13 @@ extern "C" { /** * \brief A variable controlling whether the X11 _NET_WM_BYPASS_COMPOSITOR hint should be used. - * + * * This variable can be set to the following values: * "0" - Disable _NET_WM_BYPASS_COMPOSITOR * "1" - Enable _NET_WM_BYPASS_COMPOSITOR - * + * * By default SDL will use _NET_WM_BYPASS_COMPOSITOR - * + * */ #define SDL_HINT_VIDEO_X11_NET_WM_BYPASS_COMPOSITOR "SDL_VIDEO_X11_NET_WM_BYPASS_COMPOSITOR" @@ -1466,13 +1879,11 @@ extern "C" { #define SDL_HINT_VIDEO_X11_WINDOW_VISUALID "SDL_VIDEO_X11_WINDOW_VISUALID" /** - * \brief A variable controlling whether the X11 Xinerama extension should be used. + * \brief A no-longer-used variable controlling whether the X11 Xinerama extension should be used. * - * This variable can be set to the following values: - * "0" - Disable Xinerama - * "1" - Enable Xinerama - * - * By default SDL will use Xinerama if it is available. + * Before SDL 2.0.24, this would let apps and users disable Xinerama support on X11. + * Now SDL never uses Xinerama, and does not check for this hint at all. + * The preprocessor define is left here for source compatibility. */ #define SDL_HINT_VIDEO_X11_XINERAMA "SDL_VIDEO_X11_XINERAMA" @@ -1483,18 +1894,16 @@ extern "C" { * "0" - Disable XRandR * "1" - Enable XRandR * - * By default SDL will not use XRandR because of window manager issues. + * By default SDL will use XRandR. */ #define SDL_HINT_VIDEO_X11_XRANDR "SDL_VIDEO_X11_XRANDR" /** - * \brief A variable controlling whether the X11 VidMode extension should be used. + * \brief A no-longer-used variable controlling whether the X11 VidMode extension should be used. * - * This variable can be set to the following values: - * "0" - Disable XVidMode - * "1" - Enable XVidMode - * - * By default SDL will use XVidMode if it is available. + * Before SDL 2.0.24, this would let apps and users disable XVidMode support on X11. + * Now SDL never uses XVidMode, and does not check for this hint at all. + * The preprocessor define is left here for source compatibility. */ #define SDL_HINT_VIDEO_X11_XVIDMODE "SDL_VIDEO_X11_XVIDMODE" @@ -1579,7 +1988,29 @@ extern "C" { #define SDL_HINT_WINDOWS_DISABLE_THREAD_NAMING "SDL_WINDOWS_DISABLE_THREAD_NAMING" /** - * \brief A variable controlling whether the windows message loop is processed by SDL + * \brief Controls whether menus can be opened with their keyboard shortcut (Alt+mnemonic). + * + * If the mnemonics are enabled, then menus can be opened by pressing the Alt + * key and the corresponding mnemonic (for example, Alt+F opens the File menu). + * However, in case an invalid mnemonic is pressed, Windows makes an audible + * beep to convey that nothing happened. This is true even if the window has + * no menu at all! + * + * Because most SDL applications don't have menus, and some want to use the Alt + * key for other purposes, SDL disables mnemonics (and the beeping) by default. + * + * Note: This also affects keyboard events: with mnemonics enabled, when a + * menu is opened from the keyboard, you will not receive a KEYUP event for + * the mnemonic key, and *might* not receive one for Alt. + * + * This variable can be set to the following values: + * "0" - Alt+mnemonic does nothing, no beeping. (default) + * "1" - Alt+mnemonic opens menus, invalid mnemonics produce a beep. + */ +#define SDL_HINT_WINDOWS_ENABLE_MENU_MNEMONICS "SDL_WINDOWS_ENABLE_MENU_MNEMONICS" + +/** + * \brief A variable controlling whether the windows message loop is processed by SDL * * This variable can be set to the following values: * "0" - The window message loop is not run @@ -1620,7 +2051,7 @@ extern "C" { #define SDL_HINT_WINDOWS_FORCE_SEMAPHORE_KERNEL "SDL_WINDOWS_FORCE_SEMAPHORE_KERNEL" /** - * \brief A variable to specify custom icon resource id from RC file on Windows platform + * \brief A variable to specify custom icon resource id from RC file on Windows platform */ #define SDL_HINT_WINDOWS_INTRESOURCE_ICON "SDL_WINDOWS_INTRESOURCE_ICON" #define SDL_HINT_WINDOWS_INTRESOURCE_ICON_SMALL "SDL_WINDOWS_INTRESOURCE_ICON_SMALL" @@ -1655,7 +2086,58 @@ extern "C" { #define SDL_HINT_WINDOWS_USE_D3D9EX "SDL_WINDOWS_USE_D3D9EX" /** - * \brief A variable controlling whether the window frame and title bar are interactive when the cursor is hidden + * \brief Controls whether SDL will declare the process to be DPI aware. + * + * This hint must be set before initializing the video subsystem. + * + * The main purpose of declaring DPI awareness is to disable OS bitmap scaling of SDL windows on monitors with + * a DPI scale factor. + * + * This hint is equivalent to requesting DPI awareness via external means (e.g. calling SetProcessDpiAwarenessContext) + * and does not cause SDL to use a virtualized coordinate system, so it will generally give you 1 SDL coordinate = 1 pixel + * even on high-DPI displays. + * + * For more information, see: + * https://docs.microsoft.com/en-us/windows/win32/hidpi/high-dpi-desktop-application-development-on-windows + * + * This variable can be set to the following values: + * "" - Do not change the DPI awareness (default). + * "unaware" - Declare the process as DPI unaware. (Windows 8.1 and later). + * "system" - Request system DPI awareness. (Vista and later). + * "permonitor" - Request per-monitor DPI awareness. (Windows 8.1 and later). + * "permonitorv2" - Request per-monitor V2 DPI awareness. (Windows 10, version 1607 and later). + * The most visible difference from "permonitor" is that window title bar will be scaled + * to the visually correct size when dragging between monitors with different scale factors. + * This is the preferred DPI awareness level. + * + * If the requested DPI awareness is not available on the currently running OS, SDL will try to request the best + * available match. + */ +#define SDL_HINT_WINDOWS_DPI_AWARENESS "SDL_WINDOWS_DPI_AWARENESS" + +/** + * \brief Uses DPI-scaled points as the SDL coordinate system on Windows. + * + * This changes the SDL coordinate system units to be DPI-scaled points, rather than pixels everywhere. + * This means windows will be appropriately sized, even when created on high-DPI displays with scaling. + * + * e.g. requesting a 640x480 window from SDL, on a display with 125% scaling in Windows display settings, + * will create a window with an 800x600 client area (in pixels). + * + * Setting this to "1" implicitly requests process DPI awareness (setting SDL_WINDOWS_DPI_AWARENESS is unnecessary), + * and forces SDL_WINDOW_ALLOW_HIGHDPI on all windows. + * + * This variable can be set to the following values: + * "0" - SDL coordinates equal Windows coordinates. No automatic window resizing when dragging + * between monitors with different scale factors (unless this is performed by + * Windows itself, which is the case when the process is DPI unaware). + * "1" - SDL coordinates are in DPI-scaled points. Automatically resize windows as needed on + * displays with non-100% scale factors. + */ +#define SDL_HINT_WINDOWS_DPI_SCALING "SDL_WINDOWS_DPI_SCALING" + +/** + * \brief A variable controlling whether the window frame and title bar are interactive when the cursor is hidden * * This variable can be set to the following values: * "0" - The window frame is not interactive when the cursor is hidden (no move, resize, etc) @@ -1666,7 +2148,7 @@ extern "C" { #define SDL_HINT_WINDOW_FRAME_USABLE_WHILE_CURSOR_HIDDEN "SDL_WINDOW_FRAME_USABLE_WHILE_CURSOR_HIDDEN" /** -* \brief A variable controlling whether the window is activated when the SDL_ShowWindow function is called +* \brief A variable controlling whether the window is activated when the SDL_ShowWindow function is called * * This variable can be set to the following values: * "0" - The window is activated when the SDL_ShowWindow function is called @@ -1796,6 +2278,15 @@ extern "C" { */ #define SDL_HINT_XINPUT_ENABLED "SDL_XINPUT_ENABLED" + /** + * \brief A variable that lets you disable the detection and use of DirectInput gamepad devices + * + * The variable can be set to the following values: + * "0" - Disable DirectInput detection (only uses XInput) + * "1" - Enable DirectInput detection (the default) + */ +#define SDL_HINT_DIRECTINPUT_ENABLED "SDL_DIRECTINPUT_ENABLED" + /** * \brief A variable that causes SDL to use the old axis and button mapping for XInput devices. * @@ -1824,6 +2315,133 @@ extern "C" { */ #define SDL_HINT_AUDIO_INCLUDE_MONITORS "SDL_AUDIO_INCLUDE_MONITORS" +/** + * \brief A variable that forces X11 windows to create as a custom type. + * + * This is currently only used for X11 and ignored elsewhere. + * + * During SDL_CreateWindow, SDL uses the _NET_WM_WINDOW_TYPE X11 property + * to report to the window manager the type of window it wants to create. + * This might be set to various things if SDL_WINDOW_TOOLTIP or + * SDL_WINDOW_POPUP_MENU, etc, were specified. For "normal" windows that + * haven't set a specific type, this hint can be used to specify a custom + * type. For example, a dock window might set this to + * "_NET_WM_WINDOW_TYPE_DOCK". + * + * If not set or set to "", this hint is ignored. This hint must be set + * before the SDL_CreateWindow() call that it is intended to affect. + * + * This hint is available since SDL 2.0.22. + */ +#define SDL_HINT_X11_WINDOW_TYPE "SDL_X11_WINDOW_TYPE" + +/** + * \brief A variable that decides whether to send SDL_QUIT when closing the final window. + * + * By default, SDL sends an SDL_QUIT event when there is only one window + * and it receives an SDL_WINDOWEVENT_CLOSE event, under the assumption most + * apps would also take the loss of this window as a signal to terminate the + * program. + * + * However, it's not unreasonable in some cases to have the program continue + * to live on, perhaps to create new windows later. + * + * Changing this hint to "0" will cause SDL to not send an SDL_QUIT event + * when the final window is requesting to close. Note that in this case, + * there are still other legitimate reasons one might get an SDL_QUIT + * event: choosing "Quit" from the macOS menu bar, sending a SIGINT (ctrl-c) + * on Unix, etc. + * + * The default value is "1". This hint can be changed at any time. + * + * This hint is available since SDL 2.0.22. Before then, you always get + * an SDL_QUIT event when closing the final window. + */ +#define SDL_HINT_QUIT_ON_LAST_WINDOW_CLOSE "SDL_QUIT_ON_LAST_WINDOW_CLOSE" + + +/** + * \brief A variable that decides what video backend to use. + * + * By default, SDL will try all available video backends in a reasonable + * order until it finds one that can work, but this hint allows the app + * or user to force a specific target, such as "x11" if, say, you are + * on Wayland but want to try talking to the X server instead. + * + * This functionality has existed since SDL 2.0.0 (indeed, before that) + * but before 2.0.22 this was an environment variable only. In 2.0.22, + * it was upgraded to a full SDL hint, so you can set the environment + * variable as usual or programatically set the hint with SDL_SetHint, + * which won't propagate to child processes. + * + * The default value is unset, in which case SDL will try to figure out + * the best video backend on your behalf. This hint needs to be set + * before SDL_Init() is called to be useful. + * + * This hint is available since SDL 2.0.22. Before then, you could set + * the environment variable to get the same effect. + */ +#define SDL_HINT_VIDEODRIVER "SDL_VIDEODRIVER" + +/** + * \brief A variable that decides what audio backend to use. + * + * By default, SDL will try all available audio backends in a reasonable + * order until it finds one that can work, but this hint allows the app + * or user to force a specific target, such as "alsa" if, say, you are + * on PulseAudio but want to try talking to the lower level instead. + * + * This functionality has existed since SDL 2.0.0 (indeed, before that) + * but before 2.0.22 this was an environment variable only. In 2.0.22, + * it was upgraded to a full SDL hint, so you can set the environment + * variable as usual or programatically set the hint with SDL_SetHint, + * which won't propagate to child processes. + * + * The default value is unset, in which case SDL will try to figure out + * the best audio backend on your behalf. This hint needs to be set + * before SDL_Init() is called to be useful. + * + * This hint is available since SDL 2.0.22. Before then, you could set + * the environment variable to get the same effect. + */ +#define SDL_HINT_AUDIODRIVER "SDL_AUDIODRIVER" + +/** + * \brief A variable that decides what KMSDRM device to use. + * + * Internally, SDL might open something like "/dev/dri/cardNN" to + * access KMSDRM functionality, where "NN" is a device index number. + * + * SDL makes a guess at the best index to use (usually zero), but the + * app or user can set this hint to a number between 0 and 99 to + * force selection. + * + * This hint is available since SDL 2.24.0. + */ +#define SDL_HINT_KMSDRM_DEVICE_INDEX "SDL_KMSDRM_DEVICE_INDEX" + + +/** + * \brief A variable that treats trackpads as touch devices. + * + * On macOS (and possibly other platforms in the future), SDL will report + * touches on a trackpad as mouse input, which is generally what users + * expect from this device; however, these are often actually full + * multitouch-capable touch devices, so it might be preferable to some apps + * to treat them as such. + * + * Setting this hint to true will make the trackpad input report as a + * multitouch device instead of a mouse. The default is false. + * + * Note that most platforms don't support this hint. As of 2.24.0, it + * only supports MacBooks' trackpads on macOS. Others may follow later. + * + * This hint is checked during SDL_Init and can not be changed after. + * + * This hint is available since SDL 2.24.0. + */ +#define SDL_HINT_TRACKPAD_IS_TOUCH_ONLY "SDL_TRACKPAD_IS_TOUCH_ONLY" + /** * \brief An enumeration of hint priorities @@ -1876,6 +2494,38 @@ extern DECLSPEC SDL_bool SDLCALL SDL_SetHintWithPriority(const char *name, extern DECLSPEC SDL_bool SDLCALL SDL_SetHint(const char *name, const char *value); +/** + * Reset a hint to the default value. + * + * This will reset a hint to the value of the environment variable, or NULL if + * the environment isn't set. Callbacks will be called normally with this + * change. + * + * \param name the hint to set + * \returns SDL_TRUE if the hint was set, SDL_FALSE otherwise. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GetHint + * \sa SDL_SetHint + */ +extern DECLSPEC SDL_bool SDLCALL SDL_ResetHint(const char *name); + +/** + * Reset all hints to the default values. + * + * This will reset all hints to the value of the associated environment + * variable, or NULL if the environment isn't set. Callbacks will be called + * normally with this change. + * + * \since This function is available since SDL 2.26.0. + * + * \sa SDL_GetHint + * \sa SDL_SetHint + * \sa SDL_ResetHint + */ +extern DECLSPEC void SDLCALL SDL_ResetHints(void); + /** * Get the value of a hint. * @@ -1949,9 +2599,16 @@ extern DECLSPEC void SDLCALL SDL_DelHintCallback(const char *name, /** * Clear all hints. * - * This function is automatically called during SDL_Quit(). + * This function is automatically called during SDL_Quit(), and deletes all + * callbacks without calling them and frees all memory associated with hints. + * If you're calling this from application code you probably want to call + * SDL_ResetHints() instead. + * + * This function will be removed from the API the next time we rev the ABI. * * \since This function is available since SDL 2.0.0. + * + * \sa SDL_ResetHints */ extern DECLSPEC void SDLCALL SDL_ClearHints(void); diff --git a/libs/SDL2/include/SDL_joystick.h b/libs/SDL2/include/SDL_joystick.h index e80c005..b9b4f62 100644 --- a/libs/SDL2/include/SDL_joystick.h +++ b/libs/SDL2/include/SDL_joystick.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -43,6 +43,8 @@ #include "SDL_stdinc.h" #include "SDL_error.h" +#include "SDL_guid.h" +#include "SDL_mutex.h" #include "begin_code.h" /* Set up for C function definitions, even when using C++ */ @@ -65,13 +67,14 @@ extern "C" { /** * The joystick structure used to identify an SDL joystick */ +#ifdef SDL_THREAD_SAFETY_ANALYSIS +extern SDL_mutex *SDL_joystick_lock; +#endif struct _SDL_Joystick; typedef struct _SDL_Joystick SDL_Joystick; /* A structure that encodes the stable unique id for a joystick device */ -typedef struct { - Uint8 data[16]; -} SDL_JoystickGUID; +typedef SDL_GUID SDL_JoystickGUID; /** * This is a unique ID for a joystick for the time it is connected to the system, @@ -125,9 +128,14 @@ typedef enum * the API functions that take a joystick index will be valid, and joystick * and game controller events will not be delivered. * + * As of SDL 2.26.0, you can take the joystick lock around reinitializing the + * joystick subsystem, to prevent other threads from seeing joysticks in an + * uninitialized state. However, all open joysticks will be closed and SDL + * functions called with them will fail. + * * \since This function is available since SDL 2.0.7. */ -extern DECLSPEC void SDLCALL SDL_LockJoysticks(void); +extern DECLSPEC void SDLCALL SDL_LockJoysticks(void) SDL_ACQUIRE(SDL_joystick_lock); /** @@ -142,7 +150,7 @@ extern DECLSPEC void SDLCALL SDL_LockJoysticks(void); * * \since This function is available since SDL 2.0.7. */ -extern DECLSPEC void SDLCALL SDL_UnlockJoysticks(void); +extern DECLSPEC void SDLCALL SDL_UnlockJoysticks(void) SDL_RELEASE(SDL_joystick_lock); /** * Count the number of joysticks attached to the system. @@ -153,6 +161,7 @@ extern DECLSPEC void SDLCALL SDL_UnlockJoysticks(void); * \since This function is available since SDL 2.0.0. * * \sa SDL_JoystickName + * \sa SDL_JoystickPath * \sa SDL_JoystickOpen */ extern DECLSPEC int SDLCALL SDL_NumJoysticks(void); @@ -174,6 +183,23 @@ extern DECLSPEC int SDLCALL SDL_NumJoysticks(void); */ extern DECLSPEC const char *SDLCALL SDL_JoystickNameForIndex(int device_index); +/** + * Get the implementation dependent path of a joystick. + * + * This can be called before any joysticks are opened. + * + * \param device_index the index of the joystick to query (the N'th joystick + * on the system) + * \returns the path of the selected joystick. If no path can be found, this + * function returns NULL; call SDL_GetError() for more information. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_JoystickPath + * \sa SDL_JoystickOpen + */ +extern DECLSPEC const char *SDLCALL SDL_JoystickPathForIndex(int device_index); + /** * Get the player index of a joystick, or -1 if it's not available This can be * called before any joysticks are opened. @@ -262,13 +288,12 @@ extern DECLSPEC SDL_JoystickType SDLCALL SDL_JoystickGetDeviceType(int device_in /** * Get the instance ID of a joystick. * - * This can be called before any joysticks are opened. If the index is out of - * range, this function will return -1. + * This can be called before any joysticks are opened. * * \param device_index the index of the joystick to query (the N'th joystick * on the system * \returns the instance id of the selected joystick. If called on an invalid - * index, this function returns zero + * index, this function returns -1. * * \since This function is available since SDL 2.0.6. */ @@ -330,6 +355,54 @@ extern DECLSPEC int SDLCALL SDL_JoystickAttachVirtual(SDL_JoystickType type, int nbuttons, int nhats); +/** + * The structure that defines an extended virtual joystick description + * + * The caller must zero the structure and then initialize the version with `SDL_VIRTUAL_JOYSTICK_DESC_VERSION` before passing it to SDL_JoystickAttachVirtualEx() + * All other elements of this structure are optional and can be left 0. + * + * \sa SDL_JoystickAttachVirtualEx + */ +typedef struct SDL_VirtualJoystickDesc +{ + Uint16 version; /**< `SDL_VIRTUAL_JOYSTICK_DESC_VERSION` */ + Uint16 type; /**< `SDL_JoystickType` */ + Uint16 naxes; /**< the number of axes on this joystick */ + Uint16 nbuttons; /**< the number of buttons on this joystick */ + Uint16 nhats; /**< the number of hats on this joystick */ + Uint16 vendor_id; /**< the USB vendor ID of this joystick */ + Uint16 product_id; /**< the USB product ID of this joystick */ + Uint16 padding; /**< unused */ + Uint32 button_mask; /**< A mask of which buttons are valid for this controller + e.g. (1 << SDL_CONTROLLER_BUTTON_A) */ + Uint32 axis_mask; /**< A mask of which axes are valid for this controller + e.g. (1 << SDL_CONTROLLER_AXIS_LEFTX) */ + const char *name; /**< the name of the joystick */ + + void *userdata; /**< User data pointer passed to callbacks */ + void (SDLCALL *Update)(void *userdata); /**< Called when the joystick state should be updated */ + void (SDLCALL *SetPlayerIndex)(void *userdata, int player_index); /**< Called when the player index is set */ + int (SDLCALL *Rumble)(void *userdata, Uint16 low_frequency_rumble, Uint16 high_frequency_rumble); /**< Implements SDL_JoystickRumble() */ + int (SDLCALL *RumbleTriggers)(void *userdata, Uint16 left_rumble, Uint16 right_rumble); /**< Implements SDL_JoystickRumbleTriggers() */ + int (SDLCALL *SetLED)(void *userdata, Uint8 red, Uint8 green, Uint8 blue); /**< Implements SDL_JoystickSetLED() */ + int (SDLCALL *SendEffect)(void *userdata, const void *data, int size); /**< Implements SDL_JoystickSendEffect() */ + +} SDL_VirtualJoystickDesc; + +/** + * \brief The current version of the SDL_VirtualJoystickDesc structure + */ +#define SDL_VIRTUAL_JOYSTICK_DESC_VERSION 1 + +/** + * Attach a new virtual joystick with extended properties. + * + * \returns the joystick's device index, or -1 if an error occurred. + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC int SDLCALL SDL_JoystickAttachVirtualEx(const SDL_VirtualJoystickDesc *desc); + /** * Detach a virtual joystick. * @@ -360,6 +433,10 @@ extern DECLSPEC SDL_bool SDLCALL SDL_JoystickIsVirtual(int device_index); * the following: SDL_PollEvent, SDL_PumpEvents, SDL_WaitEventTimeout, * SDL_WaitEvent. * + * Note that when sending trigger axes, you should scale the value to the full + * range of Sint16. For example, a trigger at rest would have the value of + * `SDL_JOYSTICK_AXIS_MIN`. + * * \param joystick the virtual joystick on which to set state. * \param axis the specific axis on the virtual joystick to set. * \param value the new value for the specified axis. @@ -419,6 +496,19 @@ extern DECLSPEC int SDLCALL SDL_JoystickSetVirtualHat(SDL_Joystick *joystick, in */ extern DECLSPEC const char *SDLCALL SDL_JoystickName(SDL_Joystick *joystick); +/** + * Get the implementation dependent path of a joystick. + * + * \param joystick the SDL_Joystick obtained from SDL_JoystickOpen() + * \returns the path of the selected joystick. If no path can be found, this + * function returns NULL; call SDL_GetError() for more information. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_JoystickPathForIndex + */ +extern DECLSPEC const char *SDLCALL SDL_JoystickPath(SDL_Joystick *joystick); + /** * Get the player index of an opened joystick. * @@ -436,7 +526,8 @@ extern DECLSPEC int SDLCALL SDL_JoystickGetPlayerIndex(SDL_Joystick *joystick); * Set the player index of an opened joystick. * * \param joystick the SDL_Joystick obtained from SDL_JoystickOpen() - * \param player_index the player index to set. + * \param player_index Player index to assign to this joystick, or -1 to clear + * the player index and turn off player LEDs. * * \since This function is available since SDL 2.0.12. */ @@ -495,6 +586,19 @@ extern DECLSPEC Uint16 SDLCALL SDL_JoystickGetProduct(SDL_Joystick *joystick); */ extern DECLSPEC Uint16 SDLCALL SDL_JoystickGetProductVersion(SDL_Joystick *joystick); +/** + * Get the firmware version of an opened joystick, if available. + * + * If the firmware version isn't available this function returns 0. + * + * \param joystick the SDL_Joystick obtained from SDL_JoystickOpen() + * \returns the firmware version of the selected joystick, or 0 if + * unavailable. + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC Uint16 SDLCALL SDL_JoystickGetFirmwareVersion(SDL_Joystick *joystick); + /** * Get the serial number of an opened joystick, if available. * @@ -551,6 +655,25 @@ extern DECLSPEC void SDLCALL SDL_JoystickGetGUIDString(SDL_JoystickGUID guid, ch */ extern DECLSPEC SDL_JoystickGUID SDLCALL SDL_JoystickGetGUIDFromString(const char *pchGUID); +/** + * Get the device information encoded in a SDL_JoystickGUID structure + * + * \param guid the SDL_JoystickGUID you wish to get info about + * \param vendor A pointer filled in with the device VID, or 0 if not + * available + * \param product A pointer filled in with the device PID, or 0 if not + * available + * \param version A pointer filled in with the device version, or 0 if not + * available + * \param crc16 A pointer filled in with a CRC used to distinguish different + * products with the same VID/PID, or 0 if not available + * + * \since This function is available since SDL 2.26.0. + * + * \sa SDL_JoystickGetDeviceGUID + */ +extern DECLSPEC void SDLCALL SDL_GetJoystickGUIDInfo(SDL_JoystickGUID guid, Uint16 *vendor, Uint16 *product, Uint16 *version, Uint16 *crc16); + /** * Get the status of a specified joystick. * @@ -829,9 +952,9 @@ extern DECLSPEC int SDLCALL SDL_JoystickRumble(SDL_Joystick *joystick, Uint16 lo * Each call to this function cancels any previous trigger rumble effect, and * calling it with 0 intensity stops any rumbling. * - * Note that this function is for _trigger_ rumble; the first joystick to - * support this was the PlayStation 5's DualShock 5 controller. If you want - * the (more common) whole-controller rumble, use SDL_JoystickRumble() + * Note that this is rumbling of the _triggers_ and not the game controller as + * a whole. This is currently only supported on Xbox One controllers. If you + * want the (more common) whole-controller rumble, use SDL_JoystickRumble() * instead. * * \param joystick The joystick to vibrate diff --git a/libs/SDL2/include/SDL_keyboard.h b/libs/SDL2/include/SDL_keyboard.h index a53dde6..86a37ad 100644 --- a/libs/SDL2/include/SDL_keyboard.h +++ b/libs/SDL2/include/SDL_keyboard.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -90,9 +90,21 @@ extern DECLSPEC SDL_Window * SDLCALL SDL_GetKeyboardFocus(void); * \since This function is available since SDL 2.0.0. * * \sa SDL_PumpEvents + * \sa SDL_ResetKeyboard */ extern DECLSPEC const Uint8 *SDLCALL SDL_GetKeyboardState(int *numkeys); +/** + * Clear the state of the keyboard + * + * This function will generate key up events for all pressed keys. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GetKeyboardState + */ +extern DECLSPEC void SDLCALL SDL_ResetKeyboard(void); + /** * Get the current key modifier state for the keyboard. * @@ -268,9 +280,34 @@ extern DECLSPEC SDL_bool SDLCALL SDL_IsTextInputActive(void); */ extern DECLSPEC void SDLCALL SDL_StopTextInput(void); +/** + * Dismiss the composition window/IME without disabling the subsystem. + * + * \since This function is available since SDL 2.0.22. + * + * \sa SDL_StartTextInput + * \sa SDL_StopTextInput + */ +extern DECLSPEC void SDLCALL SDL_ClearComposition(void); + +/** + * Returns if an IME Composite or Candidate window is currently shown. + * + * \since This function is available since SDL 2.0.22. + */ +extern DECLSPEC SDL_bool SDLCALL SDL_IsTextInputShown(void); + /** * Set the rectangle used to type Unicode text inputs. * + * To start text input in a given location, this function is intended to be + * called before SDL_StartTextInput, although some platforms support moving + * the rectangle even while text input (and a composition) is active. + * + * Note: If you want to use the system native IME window, try setting hint + * **SDL_HINT_IME_SHOW_UI** to **1**, otherwise this function won't give you + * any feedback. + * * \param rect the SDL_Rect structure representing the rectangle to receive * text (ignored if NULL) * @@ -278,7 +315,7 @@ extern DECLSPEC void SDLCALL SDL_StopTextInput(void); * * \sa SDL_StartTextInput */ -extern DECLSPEC void SDLCALL SDL_SetTextInputRect(SDL_Rect *rect); +extern DECLSPEC void SDLCALL SDL_SetTextInputRect(const SDL_Rect *rect); /** * Check whether the platform has screen keyboard support. diff --git a/libs/SDL2/include/SDL_keycode.h b/libs/SDL2/include/SDL_keycode.h index 3560254..7106223 100644 --- a/libs/SDL2/include/SDL_keycode.h +++ b/libs/SDL2/include/SDL_keycode.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -40,7 +40,7 @@ * an SDLK_* constant for those keys that do not generate characters. * * A special exception is the number keys at the top of the keyboard which - * always map to SDLK_0...SDLK_9, regardless of layout. + * map to SDLK_0...SDLK_9 on AZERTY layouts. */ typedef Sint32 SDL_Keycode; @@ -318,7 +318,12 @@ typedef enum SDLK_APP2 = SDL_SCANCODE_TO_KEYCODE(SDL_SCANCODE_APP2), SDLK_AUDIOREWIND = SDL_SCANCODE_TO_KEYCODE(SDL_SCANCODE_AUDIOREWIND), - SDLK_AUDIOFASTFORWARD = SDL_SCANCODE_TO_KEYCODE(SDL_SCANCODE_AUDIOFASTFORWARD) + SDLK_AUDIOFASTFORWARD = SDL_SCANCODE_TO_KEYCODE(SDL_SCANCODE_AUDIOFASTFORWARD), + + SDLK_SOFTLEFT = SDL_SCANCODE_TO_KEYCODE(SDL_SCANCODE_SOFTLEFT), + SDLK_SOFTRIGHT = SDL_SCANCODE_TO_KEYCODE(SDL_SCANCODE_SOFTRIGHT), + SDLK_CALL = SDL_SCANCODE_TO_KEYCODE(SDL_SCANCODE_CALL), + SDLK_ENDCALL = SDL_SCANCODE_TO_KEYCODE(SDL_SCANCODE_ENDCALL) } SDL_KeyCode; /** diff --git a/libs/SDL2/include/SDL_loadso.h b/libs/SDL2/include/SDL_loadso.h index 61857c8..ca59b68 100644 --- a/libs/SDL2/include/SDL_loadso.h +++ b/libs/SDL2/include/SDL_loadso.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_locale.h b/libs/SDL2/include/SDL_locale.h index 7515779..482dbef 100644 --- a/libs/SDL2/include/SDL_locale.h +++ b/libs/SDL2/include/SDL_locale.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_log.h b/libs/SDL2/include/SDL_log.h index dbbcb1e..da733c4 100644 --- a/libs/SDL2/include/SDL_log.h +++ b/libs/SDL2/include/SDL_log.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -47,9 +47,9 @@ extern "C" { /** - * \brief The maximum size of a log message + * \brief The maximum size of a log message prior to SDL 2.0.24 * - * Messages longer than the maximum size will be truncated + * As of 2.0.24 there is no limit to the length of SDL log messages. */ #define SDL_MAX_LOG_MESSAGE 4096 diff --git a/libs/SDL2/include/SDL_main.h b/libs/SDL2/include/SDL_main.h index b3fec15..5cc8e59 100644 --- a/libs/SDL2/include/SDL_main.h +++ b/libs/SDL2/include/SDL_main.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -51,6 +51,15 @@ */ #define SDL_MAIN_NEEDED +#elif defined(__GDK__) +/* On GDK, SDL provides a main function that initializes the game runtime. + + Please note that #include'ing SDL_main.h is not enough to get a main() + function working. You must either link against SDL2main or, if not possible, + call the SDL_GDKRunApp function from your entry point. +*/ +#define SDL_MAIN_NEEDED + #elif defined(__IPHONEOS__) /* On iOS SDL provides a main function that creates an application delegate and starts the iOS application run loop. @@ -92,6 +101,22 @@ */ #define SDL_MAIN_AVAILABLE +#elif defined(__PS2__) +#define SDL_MAIN_AVAILABLE + +#define SDL_PS2_SKIP_IOP_RESET() \ + void reset_IOP(); \ + void reset_IOP() {} + +#elif defined(__3DS__) +/* + On N3DS, SDL provides a main function that sets up the screens + and storage. + + If you provide this yourself, you may define SDL_MAIN_HANDLED +*/ +#define SDL_MAIN_AVAILABLE + #endif #endif /* SDL_MAIN_HANDLED */ @@ -145,7 +170,7 @@ extern SDLMAIN_DECLSPEC int SDL_main(int argc, char *argv[]); */ extern DECLSPEC void SDLCALL SDL_SetMainReady(void); -#ifdef __WIN32__ +#if defined(__WIN32__) || defined(__GDK__) /** * Register a win32 window class for SDL's use. @@ -189,7 +214,7 @@ extern DECLSPEC int SDLCALL SDL_RegisterApp(const char *name, Uint32 style, void */ extern DECLSPEC void SDLCALL SDL_UnregisterApp(void); -#endif /* __WIN32__ */ +#endif /* defined(__WIN32__) || defined(__GDK__) */ #ifdef __WINRT__ @@ -224,6 +249,28 @@ extern DECLSPEC int SDLCALL SDL_UIKitRunApp(int argc, char *argv[], SDL_main_fun #endif /* __IPHONEOS__ */ +#ifdef __GDK__ + +/** + * Initialize and launch an SDL GDK application. + * + * \param mainFunction the SDL app's C-style main(), an SDL_main_func + * \param reserved reserved for future use; should be NULL + * \returns 0 on success or -1 on failure; call SDL_GetError() to retrieve + * more information on the failure. + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC int SDLCALL SDL_GDKRunApp(SDL_main_func mainFunction, void *reserved); + +/** + * Callback from the application to let the suspend continue. + * + * \since This function is available since SDL 2.28.0. + */ +extern DECLSPEC void SDLCALL SDL_GDKSuspendComplete(void); + +#endif /* __GDK__ */ #ifdef __cplusplus } diff --git a/libs/SDL2/include/SDL_messagebox.h b/libs/SDL2/include/SDL_messagebox.h index d763534..7896fd1 100644 --- a/libs/SDL2/include/SDL_messagebox.h +++ b/libs/SDL2/include/SDL_messagebox.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_metal.h b/libs/SDL2/include/SDL_metal.h index 9ecaa81..f36e348 100644 --- a/libs/SDL2/include/SDL_metal.h +++ b/libs/SDL2/include/SDL_metal.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -82,7 +82,7 @@ extern DECLSPEC void SDLCALL SDL_Metal_DestroyView(SDL_MetalView view); * * \since This function is available since SDL 2.0.14. * - * \sa SDL_MetalCreateView + * \sa SDL_Metal_CreateView */ extern DECLSPEC void *SDLCALL SDL_Metal_GetLayer(SDL_MetalView view); @@ -92,6 +92,7 @@ extern DECLSPEC void *SDLCALL SDL_Metal_GetLayer(SDL_MetalView view); * * \param window SDL_Window from which the drawable size should be queried * \param w Pointer to variable for storing the width in pixels, may be NULL + * \param h Pointer to variable for storing the height in pixels, may be NULL * * \since This function is available since SDL 2.0.14. * diff --git a/libs/SDL2/include/SDL_misc.h b/libs/SDL2/include/SDL_misc.h index 261b6b8..13ed9c7 100644 --- a/libs/SDL2/include/SDL_misc.h +++ b/libs/SDL2/include/SDL_misc.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_mouse.h b/libs/SDL2/include/SDL_mouse.h index 1d4a2db..aa07575 100644 --- a/libs/SDL2/include/SDL_mouse.h +++ b/libs/SDL2/include/SDL_mouse.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -154,7 +154,9 @@ extern DECLSPEC Uint32 SDLCALL SDL_GetRelativeMouseState(int *x, int *y); /** * Move the mouse cursor to the given position within the window. * - * This function generates a mouse motion event. + * This function generates a mouse motion event if relative mode is not + * enabled. If relative mode is enabled, you can force mouse events for the + * warp by setting the SDL_HINT_MOUSE_RELATIVE_WARP_MOTION hint. * * Note that this function will appear to succeed, but not actually move the * mouse when used over Microsoft Remote Desktop. @@ -196,13 +198,9 @@ extern DECLSPEC int SDLCALL SDL_WarpMouseGlobal(int x, int y); /** * Set relative mouse mode. * - * While the mouse is in relative mode, the cursor is hidden, and the driver - * will try to report continuous motion in the current window. Only relative - * motion events will be delivered, the mouse position will not change. - * - * Note that this function will not be able to provide continuous relative - * motion when used over Microsoft Remote Desktop, instead motion is limited - * to the bounds of the screen. + * While the mouse is in relative mode, the cursor is hidden, the mouse + * position is constrained to the window, and SDL will report continuous + * relative mouse motion even if the mouse is at the edge of the window. * * This function will flush any pending mouse motion. * @@ -245,6 +243,15 @@ extern DECLSPEC int SDLCALL SDL_SetRelativeMouseMode(SDL_bool enabled); * While capturing is enabled, the current window will have the * `SDL_WINDOW_MOUSE_CAPTURE` flag set. * + * Please note that as of SDL 2.0.22, SDL will attempt to "auto capture" the + * mouse while the user is pressing a button; this is to try and make mouse + * behavior more consistent between platforms, and deal with the common case + * of a user dragging the mouse outside of the window. This means that if you + * are calling SDL_CaptureMouse() only to deal with this situation, you no + * longer have to (although it is safe to do so). If this causes problems for + * your app, you can disable auto capture by setting the + * `SDL_HINT_MOUSE_AUTO_CAPTURE` hint to zero. + * * \param enabled SDL_TRUE to enable capturing, SDL_FALSE to disable. * \returns 0 on success or -1 if not supported; call SDL_GetError() for more * information. @@ -378,6 +385,9 @@ extern DECLSPEC SDL_Cursor *SDLCALL SDL_GetCursor(void); /** * Get the default cursor. * + * You do not have to call SDL_FreeCursor() on the return value, but it is + * safe to do so. + * * \returns the default cursor on success or NULL on failure. * * \since This function is available since SDL 2.0.0. diff --git a/libs/SDL2/include/SDL_mutex.h b/libs/SDL2/include/SDL_mutex.h index 173468f..e679d38 100644 --- a/libs/SDL2/include/SDL_mutex.h +++ b/libs/SDL2/include/SDL_mutex.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -31,6 +31,80 @@ #include "SDL_stdinc.h" #include "SDL_error.h" +/******************************************************************************/ +/* Enable thread safety attributes only with clang. + * The attributes can be safely erased when compiling with other compilers. + */ +#if defined(SDL_THREAD_SAFETY_ANALYSIS) && \ + defined(__clang__) && (!defined(SWIG)) +#define SDL_THREAD_ANNOTATION_ATTRIBUTE__(x) __attribute__((x)) +#else +#define SDL_THREAD_ANNOTATION_ATTRIBUTE__(x) /* no-op */ +#endif + +#define SDL_CAPABILITY(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(capability(x)) + +#define SDL_SCOPED_CAPABILITY \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(scoped_lockable) + +#define SDL_GUARDED_BY(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(guarded_by(x)) + +#define SDL_PT_GUARDED_BY(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(pt_guarded_by(x)) + +#define SDL_ACQUIRED_BEFORE(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(acquired_before(x)) + +#define SDL_ACQUIRED_AFTER(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(acquired_after(x)) + +#define SDL_REQUIRES(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(requires_capability(x)) + +#define SDL_REQUIRES_SHARED(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(requires_shared_capability(x)) + +#define SDL_ACQUIRE(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(acquire_capability(x)) + +#define SDL_ACQUIRE_SHARED(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(acquire_shared_capability(x)) + +#define SDL_RELEASE(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(release_capability(x)) + +#define SDL_RELEASE_SHARED(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(release_shared_capability(x)) + +#define SDL_RELEASE_GENERIC(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(release_generic_capability(x)) + +#define SDL_TRY_ACQUIRE(x, y) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(try_acquire_capability(x, y)) + +#define SDL_TRY_ACQUIRE_SHARED(x, y) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(try_acquire_shared_capability(x, y)) + +#define SDL_EXCLUDES(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(locks_excluded(x)) + +#define SDL_ASSERT_CAPABILITY(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(assert_capability(x)) + +#define SDL_ASSERT_SHARED_CAPABILITY(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(assert_shared_capability(x)) + +#define SDL_RETURN_CAPABILITY(x) \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(lock_returned(x)) + +#define SDL_NO_THREAD_SAFETY_ANALYSIS \ + SDL_THREAD_ANNOTATION_ATTRIBUTE__(no_thread_safety_analysis) + +/******************************************************************************/ + + #include "begin_code.h" /* Set up for C function definitions, even when using C++ */ #ifdef __cplusplus @@ -96,7 +170,7 @@ extern DECLSPEC SDL_mutex *SDLCALL SDL_CreateMutex(void); * * \since This function is available since SDL 2.0.0. */ -extern DECLSPEC int SDLCALL SDL_LockMutex(SDL_mutex * mutex); +extern DECLSPEC int SDLCALL SDL_LockMutex(SDL_mutex * mutex) SDL_ACQUIRE(mutex); #define SDL_mutexP(m) SDL_LockMutex(m) /** @@ -119,7 +193,7 @@ extern DECLSPEC int SDLCALL SDL_LockMutex(SDL_mutex * mutex); * \sa SDL_LockMutex * \sa SDL_UnlockMutex */ -extern DECLSPEC int SDLCALL SDL_TryLockMutex(SDL_mutex * mutex); +extern DECLSPEC int SDLCALL SDL_TryLockMutex(SDL_mutex * mutex) SDL_TRY_ACQUIRE(0, mutex); /** * Unlock the mutex. @@ -138,7 +212,7 @@ extern DECLSPEC int SDLCALL SDL_TryLockMutex(SDL_mutex * mutex); * * \since This function is available since SDL 2.0.0. */ -extern DECLSPEC int SDLCALL SDL_UnlockMutex(SDL_mutex * mutex); +extern DECLSPEC int SDLCALL SDL_UnlockMutex(SDL_mutex * mutex) SDL_RELEASE(mutex); #define SDL_mutexV(m) SDL_UnlockMutex(m) /** @@ -276,7 +350,7 @@ extern DECLSPEC int SDLCALL SDL_SemTryWait(SDL_sem * sem); * successful it will atomically decrement the semaphore value. * * \param sem the semaphore to wait on - * \param ms the length of the timeout, in milliseconds + * \param timeout the length of the timeout, in milliseconds * \returns 0 if the wait succeeds, `SDL_MUTEX_TIMEDOUT` if the wait does not * succeed in the allotted time, or a negative error code on failure; * call SDL_GetError() for more information. @@ -290,7 +364,7 @@ extern DECLSPEC int SDLCALL SDL_SemTryWait(SDL_sem * sem); * \sa SDL_SemValue * \sa SDL_SemWait */ -extern DECLSPEC int SDLCALL SDL_SemWaitTimeout(SDL_sem * sem, Uint32 ms); +extern DECLSPEC int SDLCALL SDL_SemWaitTimeout(SDL_sem *sem, Uint32 timeout); /** * Atomically increment a semaphore's value and wake waiting threads. diff --git a/libs/SDL2/include/SDL_name.h b/libs/SDL2/include/SDL_name.h index 6ff35b4..5c3e07a 100644 --- a/libs/SDL2/include/SDL_name.h +++ b/libs/SDL2/include/SDL_name.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_opengl.h b/libs/SDL2/include/SDL_opengl.h index 9aed503..0ba8912 100644 --- a/libs/SDL2/include/SDL_opengl.h +++ b/libs/SDL2/include/SDL_opengl.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -2107,57 +2107,6 @@ typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLsh -/* - * ???. GL_MESA_packed_depth_stencil - * XXX obsolete - */ -#ifndef GL_MESA_packed_depth_stencil -#define GL_MESA_packed_depth_stencil 1 - -#define GL_DEPTH_STENCIL_MESA 0x8750 -#define GL_UNSIGNED_INT_24_8_MESA 0x8751 -#define GL_UNSIGNED_INT_8_24_REV_MESA 0x8752 -#define GL_UNSIGNED_SHORT_15_1_MESA 0x8753 -#define GL_UNSIGNED_SHORT_1_15_REV_MESA 0x8754 - -#endif /* GL_MESA_packed_depth_stencil */ - - -#ifndef GL_ATI_blend_equation_separate -#define GL_ATI_blend_equation_separate 1 - -#define GL_ALPHA_BLEND_EQUATION_ATI 0x883D - -GLAPI void GLAPIENTRY glBlendEquationSeparateATI( GLenum modeRGB, GLenum modeA ); -typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEATIPROC) (GLenum modeRGB, GLenum modeA); - -#endif /* GL_ATI_blend_equation_separate */ - - -/* GL_OES_EGL_image */ -#ifndef GL_OES_EGL_image -typedef void* GLeglImageOES; -#endif - -#ifndef GL_OES_EGL_image -#define GL_OES_EGL_image 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glEGLImageTargetTexture2DOES (GLenum target, GLeglImageOES image); -GLAPI void APIENTRY glEGLImageTargetRenderbufferStorageOES (GLenum target, GLeglImageOES image); -#endif -typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURE2DOESPROC) (GLenum target, GLeglImageOES image); -typedef void (APIENTRYP PFNGLEGLIMAGETARGETRENDERBUFFERSTORAGEOESPROC) (GLenum target, GLeglImageOES image); -#endif - - -/** - ** NOTE!!!!! If you add new functions to this file, or update - ** glext.h be sure to regenerate the gl_mangle.h file. See comments - ** in that file for details. - **/ - - - /********************************************************************** * Begin system-specific stuff */ diff --git a/libs/SDL2/include/SDL_opengl_glext.h b/libs/SDL2/include/SDL_opengl_glext.h index 6a402b1..ff6ad12 100644 --- a/libs/SDL2/include/SDL_opengl_glext.h +++ b/libs/SDL2/include/SDL_opengl_glext.h @@ -1,12 +1,49 @@ -#ifndef __glext_h_ +/* SDL modified the include guard to be compatible with Mesa and Apple include guards: + * - Mesa uses: __gl_glext_h_ + * - Apple uses: __glext_h_ */ +#if !defined(__glext_h_) && !defined(__gl_glext_h_) #define __glext_h_ 1 +#define __gl_glext_h_ 1 #ifdef __cplusplus extern "C" { #endif /* -** Copyright (c) 2013-2014 The Khronos Group Inc. +** Copyright 2013-2020 The Khronos Group Inc. +** SPDX-License-Identifier: MIT +** +** This header is generated from the Khronos OpenGL / OpenGL ES XML +** API Registry. The current version of the Registry, generator scripts +** used to make the header, and the header can be found at +** https://github.com/KhronosGroup/OpenGL-Registry +*/ + +#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) +#ifndef WIN32_LEAN_AND_MEAN +#define WIN32_LEAN_AND_MEAN 1 +#endif +#include +#endif + +#ifndef APIENTRY +#define APIENTRY +#endif +#ifndef APIENTRYP +#define APIENTRYP APIENTRY * +#endif +#ifndef GLAPI +#define GLAPI extern +#endif + +#define GL_GLEXT_VERSION 20220530 + +/*#include */ +#ifndef __khrplatform_h_ +#define __khrplatform_h_ + +/* +** Copyright (c) 2008-2018 The Khronos Group Inc. ** ** Permission is hereby granted, free of charge, to any person obtaining a ** copy of this software and/or associated documentation files (the @@ -27,36 +64,292 @@ extern "C" { ** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE ** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. */ + +/* Khronos platform-specific types and definitions. + * + * The master copy of khrplatform.h is maintained in the Khronos EGL + * Registry repository at https://github.com/KhronosGroup/EGL-Registry + * The last semantic modification to khrplatform.h was at commit ID: + * 67a3e0864c2d75ea5287b9f3d2eb74a745936692 + * + * Adopters may modify this file to suit their platform. Adopters are + * encouraged to submit platform specific modifications to the Khronos + * group so that they can be included in future versions of this file. + * Please submit changes by filing pull requests or issues on + * the EGL Registry repository linked above. + * + * + * See the Implementer's Guidelines for information about where this file + * should be located on your system and for more details of its use: + * http://www.khronos.org/registry/implementers_guide.pdf + * + * This file should be included as + * #include + * by Khronos client API header files that use its types and defines. + * + * The types in khrplatform.h should only be used to define API-specific types. + * + * Types defined in khrplatform.h: + * khronos_int8_t signed 8 bit + * khronos_uint8_t unsigned 8 bit + * khronos_int16_t signed 16 bit + * khronos_uint16_t unsigned 16 bit + * khronos_int32_t signed 32 bit + * khronos_uint32_t unsigned 32 bit + * khronos_int64_t signed 64 bit + * khronos_uint64_t unsigned 64 bit + * khronos_intptr_t signed same number of bits as a pointer + * khronos_uintptr_t unsigned same number of bits as a pointer + * khronos_ssize_t signed size + * khronos_usize_t unsigned size + * khronos_float_t signed 32 bit floating point + * khronos_time_ns_t unsigned 64 bit time in nanoseconds + * khronos_utime_nanoseconds_t unsigned time interval or absolute time in + * nanoseconds + * khronos_stime_nanoseconds_t signed time interval in nanoseconds + * khronos_boolean_enum_t enumerated boolean type. This should + * only be used as a base type when a client API's boolean type is + * an enum. Client APIs which use an integer or other type for + * booleans cannot use this as the base type for their boolean. + * + * Tokens defined in khrplatform.h: + * + * KHRONOS_FALSE, KHRONOS_TRUE Enumerated boolean false/true values. + * + * KHRONOS_SUPPORT_INT64 is 1 if 64 bit integers are supported; otherwise 0. + * KHRONOS_SUPPORT_FLOAT is 1 if floats are supported; otherwise 0. + * + * Calling convention macros defined in this file: + * KHRONOS_APICALL + * KHRONOS_APIENTRY + * KHRONOS_APIATTRIBUTES + * + * These may be used in function prototypes as: + * + * KHRONOS_APICALL void KHRONOS_APIENTRY funcname( + * int arg1, + * int arg2) KHRONOS_APIATTRIBUTES; + */ + +#if defined(__SCITECH_SNAP__) && !defined(KHRONOS_STATIC) +# define KHRONOS_STATIC 1 +#endif + +/*------------------------------------------------------------------------- + * Definition of KHRONOS_APICALL + *------------------------------------------------------------------------- + * This precedes the return type of the function in the function prototype. + */ +#if defined(KHRONOS_STATIC) + /* If the preprocessor constant KHRONOS_STATIC is defined, make the + * header compatible with static linking. */ +# define KHRONOS_APICALL +#elif defined(_WIN32) +# define KHRONOS_APICALL __declspec(dllimport) +#elif defined (__SYMBIAN32__) +# define KHRONOS_APICALL IMPORT_C +#elif defined(__ANDROID__) +# define KHRONOS_APICALL __attribute__((visibility("default"))) +#else +# define KHRONOS_APICALL +#endif + +/*------------------------------------------------------------------------- + * Definition of KHRONOS_APIENTRY + *------------------------------------------------------------------------- + * This follows the return type of the function and precedes the function + * name in the function prototype. + */ +#if defined(_WIN32) && !defined(_WIN32_WCE) && !defined(__SCITECH_SNAP__) + /* Win32 but not WinCE */ +# define KHRONOS_APIENTRY __stdcall +#else +# define KHRONOS_APIENTRY +#endif + +/*------------------------------------------------------------------------- + * Definition of KHRONOS_APIATTRIBUTES + *------------------------------------------------------------------------- + * This follows the closing parenthesis of the function prototype arguments. + */ +#if defined (__ARMCC_2__) +#define KHRONOS_APIATTRIBUTES __softfp +#else +#define KHRONOS_APIATTRIBUTES +#endif + +/*------------------------------------------------------------------------- + * basic type definitions + *-----------------------------------------------------------------------*/ +#if (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L) || defined(__GNUC__) || defined(__SCO__) || defined(__USLC__) + + /* -** This header is generated from the Khronos OpenGL / OpenGL ES XML -** API Registry. The current version of the Registry, generator scripts -** used to make the header, and the header can be found at -** http://www.opengl.org/registry/ -** -** Khronos $Revision: 26745 $ on $Date: 2014-05-21 03:12:26 -0700 (Wed, 21 May 2014) $ -*/ - -#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) -#ifndef WIN32_LEAN_AND_MEAN -#define WIN32_LEAN_AND_MEAN 1 + * Using + */ +#include +typedef int32_t khronos_int32_t; +typedef uint32_t khronos_uint32_t; +typedef int64_t khronos_int64_t; +typedef uint64_t khronos_uint64_t; +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 +/* + * To support platform where unsigned long cannot be used interchangeably with + * inptr_t (e.g. CHERI-extended ISAs), we can use the stdint.h intptr_t. + * Ideally, we could just use (u)intptr_t everywhere, but this could result in + * ABI breakage if khronos_uintptr_t is changed from unsigned long to + * unsigned long long or similar (this results in different C++ name mangling). + * To avoid changes for existing platforms, we restrict usage of intptr_t to + * platforms where the size of a pointer is larger than the size of long. + */ +#if defined(__SIZEOF_LONG__) && defined(__SIZEOF_POINTER__) +#if __SIZEOF_POINTER__ > __SIZEOF_LONG__ +#define KHRONOS_USE_INTPTR_T #endif -#ifndef NOMINMAX /* don't define min() and max(). */ -#define NOMINMAX -#endif -#include #endif -#ifndef APIENTRY -#define APIENTRY -#endif -#ifndef APIENTRYP -#define APIENTRYP APIENTRY * -#endif -#ifndef GLAPI -#define GLAPI extern +#elif defined(__VMS ) || defined(__sgi) + +/* + * Using + */ +#include +typedef int32_t khronos_int32_t; +typedef uint32_t khronos_uint32_t; +typedef int64_t khronos_int64_t; +typedef uint64_t khronos_uint64_t; +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 + +#elif defined(_WIN32) && !defined(__SCITECH_SNAP__) + +/* + * Win32 + */ +typedef __int32 khronos_int32_t; +typedef unsigned __int32 khronos_uint32_t; +typedef __int64 khronos_int64_t; +typedef unsigned __int64 khronos_uint64_t; +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 + +#elif defined(__sun__) || defined(__digital__) + +/* + * Sun or Digital + */ +typedef int khronos_int32_t; +typedef unsigned int khronos_uint32_t; +#if defined(__arch64__) || defined(_LP64) +typedef long int khronos_int64_t; +typedef unsigned long int khronos_uint64_t; +#else +typedef long long int khronos_int64_t; +typedef unsigned long long int khronos_uint64_t; +#endif /* __arch64__ */ +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 + +#elif 0 + +/* + * Hypothetical platform with no float or int64 support + */ +typedef int khronos_int32_t; +typedef unsigned int khronos_uint32_t; +#define KHRONOS_SUPPORT_INT64 0 +#define KHRONOS_SUPPORT_FLOAT 0 + +#else + +/* + * Generic fallback + */ +#include +typedef int32_t khronos_int32_t; +typedef uint32_t khronos_uint32_t; +typedef int64_t khronos_int64_t; +typedef uint64_t khronos_uint64_t; +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 + #endif -#define GL_GLEXT_VERSION 20140521 + +/* + * Types that are (so far) the same on all platforms + */ +typedef signed char khronos_int8_t; +typedef unsigned char khronos_uint8_t; +typedef signed short int khronos_int16_t; +typedef unsigned short int khronos_uint16_t; + +/* + * Types that differ between LLP64 and LP64 architectures - in LLP64, + * pointers are 64 bits, but 'long' is still 32 bits. Win64 appears + * to be the only LLP64 architecture in current use. + */ +#ifdef KHRONOS_USE_INTPTR_T +typedef intptr_t khronos_intptr_t; +typedef uintptr_t khronos_uintptr_t; +#elif defined(_WIN64) +typedef signed long long int khronos_intptr_t; +typedef unsigned long long int khronos_uintptr_t; +#else +typedef signed long int khronos_intptr_t; +typedef unsigned long int khronos_uintptr_t; +#endif + +#if defined(_WIN64) +typedef signed long long int khronos_ssize_t; +typedef unsigned long long int khronos_usize_t; +#else +typedef signed long int khronos_ssize_t; +typedef unsigned long int khronos_usize_t; +#endif + +#if KHRONOS_SUPPORT_FLOAT +/* + * Float type + */ +typedef float khronos_float_t; +#endif + +#if KHRONOS_SUPPORT_INT64 +/* Time types + * + * These types can be used to represent a time interval in nanoseconds or + * an absolute Unadjusted System Time. Unadjusted System Time is the number + * of nanoseconds since some arbitrary system event (e.g. since the last + * time the system booted). The Unadjusted System Time is an unsigned + * 64 bit value that wraps back to 0 every 584 years. Time intervals + * may be either signed or unsigned. + */ +typedef khronos_uint64_t khronos_utime_nanoseconds_t; +typedef khronos_int64_t khronos_stime_nanoseconds_t; +#endif + +/* + * Dummy value used to pad enum types to 32 bits. + */ +#ifndef KHRONOS_MAX_ENUM +#define KHRONOS_MAX_ENUM 0x7FFFFFFF +#endif + +/* + * Enumerated boolean type + * + * Values other than zero should be considered to be true. Therefore + * comparisons should not be made against KHRONOS_TRUE. + */ +typedef enum { + KHRONOS_FALSE = 0, + KHRONOS_TRUE = 1, + KHRONOS_BOOLEAN_ENUM_FORCE_SIZE = KHRONOS_MAX_ENUM +} khronos_boolean_enum_t; + +#endif /* __khrplatform_h_ */ /* Generated C header for: * API: gl @@ -358,15 +651,17 @@ GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *m); #define GL_TEXTURE_FILTER_CONTROL 0x8500 #define GL_DEPTH_TEXTURE_MODE 0x884B #define GL_COMPARE_R_TO_TEXTURE 0x884E -#define GL_FUNC_ADD 0x8006 -#define GL_FUNC_SUBTRACT 0x800A -#define GL_FUNC_REVERSE_SUBTRACT 0x800B -#define GL_MIN 0x8007 -#define GL_MAX 0x8008 +#define GL_BLEND_COLOR 0x8005 +#define GL_BLEND_EQUATION 0x8009 #define GL_CONSTANT_COLOR 0x8001 #define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 #define GL_CONSTANT_ALPHA 0x8003 #define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 +#define GL_FUNC_ADD 0x8006 +#define GL_FUNC_REVERSE_SUBTRACT 0x800B +#define GL_FUNC_SUBTRACT 0x800A +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); @@ -467,14 +762,8 @@ GLAPI void APIENTRY glBlendEquation (GLenum mode); #ifndef GL_VERSION_1_5 #define GL_VERSION_1_5 1 -#include -#ifdef __MACOSX__ -typedef long GLsizeiptr; -typedef long GLintptr; -#else -typedef ptrdiff_t GLsizeiptr; -typedef ptrdiff_t GLintptr; -#endif +typedef khronos_ssize_t GLsizeiptr; +typedef khronos_intptr_t GLintptr; #define GL_BUFFER_SIZE 0x8764 #define GL_BUFFER_USAGE 0x8765 #define GL_QUERY_COUNTER_BITS 0x8864 @@ -887,7 +1176,7 @@ GLAPI void APIENTRY glUniformMatrix4x3fv (GLint location, GLsizei count, GLboole #ifndef GL_VERSION_3_0 #define GL_VERSION_3_0 1 -typedef unsigned short GLhalf; +typedef khronos_uint16_t GLhalf; #define GL_COMPARE_REF_TO_TEXTURE 0x884E #define GL_CLIP_DISTANCE0 0x3000 #define GL_CLIP_DISTANCE1 0x3001 @@ -1049,6 +1338,22 @@ typedef unsigned short GLhalf; #define GL_COLOR_ATTACHMENT13 0x8CED #define GL_COLOR_ATTACHMENT14 0x8CEE #define GL_COLOR_ATTACHMENT15 0x8CEF +#define GL_COLOR_ATTACHMENT16 0x8CF0 +#define GL_COLOR_ATTACHMENT17 0x8CF1 +#define GL_COLOR_ATTACHMENT18 0x8CF2 +#define GL_COLOR_ATTACHMENT19 0x8CF3 +#define GL_COLOR_ATTACHMENT20 0x8CF4 +#define GL_COLOR_ATTACHMENT21 0x8CF5 +#define GL_COLOR_ATTACHMENT22 0x8CF6 +#define GL_COLOR_ATTACHMENT23 0x8CF7 +#define GL_COLOR_ATTACHMENT24 0x8CF8 +#define GL_COLOR_ATTACHMENT25 0x8CF9 +#define GL_COLOR_ATTACHMENT26 0x8CFA +#define GL_COLOR_ATTACHMENT27 0x8CFB +#define GL_COLOR_ATTACHMENT28 0x8CFC +#define GL_COLOR_ATTACHMENT29 0x8CFD +#define GL_COLOR_ATTACHMENT30 0x8CFE +#define GL_COLOR_ATTACHMENT31 0x8CFF #define GL_DEPTH_ATTACHMENT 0x8D00 #define GL_STENCIL_ATTACHMENT 0x8D20 #define GL_FRAMEBUFFER 0x8D40 @@ -1316,11 +1621,13 @@ GLAPI GLboolean APIENTRY glIsVertexArray (GLuint array); #define GL_UNIFORM_BUFFER_START 0x8A29 #define GL_UNIFORM_BUFFER_SIZE 0x8A2A #define GL_MAX_VERTEX_UNIFORM_BLOCKS 0x8A2B +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS 0x8A2C #define GL_MAX_FRAGMENT_UNIFORM_BLOCKS 0x8A2D #define GL_MAX_COMBINED_UNIFORM_BLOCKS 0x8A2E #define GL_MAX_UNIFORM_BUFFER_BINDINGS 0x8A2F #define GL_MAX_UNIFORM_BLOCK_SIZE 0x8A30 #define GL_MAX_COMBINED_VERTEX_UNIFORM_COMPONENTS 0x8A31 +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS 0x8A32 #define GL_MAX_COMBINED_FRAGMENT_UNIFORM_COMPONENTS 0x8A33 #define GL_UNIFORM_BUFFER_OFFSET_ALIGNMENT 0x8A34 #define GL_ACTIVE_UNIFORM_BLOCK_MAX_NAME_LENGTH 0x8A35 @@ -1339,6 +1646,7 @@ GLAPI GLboolean APIENTRY glIsVertexArray (GLuint array); #define GL_UNIFORM_BLOCK_ACTIVE_UNIFORMS 0x8A42 #define GL_UNIFORM_BLOCK_ACTIVE_UNIFORM_INDICES 0x8A43 #define GL_UNIFORM_BLOCK_REFERENCED_BY_VERTEX_SHADER 0x8A44 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 #define GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER 0x8A46 #define GL_INVALID_INDEX 0xFFFFFFFFu typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); @@ -1372,45 +1680,8 @@ GLAPI void APIENTRY glUniformBlockBinding (GLuint program, GLuint uniformBlockIn #ifndef GL_VERSION_3_2 #define GL_VERSION_3_2 1 typedef struct __GLsync *GLsync; -#ifndef GLEXT_64_TYPES_DEFINED -/* This code block is duplicated in glxext.h, so must be protected */ -#define GLEXT_64_TYPES_DEFINED -/* Define int32_t, int64_t, and uint64_t types for UST/MSC */ -/* (as used in the GL_EXT_timer_query extension). */ -#if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L -#include -#elif defined(__sun__) || defined(__digital__) -#include -#if defined(__STDC__) -#if defined(__arch64__) || defined(_LP64) -typedef long int int64_t; -typedef unsigned long int uint64_t; -#else -typedef long long int int64_t; -typedef unsigned long long int uint64_t; -#endif /* __arch64__ */ -#endif /* __STDC__ */ -#elif defined( __VMS ) || defined(__sgi) -#include -#elif defined(__SCO__) || defined(__USLC__) -#include -#elif defined(__UNIXOS2__) || defined(__SOL64__) -typedef long int int32_t; -typedef long long int int64_t; -typedef unsigned long long int uint64_t; -#elif defined(_WIN32) && defined(__GNUC__) -#include -#elif defined(_WIN32) -typedef __int32 int32_t; -typedef __int64 int64_t; -typedef unsigned __int64 uint64_t; -#else -/* Fallback if nothing above works */ -#include -#endif -#endif -typedef uint64_t GLuint64; -typedef int64_t GLint64; +typedef khronos_uint64_t GLuint64; +typedef khronos_int64_t GLint64; #define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001 #define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002 #define GL_LINES_ADJACENCY 0x000A @@ -1486,7 +1757,7 @@ typedef void (APIENTRYP PFNGLDELETESYNCPROC) (GLsync sync); typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *data); -typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values); typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); @@ -1506,7 +1777,7 @@ GLAPI void APIENTRY glDeleteSync (GLsync sync); GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *data); -GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values); GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data); GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params); GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level); @@ -1762,8 +2033,8 @@ typedef void (APIENTRYP PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location, typedef GLint (APIENTRYP PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar *name); typedef GLuint (APIENTRYP PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar *name); typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); -typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); -typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); typedef void (APIENTRYP PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint *indices); typedef void (APIENTRYP PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint *params); typedef void (APIENTRYP PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint *values); @@ -1809,8 +2080,8 @@ GLAPI void APIENTRY glGetUniformdv (GLuint program, GLint location, GLdouble *pa GLAPI GLint APIENTRY glGetSubroutineUniformLocation (GLuint program, GLenum shadertype, const GLchar *name); GLAPI GLuint APIENTRY glGetSubroutineIndex (GLuint program, GLenum shadertype, const GLchar *name); GLAPI void APIENTRY glGetActiveSubroutineUniformiv (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); -GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); -GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); GLAPI void APIENTRY glUniformSubroutinesuiv (GLenum shadertype, GLsizei count, const GLuint *indices); GLAPI void APIENTRY glGetUniformSubroutineuiv (GLenum shadertype, GLint location, GLuint *params); GLAPI void APIENTRY glGetProgramStageiv (GLuint program, GLenum shadertype, GLenum pname, GLint *values); @@ -1868,7 +2139,7 @@ GLAPI void APIENTRY glGetQueryIndexediv (GLenum target, GLuint index, GLenum pna #define GL_VIEWPORT_INDEX_PROVOKING_VERTEX 0x825F #define GL_UNDEFINED_VERTEX 0x8260 typedef void (APIENTRYP PFNGLRELEASESHADERCOMPILERPROC) (void); -typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryformat, const void *binary, GLsizei length); +typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryFormat, const void *binary, GLsizei length); typedef void (APIENTRYP PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); typedef void (APIENTRYP PFNGLDEPTHRANGEFPROC) (GLfloat n, GLfloat f); typedef void (APIENTRYP PFNGLCLEARDEPTHFPROC) (GLfloat d); @@ -1957,7 +2228,7 @@ typedef void (APIENTRYP PFNGLGETFLOATI_VPROC) (GLenum target, GLuint index, GLfl typedef void (APIENTRYP PFNGLGETDOUBLEI_VPROC) (GLenum target, GLuint index, GLdouble *data); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glReleaseShaderCompiler (void); -GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryformat, const void *binary, GLsizei length); +GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryFormat, const void *binary, GLsizei length); GLAPI void APIENTRY glGetShaderPrecisionFormat (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); GLAPI void APIENTRY glDepthRangef (GLfloat n, GLfloat f); GLAPI void APIENTRY glClearDepthf (GLfloat d); @@ -2049,6 +2320,10 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data) #ifndef GL_VERSION_4_2 #define GL_VERSION_4_2 1 +#define GL_COPY_READ_BUFFER_BINDING 0x8F36 +#define GL_COPY_WRITE_BUFFER_BINDING 0x8F37 +#define GL_TRANSFORM_FEEDBACK_ACTIVE 0x8E24 +#define GL_TRANSFORM_FEEDBACK_PAUSED 0x8E23 #define GL_UNPACK_COMPRESSED_BLOCK_WIDTH 0x9127 #define GL_UNPACK_COMPRESSED_BLOCK_HEIGHT 0x9128 #define GL_UNPACK_COMPRESSED_BLOCK_DEPTH 0x9129 @@ -2160,7 +2435,7 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data) typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); -typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params); typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers); @@ -2173,7 +2448,7 @@ typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum m GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); -GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params); GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers); @@ -2220,6 +2495,7 @@ typedef void (APIENTRY *GLDEBUGPROC)(GLenum source,GLenum type,GLuint id,GLenum #define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_COMPUTE_SHADER 0x90ED #define GL_DISPATCH_INDIRECT_BUFFER 0x90EE #define GL_DISPATCH_INDIRECT_BUFFER_BINDING 0x90EF +#define GL_COMPUTE_SHADER_BIT 0x00000020 #define GL_DEBUG_OUTPUT_SYNCHRONOUS 0x8242 #define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH 0x8243 #define GL_DEBUG_CALLBACK_FUNCTION 0x8244 @@ -2453,7 +2729,7 @@ typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEINDIRECTPROC) (GLintptr indirect); typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params); typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level); typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); @@ -2465,7 +2741,7 @@ typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum typedef void (APIENTRYP PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint *params); typedef GLuint (APIENTRYP PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name); typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); -typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params); typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar *name); typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name); typedef void (APIENTRYP PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding); @@ -2497,7 +2773,7 @@ GLAPI void APIENTRY glDispatchComputeIndirect (GLintptr indirect); GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param); GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); +GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params); GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level); GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length); @@ -2509,7 +2785,7 @@ GLAPI void APIENTRY glMultiDrawElementsIndirect (GLenum mode, GLenum type, const GLAPI void APIENTRY glGetProgramInterfaceiv (GLuint program, GLenum programInterface, GLenum pname, GLint *params); GLAPI GLuint APIENTRY glGetProgramResourceIndex (GLuint program, GLenum programInterface, const GLchar *name); GLAPI void APIENTRY glGetProgramResourceName (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); -GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params); +GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params); GLAPI GLint APIENTRY glGetProgramResourceLocation (GLuint program, GLenum programInterface, const GLchar *name); GLAPI GLint APIENTRY glGetProgramResourceLocationIndex (GLuint program, GLenum programInterface, const GLchar *name); GLAPI void APIENTRY glShaderStorageBlockBinding (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding); @@ -2579,10 +2855,345 @@ GLAPI void APIENTRY glBindVertexBuffers (GLuint first, GLsizei count, const GLui #endif #endif /* GL_VERSION_4_4 */ +#ifndef GL_VERSION_4_5 +#define GL_VERSION_4_5 1 +#define GL_CONTEXT_LOST 0x0507 +#define GL_NEGATIVE_ONE_TO_ONE 0x935E +#define GL_ZERO_TO_ONE 0x935F +#define GL_CLIP_ORIGIN 0x935C +#define GL_CLIP_DEPTH_MODE 0x935D +#define GL_QUERY_WAIT_INVERTED 0x8E17 +#define GL_QUERY_NO_WAIT_INVERTED 0x8E18 +#define GL_QUERY_BY_REGION_WAIT_INVERTED 0x8E19 +#define GL_QUERY_BY_REGION_NO_WAIT_INVERTED 0x8E1A +#define GL_MAX_CULL_DISTANCES 0x82F9 +#define GL_MAX_COMBINED_CLIP_AND_CULL_DISTANCES 0x82FA +#define GL_TEXTURE_TARGET 0x1006 +#define GL_QUERY_TARGET 0x82EA +#define GL_GUILTY_CONTEXT_RESET 0x8253 +#define GL_INNOCENT_CONTEXT_RESET 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET 0x8255 +#define GL_RESET_NOTIFICATION_STRATEGY 0x8256 +#define GL_LOSE_CONTEXT_ON_RESET 0x8252 +#define GL_NO_RESET_NOTIFICATION 0x8261 +#define GL_CONTEXT_FLAG_ROBUST_ACCESS_BIT 0x00000004 +#define GL_COLOR_TABLE 0x80D0 +#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1 +#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2 +#define GL_PROXY_COLOR_TABLE 0x80D3 +#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4 +#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5 +#define GL_CONVOLUTION_1D 0x8010 +#define GL_CONVOLUTION_2D 0x8011 +#define GL_SEPARABLE_2D 0x8012 +#define GL_HISTOGRAM 0x8024 +#define GL_PROXY_HISTOGRAM 0x8025 +#define GL_MINMAX 0x802E +#define GL_CONTEXT_RELEASE_BEHAVIOR 0x82FB +#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH 0x82FC +typedef void (APIENTRYP PFNGLCLIPCONTROLPROC) (GLenum origin, GLenum depth); +typedef void (APIENTRYP PFNGLCREATETRANSFORMFEEDBACKSPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERBASEPROC) (GLuint xfb, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC) (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKIVPROC) (GLuint xfb, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint *param); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI64_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint64 *param); +typedef void (APIENTRYP PFNGLCREATEBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLCOPYNAMEDBUFFERSUBDATAPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERPROC) (GLuint buffer, GLenum access); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFERPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERI64VPROC) (GLuint buffer, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVPROC) (GLuint buffer, GLenum pname, void **params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +typedef void (APIENTRYP PFNGLCREATEFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERRENDERBUFFERPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIPROC) (GLuint framebuffer, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURELAYERPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERDRAWBUFFERPROC) (GLuint framebuffer, GLenum buf); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERDRAWBUFFERSPROC) (GLuint framebuffer, GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERREADBUFFERPROC) (GLuint framebuffer, GLenum src); +typedef void (APIENTRYP PFNGLINVALIDATENAMEDFRAMEBUFFERDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments); +typedef void (APIENTRYP PFNGLINVALIDATENAMEDFRAMEBUFFERSUBDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERUIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERFVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERFIPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +typedef void (APIENTRYP PFNGLBLITNAMEDFRAMEBUFFERPROC) (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef GLenum (APIENTRYP PFNGLCHECKNAMEDFRAMEBUFFERSTATUSPROC) (GLuint framebuffer, GLenum target); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVPROC) (GLuint framebuffer, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATERENDERBUFFERSPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC) (GLuint renderbuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATETEXTURESPROC) (GLenum target, GLsizei n, GLuint *textures); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERPROC) (GLuint texture, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERRANGEPROC) (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE1DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFPROC) (GLuint texture, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIPROC) (GLuint texture, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLGENERATETEXTUREMIPMAPPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLBINDTEXTUREUNITPROC) (GLuint unit, GLuint texture); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVPROC) (GLuint texture, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVPROC) (GLuint texture, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATEVERTEXARRAYSPROC) (GLsizei n, GLuint *arrays); +typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYATTRIBPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYATTRIBPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLVERTEXARRAYELEMENTBUFFERPROC) (GLuint vaobj, GLuint buffer); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBUFFERPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBUFFERSPROC) (GLuint vaobj, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBBINDINGPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBIFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBLFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYBINDINGDIVISORPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYIVPROC) (GLuint vaobj, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXEDIVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXED64IVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint64 *param); +typedef void (APIENTRYP PFNGLCREATESAMPLERSPROC) (GLsizei n, GLuint *samplers); +typedef void (APIENTRYP PFNGLCREATEPROGRAMPIPELINESPROC) (GLsizei n, GLuint *pipelines); +typedef void (APIENTRYP PFNGLCREATEQUERIESPROC) (GLenum target, GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLMEMORYBARRIERBYREGIONPROC) (GLbitfield barriers); +typedef void (APIENTRYP PFNGLGETTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels); +typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSPROC) (void); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETNUNIFORMDVPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMFVPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMIVPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUIVPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +typedef void (APIENTRYP PFNGLREADNPIXELSPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (APIENTRYP PFNGLGETNMAPDVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +typedef void (APIENTRYP PFNGLGETNMAPFVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +typedef void (APIENTRYP PFNGLGETNMAPIVPROC) (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +typedef void (APIENTRYP PFNGLGETNPIXELMAPFVPROC) (GLenum map, GLsizei bufSize, GLfloat *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUIVPROC) (GLenum map, GLsizei bufSize, GLuint *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUSVPROC) (GLenum map, GLsizei bufSize, GLushort *values); +typedef void (APIENTRYP PFNGLGETNPOLYGONSTIPPLEPROC) (GLsizei bufSize, GLubyte *pattern); +typedef void (APIENTRYP PFNGLGETNCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +typedef void (APIENTRYP PFNGLGETNHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLGETNMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLTEXTUREBARRIERPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClipControl (GLenum origin, GLenum depth); +GLAPI void APIENTRY glCreateTransformFeedbacks (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glTransformFeedbackBufferBase (GLuint xfb, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackBufferRange (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glGetTransformFeedbackiv (GLuint xfb, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetTransformFeedbacki_v (GLuint xfb, GLenum pname, GLuint index, GLint *param); +GLAPI void APIENTRY glGetTransformFeedbacki64_v (GLuint xfb, GLenum pname, GLuint index, GLint64 *param); +GLAPI void APIENTRY glCreateBuffers (GLsizei n, GLuint *buffers); +GLAPI void APIENTRY glNamedBufferStorage (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +GLAPI void APIENTRY glNamedBufferData (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glCopyNamedBufferSubData (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glClearNamedBufferData (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearNamedBufferSubData (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +GLAPI void *APIENTRY glMapNamedBuffer (GLuint buffer, GLenum access); +GLAPI void *APIENTRY glMapNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI GLboolean APIENTRY glUnmapNamedBuffer (GLuint buffer); +GLAPI void APIENTRY glFlushMappedNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glGetNamedBufferParameteriv (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedBufferParameteri64v (GLuint buffer, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetNamedBufferPointerv (GLuint buffer, GLenum pname, void **params); +GLAPI void APIENTRY glGetNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +GLAPI void APIENTRY glCreateFramebuffers (GLsizei n, GLuint *framebuffers); +GLAPI void APIENTRY glNamedFramebufferRenderbuffer (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glNamedFramebufferParameteri (GLuint framebuffer, GLenum pname, GLint param); +GLAPI void APIENTRY glNamedFramebufferTexture (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTextureLayer (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glNamedFramebufferDrawBuffer (GLuint framebuffer, GLenum buf); +GLAPI void APIENTRY glNamedFramebufferDrawBuffers (GLuint framebuffer, GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glNamedFramebufferReadBuffer (GLuint framebuffer, GLenum src); +GLAPI void APIENTRY glInvalidateNamedFramebufferData (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments); +GLAPI void APIENTRY glInvalidateNamedFramebufferSubData (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glClearNamedFramebufferiv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint *value); +GLAPI void APIENTRY glClearNamedFramebufferuiv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint *value); +GLAPI void APIENTRY glClearNamedFramebufferfv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat *value); +GLAPI void APIENTRY glClearNamedFramebufferfi (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +GLAPI void APIENTRY glBlitNamedFramebuffer (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI GLenum APIENTRY glCheckNamedFramebufferStatus (GLuint framebuffer, GLenum target); +GLAPI void APIENTRY glGetNamedFramebufferParameteriv (GLuint framebuffer, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetNamedFramebufferAttachmentParameteriv (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateRenderbuffers (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glNamedRenderbufferStorage (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisample (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetNamedRenderbufferParameteriv (GLuint renderbuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateTextures (GLenum target, GLsizei n, GLuint *textures); +GLAPI void APIENTRY glTextureBuffer (GLuint texture, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glTextureBufferRange (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glTextureStorage1D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTextureStorage2D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureStorage3D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glTextureStorage2DMultisample (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureStorage3DMultisample (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCompressedTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCopyTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glCopyTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureParameterf (GLuint texture, GLenum pname, GLfloat param); +GLAPI void APIENTRY glTextureParameterfv (GLuint texture, GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glTextureParameteri (GLuint texture, GLenum pname, GLint param); +GLAPI void APIENTRY glTextureParameterIiv (GLuint texture, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureParameterIuiv (GLuint texture, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glTextureParameteriv (GLuint texture, GLenum pname, const GLint *param); +GLAPI void APIENTRY glGenerateTextureMipmap (GLuint texture); +GLAPI void APIENTRY glBindTextureUnit (GLuint unit, GLuint texture); +GLAPI void APIENTRY glGetTextureImage (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetCompressedTextureImage (GLuint texture, GLint level, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetTextureLevelParameterfv (GLuint texture, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureLevelParameteriv (GLuint texture, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterfv (GLuint texture, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureParameterIiv (GLuint texture, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterIuiv (GLuint texture, GLenum pname, GLuint *params); +GLAPI void APIENTRY glGetTextureParameteriv (GLuint texture, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateVertexArrays (GLsizei n, GLuint *arrays); +GLAPI void APIENTRY glDisableVertexArrayAttrib (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glEnableVertexArrayAttrib (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glVertexArrayElementBuffer (GLuint vaobj, GLuint buffer); +GLAPI void APIENTRY glVertexArrayVertexBuffer (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +GLAPI void APIENTRY glVertexArrayVertexBuffers (GLuint vaobj, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +GLAPI void APIENTRY glVertexArrayAttribBinding (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +GLAPI void APIENTRY glVertexArrayAttribFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayAttribIFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayAttribLFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayBindingDivisor (GLuint vaobj, GLuint bindingindex, GLuint divisor); +GLAPI void APIENTRY glGetVertexArrayiv (GLuint vaobj, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayIndexediv (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayIndexed64iv (GLuint vaobj, GLuint index, GLenum pname, GLint64 *param); +GLAPI void APIENTRY glCreateSamplers (GLsizei n, GLuint *samplers); +GLAPI void APIENTRY glCreateProgramPipelines (GLsizei n, GLuint *pipelines); +GLAPI void APIENTRY glCreateQueries (GLenum target, GLsizei n, GLuint *ids); +GLAPI void APIENTRY glGetQueryBufferObjecti64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectui64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectuiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glMemoryBarrierByRegion (GLbitfield barriers); +GLAPI void APIENTRY glGetTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetCompressedTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels); +GLAPI GLenum APIENTRY glGetGraphicsResetStatus (void); +GLAPI void APIENTRY glGetnCompressedTexImage (GLenum target, GLint lod, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetnTexImage (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetnUniformdv (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +GLAPI void APIENTRY glGetnUniformfv (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +GLAPI void APIENTRY glGetnUniformiv (GLuint program, GLint location, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetnUniformuiv (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +GLAPI void APIENTRY glReadnPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GLAPI void APIENTRY glGetnMapdv (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +GLAPI void APIENTRY glGetnMapfv (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +GLAPI void APIENTRY glGetnMapiv (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +GLAPI void APIENTRY glGetnPixelMapfv (GLenum map, GLsizei bufSize, GLfloat *values); +GLAPI void APIENTRY glGetnPixelMapuiv (GLenum map, GLsizei bufSize, GLuint *values); +GLAPI void APIENTRY glGetnPixelMapusv (GLenum map, GLsizei bufSize, GLushort *values); +GLAPI void APIENTRY glGetnPolygonStipple (GLsizei bufSize, GLubyte *pattern); +GLAPI void APIENTRY glGetnColorTable (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +GLAPI void APIENTRY glGetnConvolutionFilter (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +GLAPI void APIENTRY glGetnSeparableFilter (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +GLAPI void APIENTRY glGetnHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glGetnMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glTextureBarrier (void); +#endif +#endif /* GL_VERSION_4_5 */ + +#ifndef GL_VERSION_4_6 +#define GL_VERSION_4_6 1 +#define GL_SHADER_BINARY_FORMAT_SPIR_V 0x9551 +#define GL_SPIR_V_BINARY 0x9552 +#define GL_PARAMETER_BUFFER 0x80EE +#define GL_PARAMETER_BUFFER_BINDING 0x80EF +#define GL_CONTEXT_FLAG_NO_ERROR_BIT 0x00000008 +#define GL_VERTICES_SUBMITTED 0x82EE +#define GL_PRIMITIVES_SUBMITTED 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES 0x82F7 +#define GL_POLYGON_OFFSET_CLAMP 0x8E1B +#define GL_SPIR_V_EXTENSIONS 0x9553 +#define GL_NUM_SPIR_V_EXTENSIONS 0x9554 +#define GL_TEXTURE_MAX_ANISOTROPY 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY 0x84FF +#define GL_TRANSFORM_FEEDBACK_OVERFLOW 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW 0x82ED +typedef void (APIENTRYP PFNGLSPECIALIZESHADERPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpecializeShader (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +GLAPI void APIENTRY glMultiDrawArraysIndirectCount (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCount (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glPolygonOffsetClamp (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_VERSION_4_6 */ + #ifndef GL_ARB_ES2_compatibility #define GL_ARB_ES2_compatibility 1 #endif /* GL_ARB_ES2_compatibility */ +#ifndef GL_ARB_ES3_1_compatibility +#define GL_ARB_ES3_1_compatibility 1 +#endif /* GL_ARB_ES3_1_compatibility */ + +#ifndef GL_ARB_ES3_2_compatibility +#define GL_ARB_ES3_2_compatibility 1 +#define GL_PRIMITIVE_BOUNDING_BOX_ARB 0x92BE +#define GL_MULTISAMPLE_LINE_WIDTH_RANGE_ARB 0x9381 +#define GL_MULTISAMPLE_LINE_WIDTH_GRANULARITY_ARB 0x9382 +typedef void (APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXARBPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#endif +#endif /* GL_ARB_ES3_2_compatibility */ + #ifndef GL_ARB_ES3_compatibility #define GL_ARB_ES3_compatibility 1 #endif /* GL_ARB_ES3_compatibility */ @@ -2597,7 +3208,7 @@ GLAPI void APIENTRY glBindVertexBuffers (GLuint first, GLsizei count, const GLui #ifndef GL_ARB_bindless_texture #define GL_ARB_bindless_texture 1 -typedef uint64_t GLuint64EXT; +typedef khronos_uint64_t GLuint64EXT; #define GL_UNSIGNED_INT64_ARB 0x140F typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLEARBPROC) (GLuint texture); typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler); @@ -2663,6 +3274,10 @@ GLAPI GLsync APIENTRY glCreateSyncFromCLeventARB (struct _cl_context *context, s #define GL_ARB_clear_texture 1 #endif /* GL_ARB_clear_texture */ +#ifndef GL_ARB_clip_control +#define GL_ARB_clip_control 1 +#endif /* GL_ARB_clip_control */ + #ifndef GL_ARB_color_buffer_float #define GL_ARB_color_buffer_float 1 #define GL_RGBA_FLOAT_MODE_ARB 0x8820 @@ -2686,7 +3301,6 @@ GLAPI void APIENTRY glClampColorARB (GLenum target, GLenum clamp); #ifndef GL_ARB_compute_shader #define GL_ARB_compute_shader 1 -#define GL_COMPUTE_SHADER_BIT 0x00000020 #endif /* GL_ARB_compute_shader */ #ifndef GL_ARB_compute_variable_group_size @@ -2701,20 +3315,26 @@ GLAPI void APIENTRY glDispatchComputeGroupSizeARB (GLuint num_groups_x, GLuint n #endif #endif /* GL_ARB_compute_variable_group_size */ +#ifndef GL_ARB_conditional_render_inverted +#define GL_ARB_conditional_render_inverted 1 +#endif /* GL_ARB_conditional_render_inverted */ + #ifndef GL_ARB_conservative_depth #define GL_ARB_conservative_depth 1 #endif /* GL_ARB_conservative_depth */ #ifndef GL_ARB_copy_buffer #define GL_ARB_copy_buffer 1 -#define GL_COPY_READ_BUFFER_BINDING 0x8F36 -#define GL_COPY_WRITE_BUFFER_BINDING 0x8F37 #endif /* GL_ARB_copy_buffer */ #ifndef GL_ARB_copy_image #define GL_ARB_copy_image 1 #endif /* GL_ARB_copy_image */ +#ifndef GL_ARB_cull_distance +#define GL_ARB_cull_distance 1 +#endif /* GL_ARB_cull_distance */ + #ifndef GL_ARB_debug_output #define GL_ARB_debug_output 1 typedef void (APIENTRY *GLDEBUGPROCARB)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam); @@ -2769,6 +3389,14 @@ GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufSize, GL #define GL_DEPTH_TEXTURE_MODE_ARB 0x884B #endif /* GL_ARB_depth_texture */ +#ifndef GL_ARB_derivative_control +#define GL_ARB_derivative_control 1 +#endif /* GL_ARB_derivative_control */ + +#ifndef GL_ARB_direct_state_access +#define GL_ARB_direct_state_access 1 +#endif /* GL_ARB_direct_state_access */ + #ifndef GL_ARB_draw_buffers #define GL_ARB_draw_buffers 1 #define GL_MAX_DRAW_BUFFERS_ARB 0x8824 @@ -2979,6 +3607,10 @@ GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program); #define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B #endif /* GL_ARB_fragment_shader */ +#ifndef GL_ARB_fragment_shader_interlock +#define GL_ARB_fragment_shader_interlock 1 +#endif /* GL_ARB_fragment_shader_interlock */ + #ifndef GL_ARB_framebuffer_no_attachments #define GL_ARB_framebuffer_no_attachments 1 #endif /* GL_ARB_framebuffer_no_attachments */ @@ -2991,11 +3623,6 @@ GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program); #define GL_ARB_framebuffer_sRGB 1 #endif /* GL_ARB_framebuffer_sRGB */ -#ifndef GL_KHR_context_flush_control -#define GL_CONTEXT_RELEASE_BEHAVIOR 0x82FB -#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH 0x82FC -#endif /* GL_KHR_context_flush_control */ - #ifndef GL_ARB_geometry_shader4 #define GL_ARB_geometry_shader4 1 #define GL_LINES_ADJACENCY_ARB 0x000A @@ -3032,6 +3659,20 @@ GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachmen #define GL_ARB_get_program_binary 1 #endif /* GL_ARB_get_program_binary */ +#ifndef GL_ARB_get_texture_sub_image +#define GL_ARB_get_texture_sub_image 1 +#endif /* GL_ARB_get_texture_sub_image */ + +#ifndef GL_ARB_gl_spirv +#define GL_ARB_gl_spirv 1 +#define GL_SHADER_BINARY_FORMAT_SPIR_V_ARB 0x9551 +#define GL_SPIR_V_BINARY_ARB 0x9552 +typedef void (APIENTRYP PFNGLSPECIALIZESHADERARBPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpecializeShaderARB (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +#endif +#endif /* GL_ARB_gl_spirv */ + #ifndef GL_ARB_gpu_shader5 #define GL_ARB_gpu_shader5 1 #endif /* GL_ARB_gpu_shader5 */ @@ -3040,9 +3681,94 @@ GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachmen #define GL_ARB_gpu_shader_fp64 1 #endif /* GL_ARB_gpu_shader_fp64 */ +#ifndef GL_ARB_gpu_shader_int64 +#define GL_ARB_gpu_shader_int64 1 +#define GL_INT64_ARB 0x140E +#define GL_INT64_VEC2_ARB 0x8FE9 +#define GL_INT64_VEC3_ARB 0x8FEA +#define GL_INT64_VEC4_ARB 0x8FEB +#define GL_UNSIGNED_INT64_VEC2_ARB 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_ARB 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_ARB 0x8FF7 +typedef void (APIENTRYP PFNGLUNIFORM1I64ARBPROC) (GLint location, GLint64 x); +typedef void (APIENTRYP PFNGLUNIFORM2I64ARBPROC) (GLint location, GLint64 x, GLint64 y); +typedef void (APIENTRYP PFNGLUNIFORM3I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z); +typedef void (APIENTRYP PFNGLUNIFORM4I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +typedef void (APIENTRYP PFNGLUNIFORM1I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM2I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM3I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM4I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM1UI64ARBPROC) (GLint location, GLuint64 x); +typedef void (APIENTRYP PFNGLUNIFORM2UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y); +typedef void (APIENTRYP PFNGLUNIFORM3UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +typedef void (APIENTRYP PFNGLUNIFORM4UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +typedef void (APIENTRYP PFNGLUNIFORM1UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM2UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM3UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM4UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLGETUNIFORMI64VARBPROC) (GLuint program, GLint location, GLint64 *params); +typedef void (APIENTRYP PFNGLGETUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLuint64 *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint64 *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64ARBPROC) (GLuint program, GLint location, GLint64 x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64ARBPROC) (GLuint program, GLint location, GLuint64 x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1i64ARB (GLint location, GLint64 x); +GLAPI void APIENTRY glUniform2i64ARB (GLint location, GLint64 x, GLint64 y); +GLAPI void APIENTRY glUniform3i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z); +GLAPI void APIENTRY glUniform4i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +GLAPI void APIENTRY glUniform1i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform2i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform3i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform4i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform1ui64ARB (GLint location, GLuint64 x); +GLAPI void APIENTRY glUniform2ui64ARB (GLint location, GLuint64 x, GLuint64 y); +GLAPI void APIENTRY glUniform3ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +GLAPI void APIENTRY glUniform4ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +GLAPI void APIENTRY glUniform1ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform2ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform3ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform4ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glGetUniformi64vARB (GLuint program, GLint location, GLint64 *params); +GLAPI void APIENTRY glGetUniformui64vARB (GLuint program, GLint location, GLuint64 *params); +GLAPI void APIENTRY glGetnUniformi64vARB (GLuint program, GLint location, GLsizei bufSize, GLint64 *params); +GLAPI void APIENTRY glGetnUniformui64vARB (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params); +GLAPI void APIENTRY glProgramUniform1i64ARB (GLuint program, GLint location, GLint64 x); +GLAPI void APIENTRY glProgramUniform2i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y); +GLAPI void APIENTRY glProgramUniform3i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z); +GLAPI void APIENTRY glProgramUniform4i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +GLAPI void APIENTRY glProgramUniform1i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform2i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform3i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform4i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform1ui64ARB (GLuint program, GLint location, GLuint64 x); +GLAPI void APIENTRY glProgramUniform2ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y); +GLAPI void APIENTRY glProgramUniform3ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +GLAPI void APIENTRY glProgramUniform4ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +GLAPI void APIENTRY glProgramUniform1ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform2ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform3ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +#endif +#endif /* GL_ARB_gpu_shader_int64 */ + #ifndef GL_ARB_half_float_pixel #define GL_ARB_half_float_pixel 1 -typedef unsigned short GLhalfARB; +typedef khronos_uint16_t GLhalfARB; #define GL_HALF_FLOAT_ARB 0x140B #endif /* GL_ARB_half_float_pixel */ @@ -3052,11 +3778,6 @@ typedef unsigned short GLhalfARB; #ifndef GL_ARB_imaging #define GL_ARB_imaging 1 -#define GL_BLEND_COLOR 0x8005 -#define GL_BLEND_EQUATION 0x8009 -#define GL_CONVOLUTION_1D 0x8010 -#define GL_CONVOLUTION_2D 0x8011 -#define GL_SEPARABLE_2D 0x8012 #define GL_CONVOLUTION_BORDER_MODE 0x8013 #define GL_CONVOLUTION_FILTER_SCALE 0x8014 #define GL_CONVOLUTION_FILTER_BIAS 0x8015 @@ -3074,8 +3795,6 @@ typedef unsigned short GLhalfARB; #define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021 #define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022 #define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023 -#define GL_HISTOGRAM 0x8024 -#define GL_PROXY_HISTOGRAM 0x8025 #define GL_HISTOGRAM_WIDTH 0x8026 #define GL_HISTOGRAM_FORMAT 0x8027 #define GL_HISTOGRAM_RED_SIZE 0x8028 @@ -3084,7 +3803,6 @@ typedef unsigned short GLhalfARB; #define GL_HISTOGRAM_ALPHA_SIZE 0x802B #define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C #define GL_HISTOGRAM_SINK 0x802D -#define GL_MINMAX 0x802E #define GL_MINMAX_FORMAT 0x802F #define GL_MINMAX_SINK 0x8030 #define GL_TABLE_TOO_LARGE 0x8031 @@ -3099,12 +3817,6 @@ typedef unsigned short GLhalfARB; #define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9 #define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA #define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB -#define GL_COLOR_TABLE 0x80D0 -#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1 -#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2 -#define GL_PROXY_COLOR_TABLE 0x80D3 -#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4 -#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5 #define GL_COLOR_TABLE_SCALE 0x80D6 #define GL_COLOR_TABLE_BIAS 0x80D7 #define GL_COLOR_TABLE_FORMAT 0x80D8 @@ -3190,11 +3902,11 @@ GLAPI void APIENTRY glResetMinmax (GLenum target); #define GL_ARB_indirect_parameters 1 #define GL_PARAMETER_BUFFER_ARB 0x80EE #define GL_PARAMETER_BUFFER_BINDING_ARB 0x80EF -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysIndirectCountARB (GLenum mode, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); -GLAPI void APIENTRY glMultiDrawElementsIndirectCountARB (GLenum mode, GLenum type, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawArraysIndirectCountARB (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCountARB (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); #endif #endif /* GL_ARB_indirect_parameters */ @@ -3214,6 +3926,25 @@ GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor); #ifndef GL_ARB_internalformat_query2 #define GL_ARB_internalformat_query2 1 #define GL_SRGB_DECODE_ARB 0x8299 +#define GL_VIEW_CLASS_EAC_R11 0x9383 +#define GL_VIEW_CLASS_EAC_RG11 0x9384 +#define GL_VIEW_CLASS_ETC2_RGB 0x9385 +#define GL_VIEW_CLASS_ETC2_RGBA 0x9386 +#define GL_VIEW_CLASS_ETC2_EAC_RGBA 0x9387 +#define GL_VIEW_CLASS_ASTC_4x4_RGBA 0x9388 +#define GL_VIEW_CLASS_ASTC_5x4_RGBA 0x9389 +#define GL_VIEW_CLASS_ASTC_5x5_RGBA 0x938A +#define GL_VIEW_CLASS_ASTC_6x5_RGBA 0x938B +#define GL_VIEW_CLASS_ASTC_6x6_RGBA 0x938C +#define GL_VIEW_CLASS_ASTC_8x5_RGBA 0x938D +#define GL_VIEW_CLASS_ASTC_8x6_RGBA 0x938E +#define GL_VIEW_CLASS_ASTC_8x8_RGBA 0x938F +#define GL_VIEW_CLASS_ASTC_10x5_RGBA 0x9390 +#define GL_VIEW_CLASS_ASTC_10x6_RGBA 0x9391 +#define GL_VIEW_CLASS_ASTC_10x8_RGBA 0x9392 +#define GL_VIEW_CLASS_ASTC_10x10_RGBA 0x9393 +#define GL_VIEW_CLASS_ASTC_12x10_RGBA 0x9394 +#define GL_VIEW_CLASS_ASTC_12x12_RGBA 0x9395 #endif /* GL_ARB_internalformat_query2 */ #ifndef GL_ARB_invalidate_subdata @@ -3419,6 +4150,30 @@ GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint id, GLenum pname, GLuint *par #define GL_ARB_occlusion_query2 1 #endif /* GL_ARB_occlusion_query2 */ +#ifndef GL_ARB_parallel_shader_compile +#define GL_ARB_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_ARB 0x91B0 +#define GL_COMPLETION_STATUS_ARB 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSARBPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsARB (GLuint count); +#endif +#endif /* GL_ARB_parallel_shader_compile */ + +#ifndef GL_ARB_pipeline_statistics_query +#define GL_ARB_pipeline_statistics_query 1 +#define GL_VERTICES_SUBMITTED_ARB 0x82EE +#define GL_PRIMITIVES_SUBMITTED_ARB 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS_ARB 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES_ARB 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS_ARB 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED_ARB 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS_ARB 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS_ARB 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES_ARB 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES_ARB 0x82F7 +#endif /* GL_ARB_pipeline_statistics_query */ + #ifndef GL_ARB_pixel_buffer_object #define GL_ARB_pixel_buffer_object 1 #define GL_PIXEL_PACK_BUFFER_ARB 0x88EB @@ -3447,6 +4202,14 @@ GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params); #define GL_COORD_REPLACE_ARB 0x8862 #endif /* GL_ARB_point_sprite */ +#ifndef GL_ARB_polygon_offset_clamp +#define GL_ARB_polygon_offset_clamp 1 +#endif /* GL_ARB_polygon_offset_clamp */ + +#ifndef GL_ARB_post_depth_coverage +#define GL_ARB_post_depth_coverage 1 +#endif /* GL_ARB_post_depth_coverage */ + #ifndef GL_ARB_program_interface_query #define GL_ARB_program_interface_query 1 #endif /* GL_ARB_program_interface_query */ @@ -3520,6 +4283,26 @@ GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum form #define GL_ARB_robustness_isolation 1 #endif /* GL_ARB_robustness_isolation */ +#ifndef GL_ARB_sample_locations +#define GL_ARB_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_ARB 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_ARB 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_ARB 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_ARB 0x9340 +#define GL_SAMPLE_LOCATION_ARB 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_ARB 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_ARB 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_ARB 0x9343 +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLEVALUATEDEPTHVALUESARBPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSampleLocationsfvARB (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvARB (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glEvaluateDepthValuesARB (void); +#endif +#endif /* GL_ARB_sample_locations */ + #ifndef GL_ARB_sample_shading #define GL_ARB_sample_shading 1 #define GL_SAMPLE_SHADING_ARB 0x8C36 @@ -3546,14 +4329,26 @@ GLAPI void APIENTRY glMinSampleShadingARB (GLfloat value); #define GL_ARB_separate_shader_objects 1 #endif /* GL_ARB_separate_shader_objects */ +#ifndef GL_ARB_shader_atomic_counter_ops +#define GL_ARB_shader_atomic_counter_ops 1 +#endif /* GL_ARB_shader_atomic_counter_ops */ + #ifndef GL_ARB_shader_atomic_counters #define GL_ARB_shader_atomic_counters 1 #endif /* GL_ARB_shader_atomic_counters */ +#ifndef GL_ARB_shader_ballot +#define GL_ARB_shader_ballot 1 +#endif /* GL_ARB_shader_ballot */ + #ifndef GL_ARB_shader_bit_encoding #define GL_ARB_shader_bit_encoding 1 #endif /* GL_ARB_shader_bit_encoding */ +#ifndef GL_ARB_shader_clock +#define GL_ARB_shader_clock 1 +#endif /* GL_ARB_shader_clock */ + #ifndef GL_ARB_shader_draw_parameters #define GL_ARB_shader_draw_parameters 1 #endif /* GL_ARB_shader_draw_parameters */ @@ -3710,10 +4505,18 @@ GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB obj, GLsizei maxLength, GL #define GL_ARB_shader_subroutine 1 #endif /* GL_ARB_shader_subroutine */ +#ifndef GL_ARB_shader_texture_image_samples +#define GL_ARB_shader_texture_image_samples 1 +#endif /* GL_ARB_shader_texture_image_samples */ + #ifndef GL_ARB_shader_texture_lod #define GL_ARB_shader_texture_lod 1 #endif /* GL_ARB_shader_texture_lod */ +#ifndef GL_ARB_shader_viewport_layer_array +#define GL_ARB_shader_viewport_layer_array 1 +#endif /* GL_ARB_shader_viewport_layer_array */ + #ifndef GL_ARB_shading_language_100 #define GL_ARB_shading_language_100 1 #define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C @@ -3760,11 +4563,25 @@ GLAPI void APIENTRY glGetNamedStringivARB (GLint namelen, const GLchar *name, GL #define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF #endif /* GL_ARB_shadow_ambient */ +#ifndef GL_ARB_sparse_buffer +#define GL_ARB_sparse_buffer 1 +#define GL_SPARSE_STORAGE_BIT_ARB 0x0400 +#define GL_SPARSE_BUFFER_PAGE_SIZE_ARB 0x82F8 +typedef void (APIENTRYP PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTARBPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferPageCommitmentARB (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +#endif +#endif /* GL_ARB_sparse_buffer */ + #ifndef GL_ARB_sparse_texture #define GL_ARB_sparse_texture 1 #define GL_TEXTURE_SPARSE_ARB 0x91A6 #define GL_VIRTUAL_PAGE_SIZE_INDEX_ARB 0x91A7 -#define GL_MIN_SPARSE_LEVEL_ARB 0x919B +#define GL_NUM_SPARSE_LEVELS_ARB 0x91AA #define GL_NUM_VIRTUAL_PAGE_SIZES_ARB 0x91A8 #define GL_VIRTUAL_PAGE_SIZE_X_ARB 0x9195 #define GL_VIRTUAL_PAGE_SIZE_Y_ARB 0x9196 @@ -3773,12 +4590,24 @@ GLAPI void APIENTRY glGetNamedStringivARB (GLint namelen, const GLchar *name, GL #define GL_MAX_SPARSE_3D_TEXTURE_SIZE_ARB 0x9199 #define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS_ARB 0x919A #define GL_SPARSE_TEXTURE_FULL_ARRAY_CUBE_MIPMAPS_ARB 0x91A9 -typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); #endif #endif /* GL_ARB_sparse_texture */ +#ifndef GL_ARB_sparse_texture2 +#define GL_ARB_sparse_texture2 1 +#endif /* GL_ARB_sparse_texture2 */ + +#ifndef GL_ARB_sparse_texture_clamp +#define GL_ARB_sparse_texture_clamp 1 +#endif /* GL_ARB_sparse_texture_clamp */ + +#ifndef GL_ARB_spirv_extensions +#define GL_ARB_spirv_extensions 1 +#endif /* GL_ARB_spirv_extensions */ + #ifndef GL_ARB_stencil_texturing #define GL_ARB_stencil_texturing 1 #endif /* GL_ARB_stencil_texturing */ @@ -3791,6 +4620,10 @@ GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xo #define GL_ARB_tessellation_shader 1 #endif /* GL_ARB_tessellation_shader */ +#ifndef GL_ARB_texture_barrier +#define GL_ARB_texture_barrier 1 +#endif /* GL_ARB_texture_barrier */ + #ifndef GL_ARB_texture_border_clamp #define GL_ARB_texture_border_clamp 1 #define GL_CLAMP_TO_BORDER_ARB 0x812D @@ -3927,6 +4760,16 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void #define GL_DOT3_RGBA_ARB 0x86AF #endif /* GL_ARB_texture_env_dot3 */ +#ifndef GL_ARB_texture_filter_anisotropic +#define GL_ARB_texture_filter_anisotropic 1 +#endif /* GL_ARB_texture_filter_anisotropic */ + +#ifndef GL_ARB_texture_filter_minmax +#define GL_ARB_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_ARB 0x9366 +#define GL_WEIGHTED_AVERAGE_ARB 0x9367 +#endif /* GL_ARB_texture_filter_minmax */ + #ifndef GL_ARB_texture_float #define GL_ARB_texture_float 1 #define GL_TEXTURE_RED_TYPE_ARB 0x8C10 @@ -4025,8 +4868,6 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void #ifndef GL_ARB_transform_feedback2 #define GL_ARB_transform_feedback2 1 -#define GL_TRANSFORM_FEEDBACK_PAUSED 0x8E23 -#define GL_TRANSFORM_FEEDBACK_ACTIVE 0x8E24 #endif /* GL_ARB_transform_feedback2 */ #ifndef GL_ARB_transform_feedback3 @@ -4037,6 +4878,12 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void #define GL_ARB_transform_feedback_instanced 1 #endif /* GL_ARB_transform_feedback_instanced */ +#ifndef GL_ARB_transform_feedback_overflow_query +#define GL_ARB_transform_feedback_overflow_query 1 +#define GL_TRANSFORM_FEEDBACK_OVERFLOW_ARB 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW_ARB 0x82ED +#endif /* GL_ARB_transform_feedback_overflow_query */ + #ifndef GL_ARB_transpose_matrix #define GL_ARB_transpose_matrix 1 #define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3 @@ -4057,9 +4904,6 @@ GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *m); #ifndef GL_ARB_uniform_buffer_object #define GL_ARB_uniform_buffer_object 1 -#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS 0x8A2C -#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS 0x8A32 -#define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 #endif /* GL_ARB_uniform_buffer_object */ #ifndef GL_ARB_vertex_array_bgra @@ -4148,13 +4992,8 @@ GLAPI void APIENTRY glVertexBlendARB (GLint count); #ifndef GL_ARB_vertex_buffer_object #define GL_ARB_vertex_buffer_object 1 -#ifdef __MACOSX__ /* The OS X headers haven't caught up with Khronos yet */ -typedef long GLsizeiptrARB; -typedef long GLintptrARB; -#else -typedef ptrdiff_t GLsizeiptrARB; -typedef ptrdiff_t GLintptrARB; -#endif +typedef khronos_ssize_t GLsizeiptrARB; +typedef khronos_intptr_t GLintptrARB; #define GL_BUFFER_SIZE_ARB 0x8764 #define GL_BUFFER_USAGE_ARB 0x8765 #define GL_ARRAY_BUFFER_ARB 0x8892 @@ -4349,6 +5188,12 @@ GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB programObj, const GLcha #ifndef GL_ARB_viewport_array #define GL_ARB_viewport_array 1 +typedef void (APIENTRYP PFNGLDEPTHRANGEARRAYDVNVPROC) (GLuint first, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLDEPTHRANGEINDEXEDDNVPROC) (GLuint index, GLdouble n, GLdouble f); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDepthRangeArraydvNV (GLuint first, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glDepthRangeIndexeddNV (GLuint index, GLdouble n, GLdouble f); +#endif #endif /* GL_ARB_viewport_array */ #ifndef GL_ARB_window_pos @@ -4389,10 +5234,82 @@ GLAPI void APIENTRY glWindowPos3svARB (const GLshort *v); #endif #endif /* GL_ARB_window_pos */ +#ifndef GL_KHR_blend_equation_advanced +#define GL_KHR_blend_equation_advanced 1 +#define GL_MULTIPLY_KHR 0x9294 +#define GL_SCREEN_KHR 0x9295 +#define GL_OVERLAY_KHR 0x9296 +#define GL_DARKEN_KHR 0x9297 +#define GL_LIGHTEN_KHR 0x9298 +#define GL_COLORDODGE_KHR 0x9299 +#define GL_COLORBURN_KHR 0x929A +#define GL_HARDLIGHT_KHR 0x929B +#define GL_SOFTLIGHT_KHR 0x929C +#define GL_DIFFERENCE_KHR 0x929E +#define GL_EXCLUSION_KHR 0x92A0 +#define GL_HSL_HUE_KHR 0x92AD +#define GL_HSL_SATURATION_KHR 0x92AE +#define GL_HSL_COLOR_KHR 0x92AF +#define GL_HSL_LUMINOSITY_KHR 0x92B0 +typedef void (APIENTRYP PFNGLBLENDBARRIERKHRPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendBarrierKHR (void); +#endif +#endif /* GL_KHR_blend_equation_advanced */ + +#ifndef GL_KHR_blend_equation_advanced_coherent +#define GL_KHR_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_KHR 0x9285 +#endif /* GL_KHR_blend_equation_advanced_coherent */ + +#ifndef GL_KHR_context_flush_control +#define GL_KHR_context_flush_control 1 +#endif /* GL_KHR_context_flush_control */ + #ifndef GL_KHR_debug #define GL_KHR_debug 1 #endif /* GL_KHR_debug */ +#ifndef GL_KHR_no_error +#define GL_KHR_no_error 1 +#define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 +#endif /* GL_KHR_no_error */ + +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count); +#endif +#endif /* GL_KHR_parallel_shader_compile */ + +#ifndef GL_KHR_robust_buffer_access_behavior +#define GL_KHR_robust_buffer_access_behavior 1 +#endif /* GL_KHR_robust_buffer_access_behavior */ + +#ifndef GL_KHR_robustness +#define GL_KHR_robustness 1 +#define GL_CONTEXT_ROBUST_ACCESS 0x90F3 +#endif /* GL_KHR_robustness */ + +#ifndef GL_KHR_shader_subgroup +#define GL_KHR_shader_subgroup 1 +#define GL_SUBGROUP_SIZE_KHR 0x9532 +#define GL_SUBGROUP_SUPPORTED_STAGES_KHR 0x9533 +#define GL_SUBGROUP_SUPPORTED_FEATURES_KHR 0x9534 +#define GL_SUBGROUP_QUAD_ALL_STAGES_KHR 0x9535 +#define GL_SUBGROUP_FEATURE_BASIC_BIT_KHR 0x00000001 +#define GL_SUBGROUP_FEATURE_VOTE_BIT_KHR 0x00000002 +#define GL_SUBGROUP_FEATURE_ARITHMETIC_BIT_KHR 0x00000004 +#define GL_SUBGROUP_FEATURE_BALLOT_BIT_KHR 0x00000008 +#define GL_SUBGROUP_FEATURE_SHUFFLE_BIT_KHR 0x00000010 +#define GL_SUBGROUP_FEATURE_SHUFFLE_RELATIVE_BIT_KHR 0x00000020 +#define GL_SUBGROUP_FEATURE_CLUSTERED_BIT_KHR 0x00000040 +#define GL_SUBGROUP_FEATURE_QUAD_BIT_KHR 0x00000080 +#endif /* GL_KHR_shader_subgroup */ + #ifndef GL_KHR_texture_compression_astc_hdr #define GL_KHR_texture_compression_astc_hdr 1 #define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0 @@ -4429,6 +5346,10 @@ GLAPI void APIENTRY glWindowPos3svARB (const GLshort *v); #define GL_KHR_texture_compression_astc_ldr 1 #endif /* GL_KHR_texture_compression_astc_ldr */ +#ifndef GL_KHR_texture_compression_astc_sliced_3d +#define GL_KHR_texture_compression_astc_sliced_3d 1 +#endif /* GL_KHR_texture_compression_astc_sliced_3d */ + #ifndef GL_OES_byte_coordinates #define GL_OES_byte_coordinates 1 typedef void (APIENTRYP PFNGLMULTITEXCOORD1BOESPROC) (GLenum texture, GLbyte s); @@ -4447,11 +5368,11 @@ typedef void (APIENTRYP PFNGLTEXCOORD3BOESPROC) (GLbyte s, GLbyte t, GLbyte r); typedef void (APIENTRYP PFNGLTEXCOORD3BVOESPROC) (const GLbyte *coords); typedef void (APIENTRYP PFNGLTEXCOORD4BOESPROC) (GLbyte s, GLbyte t, GLbyte r, GLbyte q); typedef void (APIENTRYP PFNGLTEXCOORD4BVOESPROC) (const GLbyte *coords); -typedef void (APIENTRYP PFNGLVERTEX2BOESPROC) (GLbyte x); +typedef void (APIENTRYP PFNGLVERTEX2BOESPROC) (GLbyte x, GLbyte y); typedef void (APIENTRYP PFNGLVERTEX2BVOESPROC) (const GLbyte *coords); -typedef void (APIENTRYP PFNGLVERTEX3BOESPROC) (GLbyte x, GLbyte y); +typedef void (APIENTRYP PFNGLVERTEX3BOESPROC) (GLbyte x, GLbyte y, GLbyte z); typedef void (APIENTRYP PFNGLVERTEX3BVOESPROC) (const GLbyte *coords); -typedef void (APIENTRYP PFNGLVERTEX4BOESPROC) (GLbyte x, GLbyte y, GLbyte z); +typedef void (APIENTRYP PFNGLVERTEX4BOESPROC) (GLbyte x, GLbyte y, GLbyte z, GLbyte w); typedef void (APIENTRYP PFNGLVERTEX4BVOESPROC) (const GLbyte *coords); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMultiTexCoord1bOES (GLenum texture, GLbyte s); @@ -4470,11 +5391,11 @@ GLAPI void APIENTRY glTexCoord3bOES (GLbyte s, GLbyte t, GLbyte r); GLAPI void APIENTRY glTexCoord3bvOES (const GLbyte *coords); GLAPI void APIENTRY glTexCoord4bOES (GLbyte s, GLbyte t, GLbyte r, GLbyte q); GLAPI void APIENTRY glTexCoord4bvOES (const GLbyte *coords); -GLAPI void APIENTRY glVertex2bOES (GLbyte x); +GLAPI void APIENTRY glVertex2bOES (GLbyte x, GLbyte y); GLAPI void APIENTRY glVertex2bvOES (const GLbyte *coords); -GLAPI void APIENTRY glVertex3bOES (GLbyte x, GLbyte y); +GLAPI void APIENTRY glVertex3bOES (GLbyte x, GLbyte y, GLbyte z); GLAPI void APIENTRY glVertex3bvOES (const GLbyte *coords); -GLAPI void APIENTRY glVertex4bOES (GLbyte x, GLbyte y, GLbyte z); +GLAPI void APIENTRY glVertex4bOES (GLbyte x, GLbyte y, GLbyte z, GLbyte w); GLAPI void APIENTRY glVertex4bvOES (const GLbyte *coords); #endif #endif /* GL_OES_byte_coordinates */ @@ -4495,7 +5416,7 @@ GLAPI void APIENTRY glVertex4bvOES (const GLbyte *coords); #ifndef GL_OES_fixed_point #define GL_OES_fixed_point 1 -typedef GLint GLfixed; +typedef khronos_int32_t GLfixed; #define GL_FIXED_OES 0x140C typedef void (APIENTRYP PFNGLALPHAFUNCXOESPROC) (GLenum func, GLfixed ref); typedef void (APIENTRYP PFNGLCLEARCOLORXOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); @@ -4526,7 +5447,6 @@ typedef void (APIENTRYP PFNGLPOINTPARAMETERXVOESPROC) (GLenum pname, const GLfix typedef void (APIENTRYP PFNGLPOINTSIZEXOESPROC) (GLfixed size); typedef void (APIENTRYP PFNGLPOLYGONOFFSETXOESPROC) (GLfixed factor, GLfixed units); typedef void (APIENTRYP PFNGLROTATEXOESPROC) (GLfixed angle, GLfixed x, GLfixed y, GLfixed z); -typedef void (APIENTRYP PFNGLSAMPLECOVERAGEOESPROC) (GLfixed value, GLboolean invert); typedef void (APIENTRYP PFNGLSCALEXOESPROC) (GLfixed x, GLfixed y, GLfixed z); typedef void (APIENTRYP PFNGLTEXENVXOESPROC) (GLenum target, GLenum pname, GLfixed param); typedef void (APIENTRYP PFNGLTEXENVXVOESPROC) (GLenum target, GLenum pname, const GLfixed *params); @@ -4631,7 +5551,6 @@ GLAPI void APIENTRY glPointParameterxvOES (GLenum pname, const GLfixed *params); GLAPI void APIENTRY glPointSizexOES (GLfixed size); GLAPI void APIENTRY glPolygonOffsetxOES (GLfixed factor, GLfixed units); GLAPI void APIENTRY glRotatexOES (GLfixed angle, GLfixed x, GLfixed y, GLfixed z); -GLAPI void APIENTRY glSampleCoverageOES (GLfixed value, GLboolean invert); GLAPI void APIENTRY glScalexOES (GLfixed x, GLfixed y, GLfixed z); GLAPI void APIENTRY glTexEnvxOES (GLenum target, GLenum pname, GLfixed param); GLAPI void APIENTRY glTexEnvxvOES (GLenum target, GLenum pname, const GLfixed *params); @@ -4793,12 +5712,12 @@ typedef void (APIENTRY *GLDEBUGPROCAMD)(GLuint id,GLenum category,GLenum severi typedef void (APIENTRYP PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf); typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKAMDPROC) (GLDEBUGPROCAMD callback, void *userParam); -typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufSize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDebugMessageEnableAMD (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); GLAPI void APIENTRY glDebugMessageInsertAMD (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf); GLAPI void APIENTRY glDebugMessageCallbackAMD (GLDEBUGPROCAMD callback, void *userParam); -GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); +GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufSize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); #endif #endif /* GL_AMD_debug_output */ @@ -4822,13 +5741,68 @@ GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRG #endif #endif /* GL_AMD_draw_buffers_blend */ +#ifndef GL_AMD_framebuffer_multisample_advanced +#define GL_AMD_framebuffer_multisample_advanced 1 +#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2 +#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3 +#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4 +#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5 +#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6 +#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7 +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_AMD_framebuffer_multisample_advanced */ + +#ifndef GL_AMD_framebuffer_sample_positions +#define GL_AMD_framebuffer_sample_positions 1 +#define GL_SUBSAMPLE_DISTANCE_AMD 0x883F +#define GL_PIXELS_PER_SAMPLE_PATTERN_X_AMD 0x91AE +#define GL_PIXELS_PER_SAMPLE_PATTERN_Y_AMD 0x91AF +#define GL_ALL_PIXELS_AMD 0xFFFFFFFF +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLenum target, GLuint numsamples, GLuint pixelindex, const GLfloat *values); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLuint framebuffer, GLuint numsamples, GLuint pixelindex, const GLfloat *values); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERFVAMDPROC) (GLenum target, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat *values); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERFVAMDPROC) (GLuint framebuffer, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat *values); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSamplePositionsfvAMD (GLenum target, GLuint numsamples, GLuint pixelindex, const GLfloat *values); +GLAPI void APIENTRY glNamedFramebufferSamplePositionsfvAMD (GLuint framebuffer, GLuint numsamples, GLuint pixelindex, const GLfloat *values); +GLAPI void APIENTRY glGetFramebufferParameterfvAMD (GLenum target, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat *values); +GLAPI void APIENTRY glGetNamedFramebufferParameterfvAMD (GLuint framebuffer, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat *values); +#endif +#endif /* GL_AMD_framebuffer_sample_positions */ + #ifndef GL_AMD_gcn_shader #define GL_AMD_gcn_shader 1 #endif /* GL_AMD_gcn_shader */ +#ifndef GL_AMD_gpu_shader_half_float +#define GL_AMD_gpu_shader_half_float 1 +#define GL_FLOAT16_NV 0x8FF8 +#define GL_FLOAT16_VEC2_NV 0x8FF9 +#define GL_FLOAT16_VEC3_NV 0x8FFA +#define GL_FLOAT16_VEC4_NV 0x8FFB +#define GL_FLOAT16_MAT2_AMD 0x91C5 +#define GL_FLOAT16_MAT3_AMD 0x91C6 +#define GL_FLOAT16_MAT4_AMD 0x91C7 +#define GL_FLOAT16_MAT2x3_AMD 0x91C8 +#define GL_FLOAT16_MAT2x4_AMD 0x91C9 +#define GL_FLOAT16_MAT3x2_AMD 0x91CA +#define GL_FLOAT16_MAT3x4_AMD 0x91CB +#define GL_FLOAT16_MAT4x2_AMD 0x91CC +#define GL_FLOAT16_MAT4x3_AMD 0x91CD +#endif /* GL_AMD_gpu_shader_half_float */ + +#ifndef GL_AMD_gpu_shader_int16 +#define GL_AMD_gpu_shader_int16 1 +#endif /* GL_AMD_gpu_shader_int16 */ + #ifndef GL_AMD_gpu_shader_int64 #define GL_AMD_gpu_shader_int64 1 -typedef int64_t GLint64EXT; +typedef khronos_int64_t GLint64EXT; #define GL_INT64_NV 0x140E #define GL_UNSIGNED_INT64_NV 0x140F #define GL_INT8_NV 0x8FE0 @@ -4853,10 +5827,6 @@ typedef int64_t GLint64EXT; #define GL_UNSIGNED_INT64_VEC2_NV 0x8FF5 #define GL_UNSIGNED_INT64_VEC3_NV 0x8FF6 #define GL_UNSIGNED_INT64_VEC4_NV 0x8FF7 -#define GL_FLOAT16_NV 0x8FF8 -#define GL_FLOAT16_VEC2_NV 0x8FF9 -#define GL_FLOAT16_VEC3_NV 0x8FFA -#define GL_FLOAT16_VEC4_NV 0x8FFB typedef void (APIENTRYP PFNGLUNIFORM1I64NVPROC) (GLint location, GLint64EXT x); typedef void (APIENTRYP PFNGLUNIFORM2I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y); typedef void (APIENTRYP PFNGLUNIFORM3I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); @@ -5029,7 +5999,6 @@ GLAPI void APIENTRY glGetPerfMonitorCounterDataAMD (GLuint monitor, GLenum pname #ifndef GL_AMD_sample_positions #define GL_AMD_sample_positions 1 -#define GL_SUBSAMPLE_DISTANCE_AMD 0x883F typedef void (APIENTRYP PFNGLSETMULTISAMPLEFVAMDPROC) (GLenum pname, GLuint index, const GLfloat *val); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLfloat *val); @@ -5044,6 +6013,22 @@ GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLf #define GL_AMD_shader_atomic_counter_ops 1 #endif /* GL_AMD_shader_atomic_counter_ops */ +#ifndef GL_AMD_shader_ballot +#define GL_AMD_shader_ballot 1 +#endif /* GL_AMD_shader_ballot */ + +#ifndef GL_AMD_shader_explicit_vertex_parameter +#define GL_AMD_shader_explicit_vertex_parameter 1 +#endif /* GL_AMD_shader_explicit_vertex_parameter */ + +#ifndef GL_AMD_shader_gpu_shader_half_float_fetch +#define GL_AMD_shader_gpu_shader_half_float_fetch 1 +#endif /* GL_AMD_shader_gpu_shader_half_float_fetch */ + +#ifndef GL_AMD_shader_image_load_store_lod +#define GL_AMD_shader_image_load_store_lod 1 +#endif /* GL_AMD_shader_image_load_store_lod */ + #ifndef GL_AMD_shader_stencil_export #define GL_AMD_shader_stencil_export 1 #endif /* GL_AMD_shader_stencil_export */ @@ -5083,6 +6068,10 @@ GLAPI void APIENTRY glStencilOpValueAMD (GLenum face, GLuint value); #endif #endif /* GL_AMD_stencil_operation_extended */ +#ifndef GL_AMD_texture_gather_bias_lod +#define GL_AMD_texture_gather_bias_lod 1 +#endif /* GL_AMD_texture_gather_bias_lod */ + #ifndef GL_AMD_texture_texture4 #define GL_AMD_texture_texture4 1 #endif /* GL_AMD_texture_texture4 */ @@ -5783,6 +6772,21 @@ GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum pname, GLfloat param); #define GL_422_REV_AVERAGE_EXT 0x80CF #endif /* GL_EXT_422_pixels */ +#ifndef GL_EXT_EGL_image_storage +#define GL_EXT_EGL_image_storage 1 +typedef void *GLeglImageOES; +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list); +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list); +GLAPI void APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#endif +#endif /* GL_EXT_EGL_image_storage */ + +#ifndef GL_EXT_EGL_sync +#define GL_EXT_EGL_sync 1 +#endif /* GL_EXT_EGL_sync */ + #ifndef GL_EXT_abgr #define GL_EXT_abgr 1 #define GL_ABGR_EXT 0x8000 @@ -6345,7 +7349,7 @@ typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLFORMATEXTPROC) (GLuint vaob typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBBINDINGEXTPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBINDINGDIVISOREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); -typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBDIVISOREXTPROC) (GLuint vaobj, GLuint index, GLuint divisor); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); @@ -6601,7 +7605,7 @@ GLAPI void APIENTRY glVertexArrayVertexAttribLFormatEXT (GLuint vaobj, GLuint at GLAPI void APIENTRY glVertexArrayVertexAttribBindingEXT (GLuint vaobj, GLuint attribindex, GLuint bindingindex); GLAPI void APIENTRY glVertexArrayVertexBindingDivisorEXT (GLuint vaobj, GLuint bindingindex, GLuint divisor); GLAPI void APIENTRY glVertexArrayVertexAttribLOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); -GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); GLAPI void APIENTRY glVertexArrayVertexAttribDivisorEXT (GLuint vaobj, GLuint index, GLuint divisor); #endif #endif /* GL_EXT_direct_state_access */ @@ -6634,6 +7638,17 @@ GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint en #endif #endif /* GL_EXT_draw_range_elements */ +#ifndef GL_EXT_external_buffer +#define GL_EXT_external_buffer 1 +typedef void *GLeglClientBufferEXT; +typedef void (APIENTRYP PFNGLBUFFERSTORAGEEXTERNALEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferStorageExternalEXT (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +GLAPI void APIENTRY glNamedBufferStorageExternalEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#endif +#endif /* GL_EXT_external_buffer */ + #ifndef GL_EXT_fog_coord #define GL_EXT_fog_coord 1 #define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 @@ -6824,7 +7839,6 @@ GLAPI void APIENTRY glProgramLocalParameters4fvEXT (GLenum target, GLuint index, #ifndef GL_EXT_gpu_shader4 #define GL_EXT_gpu_shader4 1 -#define GL_VERTEX_ATTRIB_ARRAY_INTEGER_EXT 0x88FD #define GL_SAMPLER_1D_ARRAY_EXT 0x8DC0 #define GL_SAMPLER_2D_ARRAY_EXT 0x8DC1 #define GL_SAMPLER_BUFFER_EXT 0x8DC2 @@ -6852,6 +7866,7 @@ GLAPI void APIENTRY glProgramLocalParameters4fvEXT (GLenum target, GLuint index, #define GL_UNSIGNED_INT_SAMPLER_BUFFER_EXT 0x8DD8 #define GL_MIN_PROGRAM_TEXEL_OFFSET_EXT 0x8904 #define GL_MAX_PROGRAM_TEXEL_OFFSET_EXT 0x8905 +#define GL_VERTEX_ATTRIB_ARRAY_INTEGER_EXT 0x88FD typedef void (APIENTRYP PFNGLGETUNIFORMUIVEXTPROC) (GLuint program, GLint location, GLuint *params); typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONEXTPROC) (GLuint program, GLuint color, const GLchar *name); typedef GLint (APIENTRYP PFNGLGETFRAGDATALOCATIONEXTPROC) (GLuint program, const GLchar *name); @@ -6863,6 +7878,29 @@ typedef void (APIENTRYP PFNGLUNIFORM1UIVEXTPROC) (GLint location, GLsizei count, typedef void (APIENTRYP PFNGLUNIFORM2UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); typedef void (APIENTRYP PFNGLUNIFORM3UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); typedef void (APIENTRYP PFNGLUNIFORM4UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IEXTPROC) (GLuint index, GLint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IEXTPROC) (GLuint index, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IEXTPROC) (GLuint index, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IEXTPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIEXTPROC) (GLuint index, GLuint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIEXTPROC) (GLuint index, GLuint x, GLuint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVEXTPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVEXTPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVEXTPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVEXTPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVEXTPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVEXTPROC) (GLuint index, GLenum pname, GLuint *params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGetUniformuivEXT (GLuint program, GLint location, GLuint *params); GLAPI void APIENTRY glBindFragDataLocationEXT (GLuint program, GLuint color, const GLchar *name); @@ -6875,6 +7913,29 @@ GLAPI void APIENTRY glUniform1uivEXT (GLint location, GLsizei count, const GLuin GLAPI void APIENTRY glUniform2uivEXT (GLint location, GLsizei count, const GLuint *value); GLAPI void APIENTRY glUniform3uivEXT (GLint location, GLsizei count, const GLuint *value); GLAPI void APIENTRY glUniform4uivEXT (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glVertexAttribI1iEXT (GLuint index, GLint x); +GLAPI void APIENTRY glVertexAttribI2iEXT (GLuint index, GLint x, GLint y); +GLAPI void APIENTRY glVertexAttribI3iEXT (GLuint index, GLint x, GLint y, GLint z); +GLAPI void APIENTRY glVertexAttribI4iEXT (GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glVertexAttribI1uiEXT (GLuint index, GLuint x); +GLAPI void APIENTRY glVertexAttribI2uiEXT (GLuint index, GLuint x, GLuint y); +GLAPI void APIENTRY glVertexAttribI3uiEXT (GLuint index, GLuint x, GLuint y, GLuint z); +GLAPI void APIENTRY glVertexAttribI4uiEXT (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glVertexAttribI1ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI2ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI3ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI4ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI1uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI2uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI3uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4bvEXT (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttribI4svEXT (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttribI4ubvEXT (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttribI4usvEXT (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glGetVertexAttribIivEXT (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribIuivEXT (GLuint index, GLenum pname, GLuint *params); #endif #endif /* GL_EXT_gpu_shader4 */ @@ -6977,6 +8038,89 @@ GLAPI void APIENTRY glTextureMaterialEXT (GLenum face, GLenum mode); #endif #endif /* GL_EXT_light_texture */ +#ifndef GL_EXT_memory_object +#define GL_EXT_memory_object 1 +#define GL_TEXTURE_TILING_EXT 0x9580 +#define GL_DEDICATED_MEMORY_OBJECT_EXT 0x9581 +#define GL_PROTECTED_MEMORY_OBJECT_EXT 0x959B +#define GL_NUM_TILING_TYPES_EXT 0x9582 +#define GL_TILING_TYPES_EXT 0x9583 +#define GL_OPTIMAL_TILING_EXT 0x9584 +#define GL_LINEAR_TILING_EXT 0x9585 +#define GL_NUM_DEVICE_UUIDS_EXT 0x9596 +#define GL_DEVICE_UUID_EXT 0x9597 +#define GL_DRIVER_UUID_EXT 0x9598 +#define GL_UUID_SIZE_EXT 16 +typedef void (APIENTRYP PFNGLGETUNSIGNEDBYTEVEXTPROC) (GLenum pname, GLubyte *data); +typedef void (APIENTRYP PFNGLGETUNSIGNEDBYTEI_VEXTPROC) (GLenum target, GLuint index, GLubyte *data); +typedef void (APIENTRYP PFNGLDELETEMEMORYOBJECTSEXTPROC) (GLsizei n, const GLuint *memoryObjects); +typedef GLboolean (APIENTRYP PFNGLISMEMORYOBJECTEXTPROC) (GLuint memoryObject); +typedef void (APIENTRYP PFNGLCREATEMEMORYOBJECTSEXTPROC) (GLsizei n, GLuint *memoryObjects); +typedef void (APIENTRYP PFNGLMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLBUFFERSTORAGEMEMEXTPROC) (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM2DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM3DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC) (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM1DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetUnsignedBytevEXT (GLenum pname, GLubyte *data); +GLAPI void APIENTRY glGetUnsignedBytei_vEXT (GLenum target, GLuint index, GLubyte *data); +GLAPI void APIENTRY glDeleteMemoryObjectsEXT (GLsizei n, const GLuint *memoryObjects); +GLAPI GLboolean APIENTRY glIsMemoryObjectEXT (GLuint memoryObject); +GLAPI void APIENTRY glCreateMemoryObjectsEXT (GLsizei n, GLuint *memoryObjects); +GLAPI void APIENTRY glMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, GLint *params); +GLAPI void APIENTRY glTexStorageMem2DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem2DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem3DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem3DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glBufferStorageMemEXT (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem2DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem2DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem3DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem3DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glNamedBufferStorageMemEXT (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem1DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem1DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_EXT_memory_object */ + +#ifndef GL_EXT_memory_object_fd +#define GL_EXT_memory_object_fd 1 +#define GL_HANDLE_TYPE_OPAQUE_FD_EXT 0x9586 +typedef void (APIENTRYP PFNGLIMPORTMEMORYFDEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportMemoryFdEXT (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_memory_object_fd */ + +#ifndef GL_EXT_memory_object_win32 +#define GL_EXT_memory_object_win32 1 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_EXT 0x9587 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_KMT_EXT 0x9588 +#define GL_DEVICE_LUID_EXT 0x9599 +#define GL_DEVICE_NODE_MASK_EXT 0x959A +#define GL_LUID_SIZE_EXT 8 +#define GL_HANDLE_TYPE_D3D12_TILEPOOL_EXT 0x9589 +#define GL_HANDLE_TYPE_D3D12_RESOURCE_EXT 0x958A +#define GL_HANDLE_TYPE_D3D11_IMAGE_EXT 0x958B +#define GL_HANDLE_TYPE_D3D11_IMAGE_KMT_EXT 0x958C +typedef void (APIENTRYP PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +typedef void (APIENTRYP PFNGLIMPORTMEMORYWIN32NAMEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportMemoryWin32HandleEXT (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +GLAPI void APIENTRY glImportMemoryWin32NameEXT (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_memory_object_win32 */ + #ifndef GL_EXT_misc_attribute #define GL_EXT_misc_attribute 1 #endif /* GL_EXT_misc_attribute */ @@ -7018,6 +8162,18 @@ GLAPI void APIENTRY glSamplePatternEXT (GLenum pattern); #endif #endif /* GL_EXT_multisample */ +#ifndef GL_EXT_multiview_tessellation_geometry_shader +#define GL_EXT_multiview_tessellation_geometry_shader 1 +#endif /* GL_EXT_multiview_tessellation_geometry_shader */ + +#ifndef GL_EXT_multiview_texture_multisample +#define GL_EXT_multiview_texture_multisample 1 +#endif /* GL_EXT_multiview_texture_multisample */ + +#ifndef GL_EXT_multiview_timer_query +#define GL_EXT_multiview_timer_query 1 +#endif /* GL_EXT_multiview_timer_query */ + #ifndef GL_EXT_packed_depth_stencil #define GL_EXT_packed_depth_stencil 1 #define GL_DEPTH_STENCIL_EXT 0x84F9 @@ -7127,6 +8283,19 @@ GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat factor, GLfloat bias); #endif #endif /* GL_EXT_polygon_offset */ +#ifndef GL_EXT_polygon_offset_clamp +#define GL_EXT_polygon_offset_clamp 1 +#define GL_POLYGON_OFFSET_CLAMP_EXT 0x8E1B +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPEXTPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPolygonOffsetClampEXT (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_EXT_polygon_offset_clamp */ + +#ifndef GL_EXT_post_depth_coverage +#define GL_EXT_post_depth_coverage 1 +#endif /* GL_EXT_post_depth_coverage */ + #ifndef GL_EXT_provoking_vertex #define GL_EXT_provoking_vertex 1 #define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION_EXT 0x8E4C @@ -7139,6 +8308,20 @@ GLAPI void APIENTRY glProvokingVertexEXT (GLenum mode); #endif #endif /* GL_EXT_provoking_vertex */ +#ifndef GL_EXT_raster_multisample +#define GL_EXT_raster_multisample 1 +#define GL_RASTER_MULTISAMPLE_EXT 0x9327 +#define GL_RASTER_SAMPLES_EXT 0x9328 +#define GL_MAX_RASTER_SAMPLES_EXT 0x9329 +#define GL_RASTER_FIXED_SAMPLE_LOCATIONS_EXT 0x932A +#define GL_MULTISAMPLE_RASTERIZATION_ALLOWED_EXT 0x932B +#define GL_EFFECTIVE_RASTER_SAMPLES_EXT 0x932C +typedef void (APIENTRYP PFNGLRASTERSAMPLESEXTPROC) (GLuint samples, GLboolean fixedsamplelocations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRasterSamplesEXT (GLuint samples, GLboolean fixedsamplelocations); +#endif +#endif /* GL_EXT_raster_multisample */ + #ifndef GL_EXT_rescale_normal #define GL_EXT_rescale_normal 1 #define GL_RESCALE_NORMAL_EXT 0x803A @@ -7191,6 +8374,55 @@ GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei #endif #endif /* GL_EXT_secondary_color */ +#ifndef GL_EXT_semaphore +#define GL_EXT_semaphore 1 +#define GL_LAYOUT_GENERAL_EXT 0x958D +#define GL_LAYOUT_COLOR_ATTACHMENT_EXT 0x958E +#define GL_LAYOUT_DEPTH_STENCIL_ATTACHMENT_EXT 0x958F +#define GL_LAYOUT_DEPTH_STENCIL_READ_ONLY_EXT 0x9590 +#define GL_LAYOUT_SHADER_READ_ONLY_EXT 0x9591 +#define GL_LAYOUT_TRANSFER_SRC_EXT 0x9592 +#define GL_LAYOUT_TRANSFER_DST_EXT 0x9593 +#define GL_LAYOUT_DEPTH_READ_ONLY_STENCIL_ATTACHMENT_EXT 0x9530 +#define GL_LAYOUT_DEPTH_ATTACHMENT_STENCIL_READ_ONLY_EXT 0x9531 +typedef void (APIENTRYP PFNGLGENSEMAPHORESEXTPROC) (GLsizei n, GLuint *semaphores); +typedef void (APIENTRYP PFNGLDELETESEMAPHORESEXTPROC) (GLsizei n, const GLuint *semaphores); +typedef GLboolean (APIENTRYP PFNGLISSEMAPHOREEXTPROC) (GLuint semaphore); +typedef void (APIENTRYP PFNGLSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, const GLuint64 *params); +typedef void (APIENTRYP PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, GLuint64 *params); +typedef void (APIENTRYP PFNGLWAITSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +typedef void (APIENTRYP PFNGLSIGNALSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenSemaphoresEXT (GLsizei n, GLuint *semaphores); +GLAPI void APIENTRY glDeleteSemaphoresEXT (GLsizei n, const GLuint *semaphores); +GLAPI GLboolean APIENTRY glIsSemaphoreEXT (GLuint semaphore); +GLAPI void APIENTRY glSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, const GLuint64 *params); +GLAPI void APIENTRY glGetSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, GLuint64 *params); +GLAPI void APIENTRY glWaitSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +GLAPI void APIENTRY glSignalSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#endif +#endif /* GL_EXT_semaphore */ + +#ifndef GL_EXT_semaphore_fd +#define GL_EXT_semaphore_fd 1 +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREFDEXTPROC) (GLuint semaphore, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportSemaphoreFdEXT (GLuint semaphore, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_semaphore_fd */ + +#ifndef GL_EXT_semaphore_win32 +#define GL_EXT_semaphore_win32 1 +#define GL_HANDLE_TYPE_D3D12_FENCE_EXT 0x9594 +#define GL_D3D12_FENCE_VALUE_EXT 0x9595 +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC) (GLuint semaphore, GLenum handleType, void *handle); +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC) (GLuint semaphore, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportSemaphoreWin32HandleEXT (GLuint semaphore, GLenum handleType, void *handle); +GLAPI void APIENTRY glImportSemaphoreWin32NameEXT (GLuint semaphore, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_semaphore_win32 */ + #ifndef GL_EXT_separate_shader_objects #define GL_EXT_separate_shader_objects 1 #define GL_ACTIVE_PROGRAM_EXT 0x8B8D @@ -7211,6 +8443,19 @@ GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *strin #define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA #endif /* GL_EXT_separate_specular_color */ +#ifndef GL_EXT_shader_framebuffer_fetch +#define GL_EXT_shader_framebuffer_fetch 1 +#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 +#endif /* GL_EXT_shader_framebuffer_fetch */ + +#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent +#define GL_EXT_shader_framebuffer_fetch_non_coherent 1 +typedef void (APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferFetchBarrierEXT (void); +#endif +#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */ + #ifndef GL_EXT_shader_image_load_formatted #define GL_EXT_shader_image_load_formatted 1 #endif /* GL_EXT_shader_image_load_formatted */ @@ -7284,6 +8529,10 @@ GLAPI void APIENTRY glMemoryBarrierEXT (GLbitfield barriers); #define GL_EXT_shader_integer_mix 1 #endif /* GL_EXT_shader_integer_mix */ +#ifndef GL_EXT_shader_samples_identical +#define GL_EXT_shader_samples_identical 1 +#endif /* GL_EXT_shader_samples_identical */ + #ifndef GL_EXT_shadow_funcs #define GL_EXT_shadow_funcs 1 #endif /* GL_EXT_shadow_funcs */ @@ -7293,6 +8542,10 @@ GLAPI void APIENTRY glMemoryBarrierEXT (GLbitfield barriers); #define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB #endif /* GL_EXT_shared_texture_palette */ +#ifndef GL_EXT_sparse_texture2 +#define GL_EXT_sparse_texture2 1 +#endif /* GL_EXT_sparse_texture2 */ + #ifndef GL_EXT_stencil_clear_tag #define GL_EXT_stencil_clear_tag 1 #define GL_STENCIL_TAG_BITS_EXT 0x88F2 @@ -7405,6 +8658,10 @@ GLAPI void APIENTRY glTexSubImage3DEXT (GLenum target, GLint level, GLint xoffse #define GL_TEXTURE_BINDING_2D_ARRAY_EXT 0x8C1D #define GL_MAX_ARRAY_TEXTURE_LAYERS_EXT 0x88FF #define GL_COMPARE_REF_DEPTH_TO_TEXTURE_EXT 0x884E +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYEREXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferTextureLayerEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +#endif #endif /* GL_EXT_texture_array */ #ifndef GL_EXT_texture_buffer_object @@ -7501,6 +8758,12 @@ GLAPI void APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint #define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF #endif /* GL_EXT_texture_filter_anisotropic */ +#ifndef GL_EXT_texture_filter_minmax +#define GL_EXT_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_EXT 0x9366 +#define GL_WEIGHTED_AVERAGE_EXT 0x9367 +#endif /* GL_EXT_texture_filter_minmax */ + #ifndef GL_EXT_texture_integer #define GL_EXT_texture_integer 1 #define GL_RGBA32UI_EXT 0x8D70 @@ -7633,6 +8896,16 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode); #define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F #endif /* GL_EXT_texture_sRGB */ +#ifndef GL_EXT_texture_sRGB_R8 +#define GL_EXT_texture_sRGB_R8 1 +#define GL_SR8_EXT 0x8FBD +#endif /* GL_EXT_texture_sRGB_R8 */ + +#ifndef GL_EXT_texture_sRGB_RG8 +#define GL_EXT_texture_sRGB_RG8 1 +#define GL_SRG8_EXT 0x8FBE +#endif /* GL_EXT_texture_sRGB_RG8 */ + #ifndef GL_EXT_texture_sRGB_decode #define GL_EXT_texture_sRGB_decode 1 #define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48 @@ -7640,6 +8913,10 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode); #define GL_SKIP_DECODE_EXT 0x8A4A #endif /* GL_EXT_texture_sRGB_decode */ +#ifndef GL_EXT_texture_shadow_lod +#define GL_EXT_texture_shadow_lod 1 +#endif /* GL_EXT_texture_shadow_lod */ + #ifndef GL_EXT_texture_shared_exponent #define GL_EXT_texture_shared_exponent 1 #define GL_RGB9_E5_EXT 0x8C3D @@ -7667,6 +8944,36 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode); #define GL_RGBA_SNORM 0x8F93 #endif /* GL_EXT_texture_snorm */ +#ifndef GL_EXT_texture_storage +#define GL_EXT_texture_storage 1 +#define GL_TEXTURE_IMMUTABLE_FORMAT_EXT 0x912F +#define GL_RGBA32F_EXT 0x8814 +#define GL_RGB32F_EXT 0x8815 +#define GL_ALPHA32F_EXT 0x8816 +#define GL_LUMINANCE32F_EXT 0x8818 +#define GL_LUMINANCE_ALPHA32F_EXT 0x8819 +#define GL_RGBA16F_EXT 0x881A +#define GL_RGB16F_EXT 0x881B +#define GL_ALPHA16F_EXT 0x881C +#define GL_LUMINANCE16F_EXT 0x881E +#define GL_LUMINANCE_ALPHA16F_EXT 0x881F +#define GL_BGRA8_EXT 0x93A1 +#define GL_R8_EXT 0x8229 +#define GL_RG8_EXT 0x822B +#define GL_R32F_EXT 0x822E +#define GL_RG32F_EXT 0x8230 +#define GL_R16F_EXT 0x822D +#define GL_RG16F_EXT 0x822F +typedef void (APIENTRYP PFNGLTEXSTORAGE1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXSTORAGE2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXSTORAGE3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexStorage1DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTexStorage2DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTexStorage3DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +#endif +#endif /* GL_EXT_texture_storage */ + #ifndef GL_EXT_texture_swizzle #define GL_EXT_texture_swizzle 1 #define GL_TEXTURE_SWIZZLE_R_EXT 0x8E42 @@ -8045,6 +9352,30 @@ GLAPI void APIENTRY glVertexWeightPointerEXT (GLint size, GLenum type, GLsizei s #endif #endif /* GL_EXT_vertex_weighting */ +#ifndef GL_EXT_win32_keyed_mutex +#define GL_EXT_win32_keyed_mutex 1 +typedef GLboolean (APIENTRYP PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key, GLuint timeout); +typedef GLboolean (APIENTRYP PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAcquireKeyedMutexWin32EXT (GLuint memory, GLuint64 key, GLuint timeout); +GLAPI GLboolean APIENTRY glReleaseKeyedMutexWin32EXT (GLuint memory, GLuint64 key); +#endif +#endif /* GL_EXT_win32_keyed_mutex */ + +#ifndef GL_EXT_window_rectangles +#define GL_EXT_window_rectangles 1 +#define GL_INCLUSIVE_EXT 0x8F10 +#define GL_EXCLUSIVE_EXT 0x8F11 +#define GL_WINDOW_RECTANGLE_EXT 0x8F12 +#define GL_WINDOW_RECTANGLE_MODE_EXT 0x8F13 +#define GL_MAX_WINDOW_RECTANGLES_EXT 0x8F14 +#define GL_NUM_WINDOW_RECTANGLES_EXT 0x8F15 +typedef void (APIENTRYP PFNGLWINDOWRECTANGLESEXTPROC) (GLenum mode, GLsizei count, const GLint *box); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowRectanglesEXT (GLenum mode, GLsizei count, const GLint *box); +#endif +#endif /* GL_EXT_window_rectangles */ + #ifndef GL_EXT_x11_sync_object #define GL_EXT_x11_sync_object 1 #define GL_SYNC_X11_FENCE_EXT 0x90E1 @@ -8222,10 +9553,28 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG #define GL_INTERLACE_READ_INGR 0x8568 #endif /* GL_INGR_interlace_read */ +#ifndef GL_INTEL_blackhole_render +#define GL_INTEL_blackhole_render 1 +#define GL_BLACKHOLE_RENDER_INTEL 0x83FC +#endif /* GL_INTEL_blackhole_render */ + +#ifndef GL_INTEL_conservative_rasterization +#define GL_INTEL_conservative_rasterization 1 +#define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE +#endif /* GL_INTEL_conservative_rasterization */ + #ifndef GL_INTEL_fragment_shader_ordering #define GL_INTEL_fragment_shader_ordering 1 #endif /* GL_INTEL_fragment_shader_ordering */ +#ifndef GL_INTEL_framebuffer_CMAA +#define GL_INTEL_framebuffer_CMAA 1 +typedef void (APIENTRYP PFNGLAPPLYFRAMEBUFFERATTACHMENTCMAAINTELPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glApplyFramebufferAttachmentCMAAINTEL (void); +#endif +#endif /* GL_INTEL_framebuffer_CMAA */ + #ifndef GL_INTEL_map_texture #define GL_INTEL_map_texture 1 #define GL_TEXTURE_MEMORY_LAYOUT_INTEL 0x83FF @@ -8290,7 +9639,7 @@ typedef void (APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); typedef void (APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); typedef void (APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); typedef void (APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); typedef void (APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); typedef void (APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #ifdef GL_GLEXT_PROTOTYPES @@ -8301,7 +9650,7 @@ GLAPI void APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); GLAPI void APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); GLAPI void APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); GLAPI void APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); GLAPI void APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #endif @@ -8317,11 +9666,37 @@ GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLen #define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E #endif /* GL_MESAX_texture_stack */ +#ifndef GL_MESA_framebuffer_flip_x +#define GL_MESA_framebuffer_flip_x 1 +#define GL_FRAMEBUFFER_FLIP_X_MESA 0x8BBC +#endif /* GL_MESA_framebuffer_flip_x */ + +#ifndef GL_MESA_framebuffer_flip_y +#define GL_MESA_framebuffer_flip_y 1 +#define GL_FRAMEBUFFER_FLIP_Y_MESA 0x8BBB +typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIMESAPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVMESAPROC) (GLenum target, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferParameteriMESA (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glGetFramebufferParameterivMESA (GLenum target, GLenum pname, GLint *params); +#endif +#endif /* GL_MESA_framebuffer_flip_y */ + +#ifndef GL_MESA_framebuffer_swap_xy +#define GL_MESA_framebuffer_swap_xy 1 +#define GL_FRAMEBUFFER_SWAP_XY_MESA 0x8BBD +#endif /* GL_MESA_framebuffer_swap_xy */ + #ifndef GL_MESA_pack_invert #define GL_MESA_pack_invert 1 #define GL_PACK_INVERT_MESA 0x8758 #endif /* GL_MESA_pack_invert */ +#ifndef GL_MESA_program_binary_formats +#define GL_MESA_program_binary_formats 1 +#define GL_PROGRAM_BINARY_FORMAT_MESA 0x875F +#endif /* GL_MESA_program_binary_formats */ + #ifndef GL_MESA_resize_buffers #define GL_MESA_resize_buffers 1 typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); @@ -8330,6 +9705,17 @@ GLAPI void APIENTRY glResizeBuffersMESA (void); #endif #endif /* GL_MESA_resize_buffers */ +#ifndef GL_MESA_shader_integer_functions +#define GL_MESA_shader_integer_functions 1 +#endif /* GL_MESA_shader_integer_functions */ + +#ifndef GL_MESA_tile_raster_order +#define GL_MESA_tile_raster_order 1 +#define GL_TILE_RASTER_ORDER_FIXED_MESA 0x8BB8 +#define GL_TILE_RASTER_ORDER_INCREASING_X_MESA 0x8BB9 +#define GL_TILE_RASTER_ORDER_INCREASING_Y_MESA 0x8BBA +#endif /* GL_MESA_tile_raster_order */ + #ifndef GL_MESA_window_pos #define GL_MESA_window_pos 1 typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); @@ -8391,6 +9777,10 @@ GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *v); #define GL_YCBCR_MESA 0x8757 #endif /* GL_MESA_ycbcr_texture */ +#ifndef GL_NVX_blend_equation_advanced_multi_draw_buffers +#define GL_NVX_blend_equation_advanced_multi_draw_buffers 1 +#endif /* GL_NVX_blend_equation_advanced_multi_draw_buffers */ + #ifndef GL_NVX_conditional_render #define GL_NVX_conditional_render 1 typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERNVXPROC) (GLuint id); @@ -8410,6 +9800,65 @@ GLAPI void APIENTRY glEndConditionalRenderNVX (void); #define GL_GPU_MEMORY_INFO_EVICTED_MEMORY_NVX 0x904B #endif /* GL_NVX_gpu_memory_info */ +#ifndef GL_NVX_gpu_multicast2 +#define GL_NVX_gpu_multicast2 1 +#define GL_UPLOAD_GPU_MASK_NVX 0x954A +typedef void (APIENTRYP PFNGLUPLOADGPUMASKNVXPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLMULTICASTVIEWPORTARRAYVNVXPROC) (GLuint gpu, GLuint first, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTICASTVIEWPORTPOSITIONWSCALENVXPROC) (GLuint gpu, GLuint index, GLfloat xcoeff, GLfloat ycoeff); +typedef void (APIENTRYP PFNGLMULTICASTSCISSORARRAYVNVXPROC) (GLuint gpu, GLuint first, GLsizei count, const GLint *v); +typedef GLuint (APIENTRYP PFNGLASYNCCOPYBUFFERSUBDATANVXPROC) (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *fenceValueArray, GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray); +typedef GLuint (APIENTRYP PFNGLASYNCCOPYIMAGESUBDATANVXPROC) (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *waitValueArray, GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUploadGpuMaskNVX (GLbitfield mask); +GLAPI void APIENTRY glMulticastViewportArrayvNVX (GLuint gpu, GLuint first, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glMulticastViewportPositionWScaleNVX (GLuint gpu, GLuint index, GLfloat xcoeff, GLfloat ycoeff); +GLAPI void APIENTRY glMulticastScissorArrayvNVX (GLuint gpu, GLuint first, GLsizei count, const GLint *v); +GLAPI GLuint APIENTRY glAsyncCopyBufferSubDataNVX (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *fenceValueArray, GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray); +GLAPI GLuint APIENTRY glAsyncCopyImageSubDataNVX (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *waitValueArray, GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray); +#endif +#endif /* GL_NVX_gpu_multicast2 */ + +#ifndef GL_NVX_linked_gpu_multicast +#define GL_NVX_linked_gpu_multicast 1 +#define GL_LGPU_SEPARATE_STORAGE_BIT_NVX 0x0800 +#define GL_MAX_LGPU_GPUS_NVX 0x92BA +typedef void (APIENTRYP PFNGLLGPUNAMEDBUFFERSUBDATANVXPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLLGPUCOPYIMAGESUBDATANVXPROC) (GLuint sourceGpu, GLbitfield destinationGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srxY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLLGPUINTERLOCKNVXPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLGPUNamedBufferSubDataNVX (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glLGPUCopyImageSubDataNVX (GLuint sourceGpu, GLbitfield destinationGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srxY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glLGPUInterlockNVX (void); +#endif +#endif /* GL_NVX_linked_gpu_multicast */ + +#ifndef GL_NVX_progress_fence +#define GL_NVX_progress_fence 1 +typedef GLuint (APIENTRYP PFNGLCREATEPROGRESSFENCENVXPROC) (void); +typedef void (APIENTRYP PFNGLSIGNALSEMAPHOREUI64NVXPROC) (GLuint signalGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray); +typedef void (APIENTRYP PFNGLWAITSEMAPHOREUI64NVXPROC) (GLuint waitGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray); +typedef void (APIENTRYP PFNGLCLIENTWAITSEMAPHOREUI64NVXPROC) (GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glCreateProgressFenceNVX (void); +GLAPI void APIENTRY glSignalSemaphoreui64NVX (GLuint signalGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray); +GLAPI void APIENTRY glWaitSemaphoreui64NVX (GLuint waitGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray); +GLAPI void APIENTRY glClientWaitSemaphoreui64NVX (GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray); +#endif +#endif /* GL_NVX_progress_fence */ + +#ifndef GL_NV_alpha_to_coverage_dither_control +#define GL_NV_alpha_to_coverage_dither_control 1 +#define GL_ALPHA_TO_COVERAGE_DITHER_DEFAULT_NV 0x934D +#define GL_ALPHA_TO_COVERAGE_DITHER_ENABLE_NV 0x934E +#define GL_ALPHA_TO_COVERAGE_DITHER_DISABLE_NV 0x934F +#define GL_ALPHA_TO_COVERAGE_DITHER_MODE_NV 0x92BF +typedef void (APIENTRYP PFNGLALPHATOCOVERAGEDITHERCONTROLNVPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glAlphaToCoverageDitherControlNV (GLenum mode); +#endif +#endif /* GL_NV_alpha_to_coverage_dither_control */ + #ifndef GL_NV_bindless_multi_draw_indirect #define GL_NV_bindless_multi_draw_indirect 1 typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); @@ -8420,6 +9869,16 @@ GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessNV (GLenum mode, GLenum t #endif #endif /* GL_NV_bindless_multi_draw_indirect */ +#ifndef GL_NV_bindless_multi_draw_indirect_count +#define GL_NV_bindless_multi_draw_indirect_count 1 +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSCOUNTNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSCOUNTNVPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessCountNV (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessCountNV (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +#endif +#endif /* GL_NV_bindless_multi_draw_indirect_count */ + #ifndef GL_NV_bindless_texture #define GL_NV_bindless_texture 1 typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLENVPROC) (GLuint texture); @@ -8516,16 +9975,94 @@ GLAPI void APIENTRY glBlendBarrierNV (void); #define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #endif /* GL_NV_blend_equation_advanced_coherent */ +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 +#endif /* GL_NV_blend_minmax_factor */ + #ifndef GL_NV_blend_square #define GL_NV_blend_square 1 #endif /* GL_NV_blend_square */ +#ifndef GL_NV_clip_space_w_scaling +#define GL_NV_clip_space_w_scaling 1 +#define GL_VIEWPORT_POSITION_W_SCALE_NV 0x937C +#define GL_VIEWPORT_POSITION_W_SCALE_X_COEFF_NV 0x937D +#define GL_VIEWPORT_POSITION_W_SCALE_Y_COEFF_NV 0x937E +typedef void (APIENTRYP PFNGLVIEWPORTPOSITIONWSCALENVPROC) (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glViewportPositionWScaleNV (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#endif +#endif /* GL_NV_clip_space_w_scaling */ + +#ifndef GL_NV_command_list +#define GL_NV_command_list 1 +#define GL_TERMINATE_SEQUENCE_COMMAND_NV 0x0000 +#define GL_NOP_COMMAND_NV 0x0001 +#define GL_DRAW_ELEMENTS_COMMAND_NV 0x0002 +#define GL_DRAW_ARRAYS_COMMAND_NV 0x0003 +#define GL_DRAW_ELEMENTS_STRIP_COMMAND_NV 0x0004 +#define GL_DRAW_ARRAYS_STRIP_COMMAND_NV 0x0005 +#define GL_DRAW_ELEMENTS_INSTANCED_COMMAND_NV 0x0006 +#define GL_DRAW_ARRAYS_INSTANCED_COMMAND_NV 0x0007 +#define GL_ELEMENT_ADDRESS_COMMAND_NV 0x0008 +#define GL_ATTRIBUTE_ADDRESS_COMMAND_NV 0x0009 +#define GL_UNIFORM_ADDRESS_COMMAND_NV 0x000A +#define GL_BLEND_COLOR_COMMAND_NV 0x000B +#define GL_STENCIL_REF_COMMAND_NV 0x000C +#define GL_LINE_WIDTH_COMMAND_NV 0x000D +#define GL_POLYGON_OFFSET_COMMAND_NV 0x000E +#define GL_ALPHA_REF_COMMAND_NV 0x000F +#define GL_VIEWPORT_COMMAND_NV 0x0010 +#define GL_SCISSOR_COMMAND_NV 0x0011 +#define GL_FRONT_FACE_COMMAND_NV 0x0012 +typedef void (APIENTRYP PFNGLCREATESTATESNVPROC) (GLsizei n, GLuint *states); +typedef void (APIENTRYP PFNGLDELETESTATESNVPROC) (GLsizei n, const GLuint *states); +typedef GLboolean (APIENTRYP PFNGLISSTATENVPROC) (GLuint state); +typedef void (APIENTRYP PFNGLSTATECAPTURENVPROC) (GLuint state, GLenum mode); +typedef GLuint (APIENTRYP PFNGLGETCOMMANDHEADERNVPROC) (GLenum tokenID, GLuint size); +typedef GLushort (APIENTRYP PFNGLGETSTAGEINDEXNVPROC) (GLenum shadertype); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSNVPROC) (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSADDRESSNVPROC) (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESNVPROC) (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESADDRESSNVPROC) (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLCREATECOMMANDLISTSNVPROC) (GLsizei n, GLuint *lists); +typedef void (APIENTRYP PFNGLDELETECOMMANDLISTSNVPROC) (GLsizei n, const GLuint *lists); +typedef GLboolean (APIENTRYP PFNGLISCOMMANDLISTNVPROC) (GLuint list); +typedef void (APIENTRYP PFNGLLISTDRAWCOMMANDSSTATESCLIENTNVPROC) (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLCOMMANDLISTSEGMENTSNVPROC) (GLuint list, GLuint segments); +typedef void (APIENTRYP PFNGLCOMPILECOMMANDLISTNVPROC) (GLuint list); +typedef void (APIENTRYP PFNGLCALLCOMMANDLISTNVPROC) (GLuint list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCreateStatesNV (GLsizei n, GLuint *states); +GLAPI void APIENTRY glDeleteStatesNV (GLsizei n, const GLuint *states); +GLAPI GLboolean APIENTRY glIsStateNV (GLuint state); +GLAPI void APIENTRY glStateCaptureNV (GLuint state, GLenum mode); +GLAPI GLuint APIENTRY glGetCommandHeaderNV (GLenum tokenID, GLuint size); +GLAPI GLushort APIENTRY glGetStageIndexNV (GLenum shadertype); +GLAPI void APIENTRY glDrawCommandsNV (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count); +GLAPI void APIENTRY glDrawCommandsAddressNV (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count); +GLAPI void APIENTRY glDrawCommandsStatesNV (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glDrawCommandsStatesAddressNV (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glCreateCommandListsNV (GLsizei n, GLuint *lists); +GLAPI void APIENTRY glDeleteCommandListsNV (GLsizei n, const GLuint *lists); +GLAPI GLboolean APIENTRY glIsCommandListNV (GLuint list); +GLAPI void APIENTRY glListDrawCommandsStatesClientNV (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glCommandListSegmentsNV (GLuint list, GLuint segments); +GLAPI void APIENTRY glCompileCommandListNV (GLuint list); +GLAPI void APIENTRY glCallCommandListNV (GLuint list); +#endif +#endif /* GL_NV_command_list */ + #ifndef GL_NV_compute_program5 #define GL_NV_compute_program5 1 #define GL_COMPUTE_PROGRAM_NV 0x90FB #define GL_COMPUTE_PROGRAM_PARAMETER_BUFFER_NV 0x90FC #endif /* GL_NV_compute_program5 */ +#ifndef GL_NV_compute_shader_derivatives +#define GL_NV_compute_shader_derivatives 1 +#endif /* GL_NV_compute_shader_derivatives */ + #ifndef GL_NV_conditional_render #define GL_NV_conditional_render 1 #define GL_QUERY_WAIT_NV 0x8E13 @@ -8540,6 +10077,49 @@ GLAPI void APIENTRY glEndConditionalRenderNV (void); #endif #endif /* GL_NV_conditional_render */ +#ifndef GL_NV_conservative_raster +#define GL_NV_conservative_raster 1 +#define GL_CONSERVATIVE_RASTERIZATION_NV 0x9346 +#define GL_SUBPIXEL_PRECISION_BIAS_X_BITS_NV 0x9347 +#define GL_SUBPIXEL_PRECISION_BIAS_Y_BITS_NV 0x9348 +#define GL_MAX_SUBPIXEL_PRECISION_BIAS_BITS_NV 0x9349 +typedef void (APIENTRYP PFNGLSUBPIXELPRECISIONBIASNVPROC) (GLuint xbits, GLuint ybits); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybits); +#endif +#endif /* GL_NV_conservative_raster */ + +#ifndef GL_NV_conservative_raster_dilate +#define GL_NV_conservative_raster_dilate 1 +#define GL_CONSERVATIVE_RASTER_DILATE_NV 0x9379 +#define GL_CONSERVATIVE_RASTER_DILATE_RANGE_NV 0x937A +#define GL_CONSERVATIVE_RASTER_DILATE_GRANULARITY_NV 0x937B +typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERFNVPROC) (GLenum pname, GLfloat value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConservativeRasterParameterfNV (GLenum pname, GLfloat value); +#endif +#endif /* GL_NV_conservative_raster_dilate */ + +#ifndef GL_NV_conservative_raster_pre_snap +#define GL_NV_conservative_raster_pre_snap 1 +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_NV 0x9550 +#endif /* GL_NV_conservative_raster_pre_snap */ + +#ifndef GL_NV_conservative_raster_pre_snap_triangles +#define GL_NV_conservative_raster_pre_snap_triangles 1 +#define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D +#define GL_CONSERVATIVE_RASTER_MODE_POST_SNAP_NV 0x954E +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_TRIANGLES_NV 0x954F +typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERINVPROC) (GLenum pname, GLint param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConservativeRasterParameteriNV (GLenum pname, GLint param); +#endif +#endif /* GL_NV_conservative_raster_pre_snap_triangles */ + +#ifndef GL_NV_conservative_raster_underestimation +#define GL_NV_conservative_raster_underestimation 1 +#endif /* GL_NV_conservative_raster_underestimation */ + #ifndef GL_NV_copy_depth_to_color #define GL_NV_copy_depth_to_color 1 #define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E @@ -8589,6 +10169,23 @@ GLAPI void APIENTRY glDrawTextureNV (GLuint texture, GLuint sampler, GLfloat x0, #endif #endif /* GL_NV_draw_texture */ +#ifndef GL_NV_draw_vulkan_image +#define GL_NV_draw_vulkan_image 1 +typedef void (APIENTRY *GLVULKANPROCNV)(void); +typedef void (APIENTRYP PFNGLDRAWVKIMAGENVPROC) (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +typedef GLVULKANPROCNV (APIENTRYP PFNGLGETVKPROCADDRNVPROC) (const GLchar *name); +typedef void (APIENTRYP PFNGLWAITVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (APIENTRYP PFNGLSIGNALVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (APIENTRYP PFNGLSIGNALVKFENCENVPROC) (GLuint64 vkFence); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawVkImageNV (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +GLAPI GLVULKANPROCNV APIENTRY glGetVkProcAddrNV (const GLchar *name); +GLAPI void APIENTRY glWaitVkSemaphoreNV (GLuint64 vkSemaphore); +GLAPI void APIENTRY glSignalVkSemaphoreNV (GLuint64 vkSemaphore); +GLAPI void APIENTRY glSignalVkFenceNV (GLuint64 vkFence); +#endif +#endif /* GL_NV_draw_vulkan_image */ + #ifndef GL_NV_evaluators #define GL_NV_evaluators 1 #define GL_EVAL_2D_NV 0x86C0 @@ -8682,6 +10279,11 @@ GLAPI void APIENTRY glSetFenceNV (GLuint fence, GLenum condition); #endif #endif /* GL_NV_fence */ +#ifndef GL_NV_fill_rectangle +#define GL_NV_fill_rectangle 1 +#define GL_FILL_RECTANGLE_NV 0x933C +#endif /* GL_NV_fill_rectangle */ + #ifndef GL_NV_float_buffer #define GL_NV_float_buffer 1 #define GL_FLOAT_R_NV 0x8880 @@ -8708,6 +10310,16 @@ GLAPI void APIENTRY glSetFenceNV (GLuint fence, GLenum condition); #define GL_EYE_PLANE_ABSOLUTE_NV 0x855C #endif /* GL_NV_fog_distance */ +#ifndef GL_NV_fragment_coverage_to_color +#define GL_NV_fragment_coverage_to_color 1 +#define GL_FRAGMENT_COVERAGE_TO_COLOR_NV 0x92DD +#define GL_FRAGMENT_COVERAGE_COLOR_NV 0x92DE +typedef void (APIENTRYP PFNGLFRAGMENTCOVERAGECOLORNVPROC) (GLuint color); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFragmentCoverageColorNV (GLuint color); +#endif +#endif /* GL_NV_fragment_coverage_to_color */ + #ifndef GL_NV_fragment_program #define GL_NV_fragment_program 1 #define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868 @@ -8749,6 +10361,34 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons #define GL_NV_fragment_program_option 1 #endif /* GL_NV_fragment_program_option */ +#ifndef GL_NV_fragment_shader_barycentric +#define GL_NV_fragment_shader_barycentric 1 +#endif /* GL_NV_fragment_shader_barycentric */ + +#ifndef GL_NV_fragment_shader_interlock +#define GL_NV_fragment_shader_interlock 1 +#endif /* GL_NV_fragment_shader_interlock */ + +#ifndef GL_NV_framebuffer_mixed_samples +#define GL_NV_framebuffer_mixed_samples 1 +#define GL_COVERAGE_MODULATION_TABLE_NV 0x9331 +#define GL_COLOR_SAMPLES_NV 0x8E20 +#define GL_DEPTH_SAMPLES_NV 0x932D +#define GL_STENCIL_SAMPLES_NV 0x932E +#define GL_MIXED_DEPTH_SAMPLES_SUPPORTED_NV 0x932F +#define GL_MIXED_STENCIL_SAMPLES_SUPPORTED_NV 0x9330 +#define GL_COVERAGE_MODULATION_NV 0x9332 +#define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333 +typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v); +typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufSize, GLfloat *v); +typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v); +GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufSize, GLfloat *v); +GLAPI void APIENTRY glCoverageModulationNV (GLenum components); +#endif +#endif /* GL_NV_framebuffer_mixed_samples */ + #ifndef GL_NV_framebuffer_multisample_coverage #define GL_NV_framebuffer_multisample_coverage 1 #define GL_RENDERBUFFER_COVERAGE_SAMPLES_NV 0x8CAB @@ -8768,12 +10408,10 @@ GLAPI void APIENTRY glRenderbufferStorageMultisampleCoverageNV (GLenum target, G #define GL_MAX_PROGRAM_TOTAL_OUTPUT_COMPONENTS_NV 0x8C28 typedef void (APIENTRYP PFNGLPROGRAMVERTEXLIMITNVPROC) (GLenum target, GLint limit); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYEREXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glProgramVertexLimitNV (GLenum target, GLint limit); GLAPI void APIENTRY glFramebufferTextureEXT (GLenum target, GLenum attachment, GLuint texture, GLint level); -GLAPI void APIENTRY glFramebufferTextureLayerEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); #endif #endif /* GL_NV_geometry_program4 */ @@ -8782,6 +10420,45 @@ GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachmen #define GL_NV_geometry_shader4 1 #endif /* GL_NV_geometry_shader4 */ +#ifndef GL_NV_geometry_shader_passthrough +#define GL_NV_geometry_shader_passthrough 1 +#endif /* GL_NV_geometry_shader_passthrough */ + +#ifndef GL_NV_gpu_multicast +#define GL_NV_gpu_multicast 1 +#define GL_PER_GPU_STORAGE_BIT_NV 0x0800 +#define GL_MULTICAST_GPUS_NV 0x92BA +#define GL_RENDER_GPU_MASK_NV 0x9558 +#define GL_PER_GPU_STORAGE_NV 0x9548 +#define GL_MULTICAST_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9549 +typedef void (APIENTRYP PFNGLRENDERGPUMASKNVPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLMULTICASTBUFFERSUBDATANVPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLMULTICASTCOPYBUFFERSUBDATANVPROC) (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLMULTICASTCOPYIMAGESUBDATANVPROC) (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +typedef void (APIENTRYP PFNGLMULTICASTBLITFRAMEBUFFERNVPROC) (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef void (APIENTRYP PFNGLMULTICASTFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint gpu, GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTICASTBARRIERNVPROC) (void); +typedef void (APIENTRYP PFNGLMULTICASTWAITSYNCNVPROC) (GLuint signalGpu, GLbitfield waitGpuMask); +typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTIVNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTUIVNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTI64VNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTUI64VNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLuint64 *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderGpuMaskNV (GLbitfield mask); +GLAPI void APIENTRY glMulticastBufferSubDataNV (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glMulticastCopyBufferSubDataNV (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glMulticastCopyImageSubDataNV (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +GLAPI void APIENTRY glMulticastBlitFramebufferNV (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI void APIENTRY glMulticastFramebufferSampleLocationsfvNV (GLuint gpu, GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glMulticastBarrierNV (void); +GLAPI void APIENTRY glMulticastWaitSyncNV (GLuint signalGpu, GLbitfield waitGpuMask); +GLAPI void APIENTRY glMulticastGetQueryObjectivNV (GLuint gpu, GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glMulticastGetQueryObjectuivNV (GLuint gpu, GLuint id, GLenum pname, GLuint *params); +GLAPI void APIENTRY glMulticastGetQueryObjecti64vNV (GLuint gpu, GLuint id, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glMulticastGetQueryObjectui64vNV (GLuint gpu, GLuint id, GLenum pname, GLuint64 *params); +#endif +#endif /* GL_NV_gpu_multicast */ + #ifndef GL_NV_gpu_program4 #define GL_NV_gpu_program4 1 #define GL_MIN_PROGRAM_TEXEL_OFFSET_NV 0x8904 @@ -8954,15 +10631,130 @@ GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfN #endif #endif /* GL_NV_half_float */ +#ifndef GL_NV_internalformat_sample_query +#define GL_NV_internalformat_sample_query 1 +#define GL_MULTISAMPLES_NV 0x9371 +#define GL_SUPERSAMPLE_SCALE_X_NV 0x9372 +#define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373 +#define GL_CONFORMANT_NV 0x9374 +typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params); +#endif +#endif /* GL_NV_internalformat_sample_query */ + #ifndef GL_NV_light_max_exponent #define GL_NV_light_max_exponent 1 #define GL_MAX_SHININESS_NV 0x8504 #define GL_MAX_SPOT_EXPONENT_NV 0x8505 #endif /* GL_NV_light_max_exponent */ +#ifndef GL_NV_memory_attachment +#define GL_NV_memory_attachment 1 +#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4 +#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5 +#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6 +#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7 +#define GL_MEMORY_ATTACHABLE_NV 0x95A8 +#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9 +#define GL_DETACHED_TEXTURES_NV 0x95AA +#define GL_DETACHED_BUFFERS_NV 0x95AB +#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC +#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD +typedef void (APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +typedef void (APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname); +typedef void (APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +GLAPI void APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname); +GLAPI void APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_NV_memory_attachment */ + +#ifndef GL_NV_memory_object_sparse +#define GL_NV_memory_object_sparse 1 +typedef void (APIENTRYP PFNGLBUFFERPAGECOMMITMENTMEMNVPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTMEMNVPROC) (GLenum target, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTMEMNVPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTMEMNVPROC) (GLuint texture, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferPageCommitmentMemNV (GLenum target, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +GLAPI void APIENTRY glTexPageCommitmentMemNV (GLenum target, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentMemNV (GLuint buffer, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +GLAPI void APIENTRY glTexturePageCommitmentMemNV (GLuint texture, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +#endif +#endif /* GL_NV_memory_object_sparse */ + +#ifndef GL_NV_mesh_shader +#define GL_NV_mesh_shader 1 +#define GL_MESH_SHADER_NV 0x9559 +#define GL_TASK_SHADER_NV 0x955A +#define GL_MAX_MESH_UNIFORM_BLOCKS_NV 0x8E60 +#define GL_MAX_MESH_TEXTURE_IMAGE_UNITS_NV 0x8E61 +#define GL_MAX_MESH_IMAGE_UNIFORMS_NV 0x8E62 +#define GL_MAX_MESH_UNIFORM_COMPONENTS_NV 0x8E63 +#define GL_MAX_MESH_ATOMIC_COUNTER_BUFFERS_NV 0x8E64 +#define GL_MAX_MESH_ATOMIC_COUNTERS_NV 0x8E65 +#define GL_MAX_MESH_SHADER_STORAGE_BLOCKS_NV 0x8E66 +#define GL_MAX_COMBINED_MESH_UNIFORM_COMPONENTS_NV 0x8E67 +#define GL_MAX_TASK_UNIFORM_BLOCKS_NV 0x8E68 +#define GL_MAX_TASK_TEXTURE_IMAGE_UNITS_NV 0x8E69 +#define GL_MAX_TASK_IMAGE_UNIFORMS_NV 0x8E6A +#define GL_MAX_TASK_UNIFORM_COMPONENTS_NV 0x8E6B +#define GL_MAX_TASK_ATOMIC_COUNTER_BUFFERS_NV 0x8E6C +#define GL_MAX_TASK_ATOMIC_COUNTERS_NV 0x8E6D +#define GL_MAX_TASK_SHADER_STORAGE_BLOCKS_NV 0x8E6E +#define GL_MAX_COMBINED_TASK_UNIFORM_COMPONENTS_NV 0x8E6F +#define GL_MAX_MESH_WORK_GROUP_INVOCATIONS_NV 0x95A2 +#define GL_MAX_TASK_WORK_GROUP_INVOCATIONS_NV 0x95A3 +#define GL_MAX_MESH_TOTAL_MEMORY_SIZE_NV 0x9536 +#define GL_MAX_TASK_TOTAL_MEMORY_SIZE_NV 0x9537 +#define GL_MAX_MESH_OUTPUT_VERTICES_NV 0x9538 +#define GL_MAX_MESH_OUTPUT_PRIMITIVES_NV 0x9539 +#define GL_MAX_TASK_OUTPUT_COUNT_NV 0x953A +#define GL_MAX_DRAW_MESH_TASKS_COUNT_NV 0x953D +#define GL_MAX_MESH_VIEWS_NV 0x9557 +#define GL_MESH_OUTPUT_PER_VERTEX_GRANULARITY_NV 0x92DF +#define GL_MESH_OUTPUT_PER_PRIMITIVE_GRANULARITY_NV 0x9543 +#define GL_MAX_MESH_WORK_GROUP_SIZE_NV 0x953B +#define GL_MAX_TASK_WORK_GROUP_SIZE_NV 0x953C +#define GL_MESH_WORK_GROUP_SIZE_NV 0x953E +#define GL_TASK_WORK_GROUP_SIZE_NV 0x953F +#define GL_MESH_VERTICES_OUT_NV 0x9579 +#define GL_MESH_PRIMITIVES_OUT_NV 0x957A +#define GL_MESH_OUTPUT_TYPE_NV 0x957B +#define GL_UNIFORM_BLOCK_REFERENCED_BY_MESH_SHADER_NV 0x959C +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TASK_SHADER_NV 0x959D +#define GL_REFERENCED_BY_MESH_SHADER_NV 0x95A0 +#define GL_REFERENCED_BY_TASK_SHADER_NV 0x95A1 +#define GL_MESH_SHADER_BIT_NV 0x00000040 +#define GL_TASK_SHADER_BIT_NV 0x00000080 +#define GL_MESH_SUBROUTINE_NV 0x957C +#define GL_TASK_SUBROUTINE_NV 0x957D +#define GL_MESH_SUBROUTINE_UNIFORM_NV 0x957E +#define GL_TASK_SUBROUTINE_UNIFORM_NV 0x957F +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_MESH_SHADER_NV 0x959E +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TASK_SHADER_NV 0x959F +typedef void (APIENTRYP PFNGLDRAWMESHTASKSNVPROC) (GLuint first, GLuint count); +typedef void (APIENTRYP PFNGLDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect); +typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect, GLsizei drawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTCOUNTNVPROC) (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawMeshTasksNV (GLuint first, GLuint count); +GLAPI void APIENTRY glDrawMeshTasksIndirectNV (GLintptr indirect); +GLAPI void APIENTRY glMultiDrawMeshTasksIndirectNV (GLintptr indirect, GLsizei drawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawMeshTasksIndirectCountNV (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#endif +#endif /* GL_NV_mesh_shader */ + #ifndef GL_NV_multisample_coverage #define GL_NV_multisample_coverage 1 -#define GL_COLOR_SAMPLES_NV 0x8E20 #endif /* GL_NV_multisample_coverage */ #ifndef GL_NV_multisample_filter_hint @@ -9075,13 +10867,11 @@ GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindi #define GL_SKIP_MISSING_GLYPH_NV 0x90A9 #define GL_USE_MISSING_GLYPH_NV 0x90AA #define GL_PATH_ERROR_POSITION_NV 0x90AB -#define GL_PATH_FOG_GEN_MODE_NV 0x90AC #define GL_ACCUM_ADJACENT_PAIRS_NV 0x90AD #define GL_ADJACENT_PAIRS_NV 0x90AE #define GL_FIRST_TO_REST_NV 0x90AF #define GL_PATH_GEN_MODE_NV 0x90B0 #define GL_PATH_GEN_COEFF_NV 0x90B1 -#define GL_PATH_GEN_COLOR_FORMAT_NV 0x90B2 #define GL_PATH_GEN_COMPONENTS_NV 0x90B3 #define GL_PATH_STENCIL_FUNC_NV 0x90B7 #define GL_PATH_STENCIL_REF_NV 0x90B8 @@ -9150,8 +10940,44 @@ GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindi #define GL_FONT_UNDERLINE_POSITION_BIT_NV 0x04000000 #define GL_FONT_UNDERLINE_THICKNESS_BIT_NV 0x08000000 #define GL_FONT_HAS_KERNING_BIT_NV 0x10000000 +#define GL_ROUNDED_RECT_NV 0xE8 +#define GL_RELATIVE_ROUNDED_RECT_NV 0xE9 +#define GL_ROUNDED_RECT2_NV 0xEA +#define GL_RELATIVE_ROUNDED_RECT2_NV 0xEB +#define GL_ROUNDED_RECT4_NV 0xEC +#define GL_RELATIVE_ROUNDED_RECT4_NV 0xED +#define GL_ROUNDED_RECT8_NV 0xEE +#define GL_RELATIVE_ROUNDED_RECT8_NV 0xEF +#define GL_RELATIVE_RECT_NV 0xF7 +#define GL_FONT_GLYPHS_AVAILABLE_NV 0x9368 +#define GL_FONT_TARGET_UNAVAILABLE_NV 0x9369 +#define GL_FONT_UNAVAILABLE_NV 0x936A +#define GL_FONT_UNINTELLIGIBLE_NV 0x936B +#define GL_CONIC_CURVE_TO_NV 0x1A +#define GL_RELATIVE_CONIC_CURVE_TO_NV 0x1B +#define GL_FONT_NUM_GLYPH_INDICES_BIT_NV 0x20000000 +#define GL_STANDARD_FONT_FORMAT_NV 0x936C +#define GL_2_BYTES_NV 0x1407 +#define GL_3_BYTES_NV 0x1408 +#define GL_4_BYTES_NV 0x1409 +#define GL_EYE_LINEAR_NV 0x2400 +#define GL_OBJECT_LINEAR_NV 0x2401 +#define GL_CONSTANT_NV 0x8576 +#define GL_PATH_FOG_GEN_MODE_NV 0x90AC #define GL_PRIMARY_COLOR_NV 0x852C #define GL_SECONDARY_COLOR_NV 0x852D +#define GL_PATH_GEN_COLOR_FORMAT_NV 0x90B2 +#define GL_PATH_PROJECTION_NV 0x1701 +#define GL_PATH_MODELVIEW_NV 0x1700 +#define GL_PATH_MODELVIEW_STACK_DEPTH_NV 0x0BA3 +#define GL_PATH_MODELVIEW_MATRIX_NV 0x0BA6 +#define GL_PATH_MAX_MODELVIEW_STACK_DEPTH_NV 0x0D36 +#define GL_PATH_TRANSPOSE_MODELVIEW_MATRIX_NV 0x84E3 +#define GL_PATH_PROJECTION_STACK_DEPTH_NV 0x0BA4 +#define GL_PATH_PROJECTION_MATRIX_NV 0x0BA7 +#define GL_PATH_MAX_PROJECTION_STACK_DEPTH_NV 0x0D38 +#define GL_PATH_TRANSPOSE_PROJECTION_MATRIX_NV 0x84E4 +#define GL_FRAGMENT_INPUT_NV 0x936D typedef GLuint (APIENTRYP PFNGLGENPATHSNVPROC) (GLsizei range); typedef void (APIENTRYP PFNGLDELETEPATHSNVPROC) (GLuint path, GLsizei range); typedef GLboolean (APIENTRYP PFNGLISPATHNVPROC) (GLuint path); @@ -9178,9 +11004,6 @@ typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHNVPROC) (GLuint path, GLint refere typedef void (APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); typedef void (APIENTRYP PFNGLPATHCOVERDEPTHFUNCNVPROC) (GLenum func); -typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); -typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); -typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode); typedef void (APIENTRYP PFNGLCOVERFILLPATHNVPROC) (GLuint path, GLenum coverMode); typedef void (APIENTRYP PFNGLCOVERSTROKEPATHNVPROC) (GLuint path, GLenum coverMode); typedef void (APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); @@ -9193,14 +11016,32 @@ typedef void (APIENTRYP PFNGLGETPATHDASHARRAYNVPROC) (GLuint path, GLfloat *dash typedef void (APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); typedef void (APIENTRYP PFNGLGETPATHMETRICRANGENVPROC) (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); typedef void (APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); -typedef void (APIENTRYP PFNGLGETPATHCOLORGENIVNVPROC) (GLenum color, GLenum pname, GLint *value); -typedef void (APIENTRYP PFNGLGETPATHCOLORGENFVNVPROC) (GLenum color, GLenum pname, GLfloat *value); -typedef void (APIENTRYP PFNGLGETPATHTEXGENIVNVPROC) (GLenum texCoordSet, GLenum pname, GLint *value); -typedef void (APIENTRYP PFNGLGETPATHTEXGENFVNVPROC) (GLenum texCoordSet, GLenum pname, GLfloat *value); typedef GLboolean (APIENTRYP PFNGLISPOINTINFILLPATHNVPROC) (GLuint path, GLuint mask, GLfloat x, GLfloat y); typedef GLboolean (APIENTRYP PFNGLISPOINTINSTROKEPATHNVPROC) (GLuint path, GLfloat x, GLfloat y); typedef GLfloat (APIENTRYP PFNGLGETPATHLENGTHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments); typedef GLboolean (APIENTRYP PFNGLPOINTALONGPATHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +typedef void (APIENTRYP PFNGLMATRIXLOAD3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOAD3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULT3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULT3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXRANGENVPROC) (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint *baseAndCount); +typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params); +typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode); +typedef void (APIENTRYP PFNGLGETPATHCOLORGENIVNVPROC) (GLenum color, GLenum pname, GLint *value); +typedef void (APIENTRYP PFNGLGETPATHCOLORGENFVNVPROC) (GLenum color, GLenum pname, GLfloat *value); +typedef void (APIENTRYP PFNGLGETPATHTEXGENIVNVPROC) (GLenum texCoordSet, GLenum pname, GLint *value); +typedef void (APIENTRYP PFNGLGETPATHTEXGENFVNVPROC) (GLenum texCoordSet, GLenum pname, GLfloat *value); #ifdef GL_GLEXT_PROTOTYPES GLAPI GLuint APIENTRY glGenPathsNV (GLsizei range); GLAPI void APIENTRY glDeletePathsNV (GLuint path, GLsizei range); @@ -9228,9 +11069,6 @@ GLAPI void APIENTRY glStencilStrokePathNV (GLuint path, GLint reference, GLuint GLAPI void APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); GLAPI void APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); GLAPI void APIENTRY glPathCoverDepthFuncNV (GLenum func); -GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); -GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); -GLAPI void APIENTRY glPathFogGenNV (GLenum genMode); GLAPI void APIENTRY glCoverFillPathNV (GLuint path, GLenum coverMode); GLAPI void APIENTRY glCoverStrokePathNV (GLuint path, GLenum coverMode); GLAPI void APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); @@ -9243,17 +11081,40 @@ GLAPI void APIENTRY glGetPathDashArrayNV (GLuint path, GLfloat *dashArray); GLAPI void APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); GLAPI void APIENTRY glGetPathMetricRangeNV (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); GLAPI void APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); -GLAPI void APIENTRY glGetPathColorGenivNV (GLenum color, GLenum pname, GLint *value); -GLAPI void APIENTRY glGetPathColorGenfvNV (GLenum color, GLenum pname, GLfloat *value); -GLAPI void APIENTRY glGetPathTexGenivNV (GLenum texCoordSet, GLenum pname, GLint *value); -GLAPI void APIENTRY glGetPathTexGenfvNV (GLenum texCoordSet, GLenum pname, GLfloat *value); GLAPI GLboolean APIENTRY glIsPointInFillPathNV (GLuint path, GLuint mask, GLfloat x, GLfloat y); GLAPI GLboolean APIENTRY glIsPointInStrokePathNV (GLuint path, GLfloat x, GLfloat y); GLAPI GLfloat APIENTRY glGetPathLengthNV (GLuint path, GLsizei startSegment, GLsizei numSegments); GLAPI GLboolean APIENTRY glPointAlongPathNV (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +GLAPI void APIENTRY glMatrixLoad3x2fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoad3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoadTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMult3x2fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMult3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glStencilThenCoverFillPathNV (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +GLAPI void APIENTRY glStencilThenCoverStrokePathNV (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +GLAPI void APIENTRY glStencilThenCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilThenCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI GLenum APIENTRY glPathGlyphIndexRangeNV (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint *baseAndCount); +GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params); +GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); +GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); +GLAPI void APIENTRY glPathFogGenNV (GLenum genMode); +GLAPI void APIENTRY glGetPathColorGenivNV (GLenum color, GLenum pname, GLint *value); +GLAPI void APIENTRY glGetPathColorGenfvNV (GLenum color, GLenum pname, GLfloat *value); +GLAPI void APIENTRY glGetPathTexGenivNV (GLenum texCoordSet, GLenum pname, GLint *value); +GLAPI void APIENTRY glGetPathTexGenfvNV (GLenum texCoordSet, GLenum pname, GLfloat *value); #endif #endif /* GL_NV_path_rendering */ +#ifndef GL_NV_path_rendering_shared_edge +#define GL_NV_path_rendering_shared_edge 1 +#define GL_SHARED_EDGE_NV 0xC0 +#endif /* GL_NV_path_rendering_shared_edge */ + #ifndef GL_NV_pixel_data_range #define GL_NV_pixel_data_range 1 #define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878 @@ -9319,6 +11180,38 @@ GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint index); #endif #endif /* GL_NV_primitive_restart */ +#ifndef GL_NV_primitive_shading_rate +#define GL_NV_primitive_shading_rate 1 +#define GL_SHADING_RATE_IMAGE_PER_PRIMITIVE_NV 0x95B1 +#define GL_SHADING_RATE_IMAGE_PALETTE_COUNT_NV 0x95B2 +#endif /* GL_NV_primitive_shading_rate */ + +#ifndef GL_NV_query_resource +#define GL_NV_query_resource 1 +#define GL_QUERY_RESOURCE_TYPE_VIDMEM_ALLOC_NV 0x9540 +#define GL_QUERY_RESOURCE_MEMTYPE_VIDMEM_NV 0x9542 +#define GL_QUERY_RESOURCE_SYS_RESERVED_NV 0x9544 +#define GL_QUERY_RESOURCE_TEXTURE_NV 0x9545 +#define GL_QUERY_RESOURCE_RENDERBUFFER_NV 0x9546 +#define GL_QUERY_RESOURCE_BUFFEROBJECT_NV 0x9547 +typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint count, GLint *buffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint count, GLint *buffer); +#endif +#endif /* GL_NV_query_resource */ + +#ifndef GL_NV_query_resource_tag +#define GL_NV_query_resource_tag 1 +typedef void (APIENTRYP PFNGLGENQUERYRESOURCETAGNVPROC) (GLsizei n, GLint *tagIds); +typedef void (APIENTRYP PFNGLDELETEQUERYRESOURCETAGNVPROC) (GLsizei n, const GLint *tagIds); +typedef void (APIENTRYP PFNGLQUERYRESOURCETAGNVPROC) (GLint tagId, const GLchar *tagString); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueryResourceTagNV (GLsizei n, GLint *tagIds); +GLAPI void APIENTRY glDeleteQueryResourceTagNV (GLsizei n, const GLint *tagIds); +GLAPI void APIENTRY glQueryResourceTagNV (GLint tagId, const GLchar *tagString); +#endif +#endif /* GL_NV_query_resource_tag */ + #ifndef GL_NV_register_combiners #define GL_NV_register_combiners 1 #define GL_REGISTER_COMBINERS_NV 0x8522 @@ -9411,6 +11304,52 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname, #endif #endif /* GL_NV_register_combiners2 */ +#ifndef GL_NV_representative_fragment_test +#define GL_NV_representative_fragment_test 1 +#define GL_REPRESENTATIVE_FRAGMENT_TEST_NV 0x937F +#endif /* GL_NV_representative_fragment_test */ + +#ifndef GL_NV_robustness_video_memory_purge +#define GL_NV_robustness_video_memory_purge 1 +#define GL_PURGED_CONTEXT_RESET_NV 0x92BB +#endif /* GL_NV_robustness_video_memory_purge */ + +#ifndef GL_NV_sample_locations +#define GL_NV_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_NV 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_NV 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_NV 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_NV 0x9340 +#define GL_SAMPLE_LOCATION_NV 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_NV 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_NV 0x9343 +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLRESOLVEDEPTHVALUESNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSampleLocationsfvNV (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvNV (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glResolveDepthValuesNV (void); +#endif +#endif /* GL_NV_sample_locations */ + +#ifndef GL_NV_sample_mask_override_coverage +#define GL_NV_sample_mask_override_coverage 1 +#endif /* GL_NV_sample_mask_override_coverage */ + +#ifndef GL_NV_scissor_exclusive +#define GL_NV_scissor_exclusive 1 +#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555 +#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556 +typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v); +#endif +#endif /* GL_NV_scissor_exclusive */ + #ifndef GL_NV_shader_atomic_counters #define GL_NV_shader_atomic_counters 1 #endif /* GL_NV_shader_atomic_counters */ @@ -9419,6 +11358,18 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname, #define GL_NV_shader_atomic_float 1 #endif /* GL_NV_shader_atomic_float */ +#ifndef GL_NV_shader_atomic_float64 +#define GL_NV_shader_atomic_float64 1 +#endif /* GL_NV_shader_atomic_float64 */ + +#ifndef GL_NV_shader_atomic_fp16_vector +#define GL_NV_shader_atomic_fp16_vector 1 +#endif /* GL_NV_shader_atomic_fp16_vector */ + +#ifndef GL_NV_shader_atomic_int64 +#define GL_NV_shader_atomic_int64 1 +#endif /* GL_NV_shader_atomic_int64 */ + #ifndef GL_NV_shader_buffer_load #define GL_NV_shader_buffer_load 1 #define GL_BUFFER_GPU_ADDRESS_NV 0x8F1D @@ -9463,6 +11414,15 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs #define GL_NV_shader_storage_buffer_object 1 #endif /* GL_NV_shader_storage_buffer_object */ +#ifndef GL_NV_shader_subgroup_partitioned +#define GL_NV_shader_subgroup_partitioned 1 +#define GL_SUBGROUP_FEATURE_PARTITIONED_BIT_NV 0x00000100 +#endif /* GL_NV_shader_subgroup_partitioned */ + +#ifndef GL_NV_shader_texture_footprint +#define GL_NV_shader_texture_footprint 1 +#endif /* GL_NV_shader_texture_footprint */ + #ifndef GL_NV_shader_thread_group #define GL_NV_shader_thread_group 1 #define GL_WARP_SIZE_NV 0x9339 @@ -9474,6 +11434,51 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs #define GL_NV_shader_thread_shuffle 1 #endif /* GL_NV_shader_thread_shuffle */ +#ifndef GL_NV_shading_rate_image +#define GL_NV_shading_rate_image 1 +#define GL_SHADING_RATE_IMAGE_NV 0x9563 +#define GL_SHADING_RATE_NO_INVOCATIONS_NV 0x9564 +#define GL_SHADING_RATE_1_INVOCATION_PER_PIXEL_NV 0x9565 +#define GL_SHADING_RATE_1_INVOCATION_PER_1X2_PIXELS_NV 0x9566 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X1_PIXELS_NV 0x9567 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X2_PIXELS_NV 0x9568 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X4_PIXELS_NV 0x9569 +#define GL_SHADING_RATE_1_INVOCATION_PER_4X2_PIXELS_NV 0x956A +#define GL_SHADING_RATE_1_INVOCATION_PER_4X4_PIXELS_NV 0x956B +#define GL_SHADING_RATE_2_INVOCATIONS_PER_PIXEL_NV 0x956C +#define GL_SHADING_RATE_4_INVOCATIONS_PER_PIXEL_NV 0x956D +#define GL_SHADING_RATE_8_INVOCATIONS_PER_PIXEL_NV 0x956E +#define GL_SHADING_RATE_16_INVOCATIONS_PER_PIXEL_NV 0x956F +#define GL_SHADING_RATE_IMAGE_BINDING_NV 0x955B +#define GL_SHADING_RATE_IMAGE_TEXEL_WIDTH_NV 0x955C +#define GL_SHADING_RATE_IMAGE_TEXEL_HEIGHT_NV 0x955D +#define GL_SHADING_RATE_IMAGE_PALETTE_SIZE_NV 0x955E +#define GL_MAX_COARSE_FRAGMENT_SAMPLES_NV 0x955F +#define GL_SHADING_RATE_SAMPLE_ORDER_DEFAULT_NV 0x95AE +#define GL_SHADING_RATE_SAMPLE_ORDER_PIXEL_MAJOR_NV 0x95AF +#define GL_SHADING_RATE_SAMPLE_ORDER_SAMPLE_MAJOR_NV 0x95B0 +typedef void (APIENTRYP PFNGLBINDSHADINGRATEIMAGENVPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLGETSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint entry, GLenum *rate); +typedef void (APIENTRYP PFNGLGETSHADINGRATESAMPLELOCATIONIVNVPROC) (GLenum rate, GLuint samples, GLuint index, GLint *location); +typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEBARRIERNVPROC) (GLboolean synchronize); +typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERNVPROC) (GLenum order); +typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERCUSTOMNVPROC) (GLenum rate, GLuint samples, const GLint *locations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindShadingRateImageNV (GLuint texture); +GLAPI void APIENTRY glGetShadingRateImagePaletteNV (GLuint viewport, GLuint entry, GLenum *rate); +GLAPI void APIENTRY glGetShadingRateSampleLocationivNV (GLenum rate, GLuint samples, GLuint index, GLint *location); +GLAPI void APIENTRY glShadingRateImageBarrierNV (GLboolean synchronize); +GLAPI void APIENTRY glShadingRateImagePaletteNV (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +GLAPI void APIENTRY glShadingRateSampleOrderNV (GLenum order); +GLAPI void APIENTRY glShadingRateSampleOrderCustomNV (GLenum rate, GLuint samples, const GLint *locations); +#endif +#endif /* GL_NV_shading_rate_image */ + +#ifndef GL_NV_stereo_view_rendering +#define GL_NV_stereo_view_rendering 1 +#endif /* GL_NV_stereo_view_rendering */ + #ifndef GL_NV_tessellation_program5 #define GL_NV_tessellation_program5 1 #define GL_MAX_PROGRAM_PATCH_ATTRIBS_NV 0x86D8 @@ -9550,6 +11555,10 @@ GLAPI void APIENTRY glTextureImage3DMultisampleCoverageNV (GLuint texture, GLenu #define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 #endif /* GL_NV_texture_rectangle */ +#ifndef GL_NV_texture_rectangle_compressed +#define GL_NV_texture_rectangle_compressed 1 +#endif /* GL_NV_texture_rectangle_compressed */ + #ifndef GL_NV_texture_shader #define GL_NV_texture_shader 1 #define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C @@ -9653,6 +11662,23 @@ GLAPI void APIENTRY glTextureImage3DMultisampleCoverageNV (GLuint texture, GLenu #define GL_FORCE_BLUE_TO_ONE_NV 0x8860 #endif /* GL_NV_texture_shader3 */ +#ifndef GL_NV_timeline_semaphore +#define GL_NV_timeline_semaphore 1 +#define GL_TIMELINE_SEMAPHORE_VALUE_NV 0x9595 +#define GL_SEMAPHORE_TYPE_NV 0x95B3 +#define GL_SEMAPHORE_TYPE_BINARY_NV 0x95B4 +#define GL_SEMAPHORE_TYPE_TIMELINE_NV 0x95B5 +#define GL_MAX_TIMELINE_SEMAPHORE_VALUE_DIFFERENCE_NV 0x95B6 +typedef void (APIENTRYP PFNGLCREATESEMAPHORESNVPROC) (GLsizei n, GLuint *semaphores); +typedef void (APIENTRYP PFNGLSEMAPHOREPARAMETERIVNVPROC) (GLuint semaphore, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETSEMAPHOREPARAMETERIVNVPROC) (GLuint semaphore, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCreateSemaphoresNV (GLsizei n, GLuint *semaphores); +GLAPI void APIENTRY glSemaphoreParameterivNV (GLuint semaphore, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetSemaphoreParameterivNV (GLuint semaphore, GLenum pname, GLint *params); +#endif +#endif /* GL_NV_timeline_semaphore */ + #ifndef GL_NV_transform_feedback #define GL_NV_transform_feedback 1 #define GL_BACK_PRIMARY_COLOR_NV 0x8C77 @@ -9688,7 +11714,7 @@ GLAPI void APIENTRY glTextureImage3DMultisampleCoverageNV (GLuint texture, GLenu #define GL_SKIP_COMPONENTS1_NV -6 typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKNVPROC) (GLenum primitiveMode); typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKNVPROC) (void); -typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC) (GLuint count, const GLint *attribs, GLenum bufferMode); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC) (GLsizei count, const GLint *attribs, GLenum bufferMode); typedef void (APIENTRYP PFNGLBINDBUFFERRANGENVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); typedef void (APIENTRYP PFNGLBINDBUFFEROFFSETNVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset); typedef void (APIENTRYP PFNGLBINDBUFFERBASENVPROC) (GLenum target, GLuint index, GLuint buffer); @@ -9701,7 +11727,7 @@ typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKSTREAMATTRIBSNVPROC) (GLsizei coun #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBeginTransformFeedbackNV (GLenum primitiveMode); GLAPI void APIENTRY glEndTransformFeedbackNV (void); -GLAPI void APIENTRY glTransformFeedbackAttribsNV (GLuint count, const GLint *attribs, GLenum bufferMode); +GLAPI void APIENTRY glTransformFeedbackAttribsNV (GLsizei count, const GLint *attribs, GLenum bufferMode); GLAPI void APIENTRY glBindBufferRangeNV (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); GLAPI void APIENTRY glBindBufferOffsetNV (GLenum target, GLuint index, GLuint buffer, GLintptr offset); GLAPI void APIENTRY glBindBufferBaseNV (GLenum target, GLuint index, GLuint buffer); @@ -9738,6 +11764,13 @@ GLAPI void APIENTRY glDrawTransformFeedbackNV (GLenum mode, GLuint id); #endif #endif /* GL_NV_transform_feedback2 */ +#ifndef GL_NV_uniform_buffer_unified_memory +#define GL_NV_uniform_buffer_unified_memory 1 +#define GL_UNIFORM_BUFFER_UNIFIED_NV 0x936E +#define GL_UNIFORM_BUFFER_ADDRESS_NV 0x936F +#define GL_UNIFORM_BUFFER_LENGTH_NV 0x9370 +#endif /* GL_NV_uniform_buffer_unified_memory */ + #ifndef GL_NV_vdpau_interop #define GL_NV_vdpau_interop 1 typedef GLintptr GLvdpauSurfaceNV; @@ -9751,7 +11784,7 @@ typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); typedef GLboolean (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface); typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface); -typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei count, GLsizei *length, GLint *values); typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface, GLenum access); typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); @@ -9762,13 +11795,21 @@ GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const void *vdpSu GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); GLAPI GLboolean APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface); GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface); -GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei count, GLsizei *length, GLint *values); GLAPI void APIENTRY glVDPAUSurfaceAccessNV (GLvdpauSurfaceNV surface, GLenum access); GLAPI void APIENTRY glVDPAUMapSurfacesNV (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); #endif #endif /* GL_NV_vdpau_interop */ +#ifndef GL_NV_vdpau_interop2 +#define GL_NV_vdpau_interop2 1 +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACEWITHPICTURESTRUCTURENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceWithPictureStructureNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure); +#endif +#endif /* GL_NV_vdpau_interop2 */ + #ifndef GL_NV_vertex_array_range #define GL_NV_vertex_array_range 1 #define GL_VERTEX_ARRAY_RANGE_NV 0x851D @@ -10124,54 +12165,6 @@ GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint index, GLsizei count, const GL #ifndef GL_NV_vertex_program4 #define GL_NV_vertex_program4 1 #define GL_VERTEX_ATTRIB_ARRAY_INTEGER_NV 0x88FD -typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IEXTPROC) (GLuint index, GLint x); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IEXTPROC) (GLuint index, GLint x, GLint y); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IEXTPROC) (GLuint index, GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IEXTPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIEXTPROC) (GLuint index, GLuint x); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIEXTPROC) (GLuint index, GLuint x, GLuint y); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVEXTPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVEXTPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVEXTPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVEXTPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVEXTPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVEXTPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVEXTPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVEXTPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVEXTPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVEXTPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVEXTPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVEXTPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVEXTPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVEXTPROC) (GLuint index, GLenum pname, GLuint *params); -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexAttribI1iEXT (GLuint index, GLint x); -GLAPI void APIENTRY glVertexAttribI2iEXT (GLuint index, GLint x, GLint y); -GLAPI void APIENTRY glVertexAttribI3iEXT (GLuint index, GLint x, GLint y, GLint z); -GLAPI void APIENTRY glVertexAttribI4iEXT (GLuint index, GLint x, GLint y, GLint z, GLint w); -GLAPI void APIENTRY glVertexAttribI1uiEXT (GLuint index, GLuint x); -GLAPI void APIENTRY glVertexAttribI2uiEXT (GLuint index, GLuint x, GLuint y); -GLAPI void APIENTRY glVertexAttribI3uiEXT (GLuint index, GLuint x, GLuint y, GLuint z); -GLAPI void APIENTRY glVertexAttribI4uiEXT (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); -GLAPI void APIENTRY glVertexAttribI1ivEXT (GLuint index, const GLint *v); -GLAPI void APIENTRY glVertexAttribI2ivEXT (GLuint index, const GLint *v); -GLAPI void APIENTRY glVertexAttribI3ivEXT (GLuint index, const GLint *v); -GLAPI void APIENTRY glVertexAttribI4ivEXT (GLuint index, const GLint *v); -GLAPI void APIENTRY glVertexAttribI1uivEXT (GLuint index, const GLuint *v); -GLAPI void APIENTRY glVertexAttribI2uivEXT (GLuint index, const GLuint *v); -GLAPI void APIENTRY glVertexAttribI3uivEXT (GLuint index, const GLuint *v); -GLAPI void APIENTRY glVertexAttribI4uivEXT (GLuint index, const GLuint *v); -GLAPI void APIENTRY glVertexAttribI4bvEXT (GLuint index, const GLbyte *v); -GLAPI void APIENTRY glVertexAttribI4svEXT (GLuint index, const GLshort *v); -GLAPI void APIENTRY glVertexAttribI4ubvEXT (GLuint index, const GLubyte *v); -GLAPI void APIENTRY glVertexAttribI4usvEXT (GLuint index, const GLushort *v); -GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); -GLAPI void APIENTRY glGetVertexAttribIivEXT (GLuint index, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetVertexAttribIuivEXT (GLuint index, GLenum pname, GLuint *params); -#endif #endif /* GL_NV_vertex_program4 */ #ifndef GL_NV_video_capture @@ -10233,6 +12226,30 @@ GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot #endif #endif /* GL_NV_video_capture */ +#ifndef GL_NV_viewport_array2 +#define GL_NV_viewport_array2 1 +#endif /* GL_NV_viewport_array2 */ + +#ifndef GL_NV_viewport_swizzle +#define GL_NV_viewport_swizzle 1 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_X_NV 0x9350 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_X_NV 0x9351 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Y_NV 0x9352 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Y_NV 0x9353 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Z_NV 0x9354 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Z_NV 0x9355 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_W_NV 0x9356 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_W_NV 0x9357 +#define GL_VIEWPORT_SWIZZLE_X_NV 0x9358 +#define GL_VIEWPORT_SWIZZLE_Y_NV 0x9359 +#define GL_VIEWPORT_SWIZZLE_Z_NV 0x935A +#define GL_VIEWPORT_SWIZZLE_W_NV 0x935B +typedef void (APIENTRYP PFNGLVIEWPORTSWIZZLENVPROC) (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glViewportSwizzleNV (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); +#endif +#endif /* GL_NV_viewport_swizzle */ + #ifndef GL_OML_interlace #define GL_OML_interlace 1 #define GL_INTERLACE_OML 0x8980 @@ -10255,6 +12272,22 @@ GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot #define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983 #endif /* GL_OML_subsample */ +#ifndef GL_OVR_multiview +#define GL_OVR_multiview 1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_NUM_VIEWS_OVR 0x9630 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_BASE_VIEW_INDEX_OVR 0x9632 +#define GL_MAX_VIEWS_OVR 0x9631 +#define GL_FRAMEBUFFER_INCOMPLETE_VIEW_TARGETS_OVR 0x9633 +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferTextureMultiviewOVR (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#endif +#endif /* GL_OVR_multiview */ + +#ifndef GL_OVR_multiview2 +#define GL_OVR_multiview2 1 +#endif /* GL_OVR_multiview2 */ + #ifndef GL_PGI_misc_hints #define GL_PGI_misc_hints 1 #define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8 @@ -10811,10 +12844,10 @@ GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *equation); #ifndef GL_SGIX_resample #define GL_SGIX_resample 1 -#define GL_PACK_RESAMPLE_SGIX 0x842C -#define GL_UNPACK_RESAMPLE_SGIX 0x842D -#define GL_RESAMPLE_REPLICATE_SGIX 0x842E -#define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F +#define GL_PACK_RESAMPLE_SGIX 0x842E +#define GL_UNPACK_RESAMPLE_SGIX 0x842F +#define GL_RESAMPLE_REPLICATE_SGIX 0x8433 +#define GL_RESAMPLE_ZERO_FILL_SGIX 0x8434 #define GL_RESAMPLE_DECIMATE_SGIX 0x8430 #endif /* GL_SGIX_resample */ diff --git a/libs/SDL2/include/SDL_opengles.h b/libs/SDL2/include/SDL_opengles.h index 8511b96..f4465ea 100644 --- a/libs/SDL2/include/SDL_opengles.h +++ b/libs/SDL2/include/SDL_opengles.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_opengles2.h b/libs/SDL2/include/SDL_opengles2.h index 172fcb3..5e3b717 100644 --- a/libs/SDL2/include/SDL_opengles2.h +++ b/libs/SDL2/include/SDL_opengles2.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_opengles2_gl2.h b/libs/SDL2/include/SDL_opengles2_gl2.h index c62fb0a..d13622a 100644 --- a/libs/SDL2/include/SDL_opengles2_gl2.h +++ b/libs/SDL2/include/SDL_opengles2_gl2.h @@ -1,56 +1,70 @@ -#ifndef __gl2_h_ -#define __gl2_h_ - -/* $Revision: 20555 $ on $Date:: 2013-02-12 14:32:47 -0800 #$ */ - -/*#include */ +#ifndef __gles2_gl2_h_ +#define __gles2_gl2_h_ 1 #ifdef __cplusplus extern "C" { #endif /* - * This document is licensed under the SGI Free Software B License Version - * 2.0. For details, see http://oss.sgi.com/projects/FreeB/ . +** Copyright 2013-2020 The Khronos Group Inc. +** SPDX-License-Identifier: MIT +** +** This header is generated from the Khronos OpenGL / OpenGL ES XML +** API Registry. The current version of the Registry, generator scripts +** used to make the header, and the header can be found at +** https://github.com/KhronosGroup/OpenGL-Registry +*/ + +/*#include */ + +#ifndef GL_APIENTRYP +#define GL_APIENTRYP GL_APIENTRY* +#endif + +#ifndef GL_GLES_PROTOTYPES +#define GL_GLES_PROTOTYPES 1 +#endif + +/* Generated on date 20220530 */ + +/* Generated C header for: + * API: gles2 + * Profile: common + * Versions considered: 2\.[0-9] + * Versions emitted: .* + * Default extensions included: None + * Additional extensions included: _nomatch_^ + * Extensions removed: _nomatch_^ */ -/*------------------------------------------------------------------------- - * Data type definitions - *-----------------------------------------------------------------------*/ - -typedef void GLvoid; -typedef char GLchar; -typedef unsigned int GLenum; -typedef unsigned char GLboolean; -typedef unsigned int GLbitfield; -typedef khronos_int8_t GLbyte; -typedef short GLshort; -typedef int GLint; -typedef int GLsizei; -typedef khronos_uint8_t GLubyte; -typedef unsigned short GLushort; -typedef unsigned int GLuint; -typedef khronos_float_t GLfloat; -typedef khronos_float_t GLclampf; -typedef khronos_int32_t GLfixed; - -/* GL types for handling large vertex buffer objects */ +#ifndef GL_ES_VERSION_2_0 +#define GL_ES_VERSION_2_0 1 +/*#include */ +typedef khronos_int8_t GLbyte; +typedef khronos_float_t GLclampf; +typedef khronos_int32_t GLfixed; +typedef khronos_int16_t GLshort; +typedef khronos_uint16_t GLushort; +typedef void GLvoid; +typedef struct __GLsync *GLsync; +typedef khronos_int64_t GLint64; +typedef khronos_uint64_t GLuint64; +typedef unsigned int GLenum; +typedef unsigned int GLuint; +typedef char GLchar; +typedef khronos_float_t GLfloat; +typedef khronos_ssize_t GLsizeiptr; typedef khronos_intptr_t GLintptr; -typedef khronos_ssize_t GLsizeiptr; - -/* OpenGL ES core versions */ -#define GL_ES_VERSION_2_0 1 - -/* ClearBufferMask */ +typedef unsigned int GLbitfield; +typedef int GLint; +typedef unsigned char GLboolean; +typedef int GLsizei; +typedef khronos_uint8_t GLubyte; #define GL_DEPTH_BUFFER_BIT 0x00000100 #define GL_STENCIL_BUFFER_BIT 0x00000400 #define GL_COLOR_BUFFER_BIT 0x00004000 - -/* Boolean */ #define GL_FALSE 0 #define GL_TRUE 1 - -/* BeginMode */ #define GL_POINTS 0x0000 #define GL_LINES 0x0001 #define GL_LINE_LOOP 0x0002 @@ -58,18 +72,6 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_TRIANGLES 0x0004 #define GL_TRIANGLE_STRIP 0x0005 #define GL_TRIANGLE_FAN 0x0006 - -/* AlphaFunction (not supported in ES20) */ -/* GL_NEVER */ -/* GL_LESS */ -/* GL_EQUAL */ -/* GL_LEQUAL */ -/* GL_GREATER */ -/* GL_NOTEQUAL */ -/* GL_GEQUAL */ -/* GL_ALWAYS */ - -/* BlendingFactorDest */ #define GL_ZERO 0 #define GL_ONE 1 #define GL_SRC_COLOR 0x0300 @@ -78,29 +80,15 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_ONE_MINUS_SRC_ALPHA 0x0303 #define GL_DST_ALPHA 0x0304 #define GL_ONE_MINUS_DST_ALPHA 0x0305 - -/* BlendingFactorSrc */ -/* GL_ZERO */ -/* GL_ONE */ #define GL_DST_COLOR 0x0306 #define GL_ONE_MINUS_DST_COLOR 0x0307 #define GL_SRC_ALPHA_SATURATE 0x0308 -/* GL_SRC_ALPHA */ -/* GL_ONE_MINUS_SRC_ALPHA */ -/* GL_DST_ALPHA */ -/* GL_ONE_MINUS_DST_ALPHA */ - -/* BlendEquationSeparate */ #define GL_FUNC_ADD 0x8006 #define GL_BLEND_EQUATION 0x8009 -#define GL_BLEND_EQUATION_RGB 0x8009 /* same as BLEND_EQUATION */ +#define GL_BLEND_EQUATION_RGB 0x8009 #define GL_BLEND_EQUATION_ALPHA 0x883D - -/* BlendSubtract */ #define GL_FUNC_SUBTRACT 0x800A #define GL_FUNC_REVERSE_SUBTRACT 0x800B - -/* Separate Blend Functions */ #define GL_BLEND_DST_RGB 0x80C8 #define GL_BLEND_SRC_RGB 0x80C9 #define GL_BLEND_DST_ALPHA 0x80CA @@ -110,38 +98,19 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_CONSTANT_ALPHA 0x8003 #define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 #define GL_BLEND_COLOR 0x8005 - -/* Buffer Objects */ #define GL_ARRAY_BUFFER 0x8892 #define GL_ELEMENT_ARRAY_BUFFER 0x8893 #define GL_ARRAY_BUFFER_BINDING 0x8894 #define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895 - #define GL_STREAM_DRAW 0x88E0 #define GL_STATIC_DRAW 0x88E4 #define GL_DYNAMIC_DRAW 0x88E8 - #define GL_BUFFER_SIZE 0x8764 #define GL_BUFFER_USAGE 0x8765 - #define GL_CURRENT_VERTEX_ATTRIB 0x8626 - -/* CullFaceMode */ #define GL_FRONT 0x0404 #define GL_BACK 0x0405 #define GL_FRONT_AND_BACK 0x0408 - -/* DepthFunction */ -/* GL_NEVER */ -/* GL_LESS */ -/* GL_EQUAL */ -/* GL_LEQUAL */ -/* GL_GREATER */ -/* GL_NOTEQUAL */ -/* GL_GEQUAL */ -/* GL_ALWAYS */ - -/* EnableCap */ #define GL_TEXTURE_2D 0x0DE1 #define GL_CULL_FACE 0x0B44 #define GL_BLEND 0x0BE2 @@ -152,19 +121,13 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_POLYGON_OFFSET_FILL 0x8037 #define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E #define GL_SAMPLE_COVERAGE 0x80A0 - -/* ErrorCode */ #define GL_NO_ERROR 0 #define GL_INVALID_ENUM 0x0500 #define GL_INVALID_VALUE 0x0501 #define GL_INVALID_OPERATION 0x0502 #define GL_OUT_OF_MEMORY 0x0505 - -/* FrontFaceDirection */ #define GL_CW 0x0900 #define GL_CCW 0x0901 - -/* GetPName */ #define GL_LINE_WIDTH 0x0B21 #define GL_ALIASED_POINT_SIZE_RANGE 0x846D #define GL_ALIASED_LINE_WIDTH_RANGE 0x846E @@ -191,7 +154,6 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_STENCIL_BACK_WRITEMASK 0x8CA5 #define GL_VIEWPORT 0x0BA2 #define GL_SCISSOR_BOX 0x0C10 -/* GL_SCISSOR_TEST */ #define GL_COLOR_CLEAR_VALUE 0x0C22 #define GL_COLOR_WRITEMASK 0x0C23 #define GL_UNPACK_ALIGNMENT 0x0CF5 @@ -206,32 +168,18 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_DEPTH_BITS 0x0D56 #define GL_STENCIL_BITS 0x0D57 #define GL_POLYGON_OFFSET_UNITS 0x2A00 -/* GL_POLYGON_OFFSET_FILL */ #define GL_POLYGON_OFFSET_FACTOR 0x8038 #define GL_TEXTURE_BINDING_2D 0x8069 #define GL_SAMPLE_BUFFERS 0x80A8 #define GL_SAMPLES 0x80A9 #define GL_SAMPLE_COVERAGE_VALUE 0x80AA #define GL_SAMPLE_COVERAGE_INVERT 0x80AB - -/* GetTextureParameter */ -/* GL_TEXTURE_MAG_FILTER */ -/* GL_TEXTURE_MIN_FILTER */ -/* GL_TEXTURE_WRAP_S */ -/* GL_TEXTURE_WRAP_T */ - #define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2 #define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3 - -/* HintMode */ #define GL_DONT_CARE 0x1100 #define GL_FASTEST 0x1101 #define GL_NICEST 0x1102 - -/* HintTarget */ -#define GL_GENERATE_MIPMAP_HINT 0x8192 - -/* DataType */ +#define GL_GENERATE_MIPMAP_HINT 0x8192 #define GL_BYTE 0x1400 #define GL_UNSIGNED_BYTE 0x1401 #define GL_SHORT 0x1402 @@ -240,44 +188,35 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_UNSIGNED_INT 0x1405 #define GL_FLOAT 0x1406 #define GL_FIXED 0x140C - -/* PixelFormat */ #define GL_DEPTH_COMPONENT 0x1902 #define GL_ALPHA 0x1906 #define GL_RGB 0x1907 #define GL_RGBA 0x1908 #define GL_LUMINANCE 0x1909 #define GL_LUMINANCE_ALPHA 0x190A - -/* PixelType */ -/* GL_UNSIGNED_BYTE */ #define GL_UNSIGNED_SHORT_4_4_4_4 0x8033 #define GL_UNSIGNED_SHORT_5_5_5_1 0x8034 #define GL_UNSIGNED_SHORT_5_6_5 0x8363 - -/* Shaders */ -#define GL_FRAGMENT_SHADER 0x8B30 -#define GL_VERTEX_SHADER 0x8B31 -#define GL_MAX_VERTEX_ATTRIBS 0x8869 -#define GL_MAX_VERTEX_UNIFORM_VECTORS 0x8DFB -#define GL_MAX_VARYING_VECTORS 0x8DFC +#define GL_FRAGMENT_SHADER 0x8B30 +#define GL_VERTEX_SHADER 0x8B31 +#define GL_MAX_VERTEX_ATTRIBS 0x8869 +#define GL_MAX_VERTEX_UNIFORM_VECTORS 0x8DFB +#define GL_MAX_VARYING_VECTORS 0x8DFC #define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D -#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C -#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 -#define GL_MAX_FRAGMENT_UNIFORM_VECTORS 0x8DFD -#define GL_SHADER_TYPE 0x8B4F -#define GL_DELETE_STATUS 0x8B80 -#define GL_LINK_STATUS 0x8B82 -#define GL_VALIDATE_STATUS 0x8B83 -#define GL_ATTACHED_SHADERS 0x8B85 -#define GL_ACTIVE_UNIFORMS 0x8B86 -#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 -#define GL_ACTIVE_ATTRIBUTES 0x8B89 -#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A -#define GL_SHADING_LANGUAGE_VERSION 0x8B8C -#define GL_CURRENT_PROGRAM 0x8B8D - -/* StencilFunction */ +#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C +#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 +#define GL_MAX_FRAGMENT_UNIFORM_VECTORS 0x8DFD +#define GL_SHADER_TYPE 0x8B4F +#define GL_DELETE_STATUS 0x8B80 +#define GL_LINK_STATUS 0x8B82 +#define GL_VALIDATE_STATUS 0x8B83 +#define GL_ATTACHED_SHADERS 0x8B85 +#define GL_ACTIVE_UNIFORMS 0x8B86 +#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 +#define GL_ACTIVE_ATTRIBUTES 0x8B89 +#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A +#define GL_SHADING_LANGUAGE_VERSION 0x8B8C +#define GL_CURRENT_PROGRAM 0x8B8D #define GL_NEVER 0x0200 #define GL_LESS 0x0201 #define GL_EQUAL 0x0202 @@ -286,9 +225,6 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_NOTEQUAL 0x0205 #define GL_GEQUAL 0x0206 #define GL_ALWAYS 0x0207 - -/* StencilOp */ -/* GL_ZERO */ #define GL_KEEP 0x1E00 #define GL_REPLACE 0x1E01 #define GL_INCR 0x1E02 @@ -296,35 +232,21 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_INVERT 0x150A #define GL_INCR_WRAP 0x8507 #define GL_DECR_WRAP 0x8508 - -/* StringName */ #define GL_VENDOR 0x1F00 #define GL_RENDERER 0x1F01 #define GL_VERSION 0x1F02 #define GL_EXTENSIONS 0x1F03 - -/* TextureMagFilter */ #define GL_NEAREST 0x2600 #define GL_LINEAR 0x2601 - -/* TextureMinFilter */ -/* GL_NEAREST */ -/* GL_LINEAR */ #define GL_NEAREST_MIPMAP_NEAREST 0x2700 #define GL_LINEAR_MIPMAP_NEAREST 0x2701 #define GL_NEAREST_MIPMAP_LINEAR 0x2702 #define GL_LINEAR_MIPMAP_LINEAR 0x2703 - -/* TextureParameterName */ #define GL_TEXTURE_MAG_FILTER 0x2800 #define GL_TEXTURE_MIN_FILTER 0x2801 #define GL_TEXTURE_WRAP_S 0x2802 #define GL_TEXTURE_WRAP_T 0x2803 - -/* TextureTarget */ -/* GL_TEXTURE_2D */ #define GL_TEXTURE 0x1702 - #define GL_TEXTURE_CUBE_MAP 0x8513 #define GL_TEXTURE_BINDING_CUBE_MAP 0x8514 #define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515 @@ -334,8 +256,6 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A #define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C - -/* TextureUnit */ #define GL_TEXTURE0 0x84C0 #define GL_TEXTURE1 0x84C1 #define GL_TEXTURE2 0x84C2 @@ -369,13 +289,9 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_TEXTURE30 0x84DE #define GL_TEXTURE31 0x84DF #define GL_ACTIVE_TEXTURE 0x84E0 - -/* TextureWrapMode */ #define GL_REPEAT 0x2901 #define GL_CLAMP_TO_EDGE 0x812F #define GL_MIRRORED_REPEAT 0x8370 - -/* Uniform Types */ #define GL_FLOAT_VEC2 0x8B50 #define GL_FLOAT_VEC3 0x8B51 #define GL_FLOAT_VEC4 0x8B52 @@ -391,48 +307,34 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_FLOAT_MAT4 0x8B5C #define GL_SAMPLER_2D 0x8B5E #define GL_SAMPLER_CUBE 0x8B60 - -/* Vertex Arrays */ -#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 -#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 -#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 -#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 -#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A -#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 +#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 +#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 +#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 +#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 +#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A +#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 #define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F - -/* Read Format */ -#define GL_IMPLEMENTATION_COLOR_READ_TYPE 0x8B9A +#define GL_IMPLEMENTATION_COLOR_READ_TYPE 0x8B9A #define GL_IMPLEMENTATION_COLOR_READ_FORMAT 0x8B9B - -/* Shader Source */ #define GL_COMPILE_STATUS 0x8B81 #define GL_INFO_LOG_LENGTH 0x8B84 #define GL_SHADER_SOURCE_LENGTH 0x8B88 #define GL_SHADER_COMPILER 0x8DFA - -/* Shader Binary */ #define GL_SHADER_BINARY_FORMATS 0x8DF8 #define GL_NUM_SHADER_BINARY_FORMATS 0x8DF9 - -/* Shader Precision-Specified Types */ #define GL_LOW_FLOAT 0x8DF0 #define GL_MEDIUM_FLOAT 0x8DF1 #define GL_HIGH_FLOAT 0x8DF2 #define GL_LOW_INT 0x8DF3 #define GL_MEDIUM_INT 0x8DF4 #define GL_HIGH_INT 0x8DF5 - -/* Framebuffer Object. */ #define GL_FRAMEBUFFER 0x8D40 #define GL_RENDERBUFFER 0x8D41 - #define GL_RGBA4 0x8056 #define GL_RGB5_A1 0x8057 #define GL_RGB565 0x8D62 #define GL_DEPTH_COMPONENT16 0x81A5 #define GL_STENCIL_INDEX8 0x8D48 - #define GL_RENDERBUFFER_WIDTH 0x8D42 #define GL_RENDERBUFFER_HEIGHT 0x8D43 #define GL_RENDERBUFFER_INTERNAL_FORMAT 0x8D44 @@ -442,180 +344,313 @@ typedef khronos_ssize_t GLsizeiptr; #define GL_RENDERBUFFER_ALPHA_SIZE 0x8D53 #define GL_RENDERBUFFER_DEPTH_SIZE 0x8D54 #define GL_RENDERBUFFER_STENCIL_SIZE 0x8D55 - -#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE 0x8CD0 -#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME 0x8CD1 -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL 0x8CD2 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE 0x8CD0 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME 0x8CD1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL 0x8CD2 #define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE 0x8CD3 - #define GL_COLOR_ATTACHMENT0 0x8CE0 #define GL_DEPTH_ATTACHMENT 0x8D00 #define GL_STENCIL_ATTACHMENT 0x8D20 - #define GL_NONE 0 - -#define GL_FRAMEBUFFER_COMPLETE 0x8CD5 -#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT 0x8CD6 +#define GL_FRAMEBUFFER_COMPLETE 0x8CD5 +#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT 0x8CD6 #define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT 0x8CD7 -#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS 0x8CD9 -#define GL_FRAMEBUFFER_UNSUPPORTED 0x8CDD - +#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS 0x8CD9 +#define GL_FRAMEBUFFER_UNSUPPORTED 0x8CDD #define GL_FRAMEBUFFER_BINDING 0x8CA6 #define GL_RENDERBUFFER_BINDING 0x8CA7 #define GL_MAX_RENDERBUFFER_SIZE 0x84E8 - #define GL_INVALID_FRAMEBUFFER_OPERATION 0x0506 - -/*------------------------------------------------------------------------- - * GL core functions. - *-----------------------------------------------------------------------*/ - -GL_APICALL void GL_APIENTRY glActiveTexture (GLenum texture); -GL_APICALL void GL_APIENTRY glAttachShader (GLuint program, GLuint shader); -GL_APICALL void GL_APIENTRY glBindAttribLocation (GLuint program, GLuint index, const GLchar* name); -GL_APICALL void GL_APIENTRY glBindBuffer (GLenum target, GLuint buffer); -GL_APICALL void GL_APIENTRY glBindFramebuffer (GLenum target, GLuint framebuffer); -GL_APICALL void GL_APIENTRY glBindRenderbuffer (GLenum target, GLuint renderbuffer); -GL_APICALL void GL_APIENTRY glBindTexture (GLenum target, GLuint texture); -GL_APICALL void GL_APIENTRY glBlendColor (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); -GL_APICALL void GL_APIENTRY glBlendEquation ( GLenum mode ); -GL_APICALL void GL_APIENTRY glBlendEquationSeparate (GLenum modeRGB, GLenum modeAlpha); -GL_APICALL void GL_APIENTRY glBlendFunc (GLenum sfactor, GLenum dfactor); -GL_APICALL void GL_APIENTRY glBlendFuncSeparate (GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); -GL_APICALL void GL_APIENTRY glBufferData (GLenum target, GLsizeiptr size, const GLvoid* data, GLenum usage); -GL_APICALL void GL_APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid* data); -GL_APICALL GLenum GL_APIENTRY glCheckFramebufferStatus (GLenum target); -GL_APICALL void GL_APIENTRY glClear (GLbitfield mask); -GL_APICALL void GL_APIENTRY glClearColor (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); -GL_APICALL void GL_APIENTRY glClearDepthf (GLclampf depth); -GL_APICALL void GL_APIENTRY glClearStencil (GLint s); -GL_APICALL void GL_APIENTRY glColorMask (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); -GL_APICALL void GL_APIENTRY glCompileShader (GLuint shader); -GL_APICALL void GL_APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid* data); -GL_APICALL void GL_APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid* data); -GL_APICALL void GL_APIENTRY glCopyTexImage2D (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); -GL_APICALL void GL_APIENTRY glCopyTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -GL_APICALL GLuint GL_APIENTRY glCreateProgram (void); -GL_APICALL GLuint GL_APIENTRY glCreateShader (GLenum type); -GL_APICALL void GL_APIENTRY glCullFace (GLenum mode); -GL_APICALL void GL_APIENTRY glDeleteBuffers (GLsizei n, const GLuint* buffers); -GL_APICALL void GL_APIENTRY glDeleteFramebuffers (GLsizei n, const GLuint* framebuffers); -GL_APICALL void GL_APIENTRY glDeleteProgram (GLuint program); -GL_APICALL void GL_APIENTRY glDeleteRenderbuffers (GLsizei n, const GLuint* renderbuffers); -GL_APICALL void GL_APIENTRY glDeleteShader (GLuint shader); -GL_APICALL void GL_APIENTRY glDeleteTextures (GLsizei n, const GLuint* textures); -GL_APICALL void GL_APIENTRY glDepthFunc (GLenum func); -GL_APICALL void GL_APIENTRY glDepthMask (GLboolean flag); -GL_APICALL void GL_APIENTRY glDepthRangef (GLclampf zNear, GLclampf zFar); -GL_APICALL void GL_APIENTRY glDetachShader (GLuint program, GLuint shader); -GL_APICALL void GL_APIENTRY glDisable (GLenum cap); -GL_APICALL void GL_APIENTRY glDisableVertexAttribArray (GLuint index); -GL_APICALL void GL_APIENTRY glDrawArrays (GLenum mode, GLint first, GLsizei count); -GL_APICALL void GL_APIENTRY glDrawElements (GLenum mode, GLsizei count, GLenum type, const GLvoid* indices); -GL_APICALL void GL_APIENTRY glEnable (GLenum cap); -GL_APICALL void GL_APIENTRY glEnableVertexAttribArray (GLuint index); -GL_APICALL void GL_APIENTRY glFinish (void); -GL_APICALL void GL_APIENTRY glFlush (void); -GL_APICALL void GL_APIENTRY glFramebufferRenderbuffer (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); -GL_APICALL void GL_APIENTRY glFramebufferTexture2D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); -GL_APICALL void GL_APIENTRY glFrontFace (GLenum mode); -GL_APICALL void GL_APIENTRY glGenBuffers (GLsizei n, GLuint* buffers); -GL_APICALL void GL_APIENTRY glGenerateMipmap (GLenum target); -GL_APICALL void GL_APIENTRY glGenFramebuffers (GLsizei n, GLuint* framebuffers); -GL_APICALL void GL_APIENTRY glGenRenderbuffers (GLsizei n, GLuint* renderbuffers); -GL_APICALL void GL_APIENTRY glGenTextures (GLsizei n, GLuint* textures); -GL_APICALL void GL_APIENTRY glGetActiveAttrib (GLuint program, GLuint index, GLsizei bufsize, GLsizei* length, GLint* size, GLenum* type, GLchar* name); -GL_APICALL void GL_APIENTRY glGetActiveUniform (GLuint program, GLuint index, GLsizei bufsize, GLsizei* length, GLint* size, GLenum* type, GLchar* name); -GL_APICALL void GL_APIENTRY glGetAttachedShaders (GLuint program, GLsizei maxcount, GLsizei* count, GLuint* shaders); -GL_APICALL GLint GL_APIENTRY glGetAttribLocation (GLuint program, const GLchar* name); -GL_APICALL void GL_APIENTRY glGetBooleanv (GLenum pname, GLboolean* params); -GL_APICALL void GL_APIENTRY glGetBufferParameteriv (GLenum target, GLenum pname, GLint* params); -GL_APICALL GLenum GL_APIENTRY glGetError (void); -GL_APICALL void GL_APIENTRY glGetFloatv (GLenum pname, GLfloat* params); -GL_APICALL void GL_APIENTRY glGetFramebufferAttachmentParameteriv (GLenum target, GLenum attachment, GLenum pname, GLint* params); -GL_APICALL void GL_APIENTRY glGetIntegerv (GLenum pname, GLint* params); -GL_APICALL void GL_APIENTRY glGetProgramiv (GLuint program, GLenum pname, GLint* params); -GL_APICALL void GL_APIENTRY glGetProgramInfoLog (GLuint program, GLsizei bufsize, GLsizei* length, GLchar* infolog); -GL_APICALL void GL_APIENTRY glGetRenderbufferParameteriv (GLenum target, GLenum pname, GLint* params); -GL_APICALL void GL_APIENTRY glGetShaderiv (GLuint shader, GLenum pname, GLint* params); -GL_APICALL void GL_APIENTRY glGetShaderInfoLog (GLuint shader, GLsizei bufsize, GLsizei* length, GLchar* infolog); -GL_APICALL void GL_APIENTRY glGetShaderPrecisionFormat (GLenum shadertype, GLenum precisiontype, GLint* range, GLint* precision); -GL_APICALL void GL_APIENTRY glGetShaderSource (GLuint shader, GLsizei bufsize, GLsizei* length, GLchar* source); -GL_APICALL const GLubyte* GL_APIENTRY glGetString (GLenum name); -GL_APICALL void GL_APIENTRY glGetTexParameterfv (GLenum target, GLenum pname, GLfloat* params); -GL_APICALL void GL_APIENTRY glGetTexParameteriv (GLenum target, GLenum pname, GLint* params); -GL_APICALL void GL_APIENTRY glGetUniformfv (GLuint program, GLint location, GLfloat* params); -GL_APICALL void GL_APIENTRY glGetUniformiv (GLuint program, GLint location, GLint* params); -GL_APICALL GLint GL_APIENTRY glGetUniformLocation (GLuint program, const GLchar* name); -GL_APICALL void GL_APIENTRY glGetVertexAttribfv (GLuint index, GLenum pname, GLfloat* params); -GL_APICALL void GL_APIENTRY glGetVertexAttribiv (GLuint index, GLenum pname, GLint* params); -GL_APICALL void GL_APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, GLvoid** pointer); -GL_APICALL void GL_APIENTRY glHint (GLenum target, GLenum mode); -GL_APICALL GLboolean GL_APIENTRY glIsBuffer (GLuint buffer); -GL_APICALL GLboolean GL_APIENTRY glIsEnabled (GLenum cap); -GL_APICALL GLboolean GL_APIENTRY glIsFramebuffer (GLuint framebuffer); -GL_APICALL GLboolean GL_APIENTRY glIsProgram (GLuint program); -GL_APICALL GLboolean GL_APIENTRY glIsRenderbuffer (GLuint renderbuffer); -GL_APICALL GLboolean GL_APIENTRY glIsShader (GLuint shader); -GL_APICALL GLboolean GL_APIENTRY glIsTexture (GLuint texture); -GL_APICALL void GL_APIENTRY glLineWidth (GLfloat width); -GL_APICALL void GL_APIENTRY glLinkProgram (GLuint program); -GL_APICALL void GL_APIENTRY glPixelStorei (GLenum pname, GLint param); -GL_APICALL void GL_APIENTRY glPolygonOffset (GLfloat factor, GLfloat units); -GL_APICALL void GL_APIENTRY glReadPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLvoid* pixels); -GL_APICALL void GL_APIENTRY glReleaseShaderCompiler (void); -GL_APICALL void GL_APIENTRY glRenderbufferStorage (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); -GL_APICALL void GL_APIENTRY glSampleCoverage (GLclampf value, GLboolean invert); -GL_APICALL void GL_APIENTRY glScissor (GLint x, GLint y, GLsizei width, GLsizei height); -GL_APICALL void GL_APIENTRY glShaderBinary (GLsizei n, const GLuint* shaders, GLenum binaryformat, const GLvoid* binary, GLsizei length); -GL_APICALL void GL_APIENTRY glShaderSource (GLuint shader, GLsizei count, const GLchar* const* string, const GLint* length); -GL_APICALL void GL_APIENTRY glStencilFunc (GLenum func, GLint ref, GLuint mask); -GL_APICALL void GL_APIENTRY glStencilFuncSeparate (GLenum face, GLenum func, GLint ref, GLuint mask); -GL_APICALL void GL_APIENTRY glStencilMask (GLuint mask); -GL_APICALL void GL_APIENTRY glStencilMaskSeparate (GLenum face, GLuint mask); -GL_APICALL void GL_APIENTRY glStencilOp (GLenum fail, GLenum zfail, GLenum zpass); -GL_APICALL void GL_APIENTRY glStencilOpSeparate (GLenum face, GLenum fail, GLenum zfail, GLenum zpass); -GL_APICALL void GL_APIENTRY glTexImage2D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid* pixels); -GL_APICALL void GL_APIENTRY glTexParameterf (GLenum target, GLenum pname, GLfloat param); -GL_APICALL void GL_APIENTRY glTexParameterfv (GLenum target, GLenum pname, const GLfloat* params); -GL_APICALL void GL_APIENTRY glTexParameteri (GLenum target, GLenum pname, GLint param); -GL_APICALL void GL_APIENTRY glTexParameteriv (GLenum target, GLenum pname, const GLint* params); -GL_APICALL void GL_APIENTRY glTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid* pixels); -GL_APICALL void GL_APIENTRY glUniform1f (GLint location, GLfloat x); -GL_APICALL void GL_APIENTRY glUniform1fv (GLint location, GLsizei count, const GLfloat* v); -GL_APICALL void GL_APIENTRY glUniform1i (GLint location, GLint x); -GL_APICALL void GL_APIENTRY glUniform1iv (GLint location, GLsizei count, const GLint* v); -GL_APICALL void GL_APIENTRY glUniform2f (GLint location, GLfloat x, GLfloat y); -GL_APICALL void GL_APIENTRY glUniform2fv (GLint location, GLsizei count, const GLfloat* v); -GL_APICALL void GL_APIENTRY glUniform2i (GLint location, GLint x, GLint y); -GL_APICALL void GL_APIENTRY glUniform2iv (GLint location, GLsizei count, const GLint* v); -GL_APICALL void GL_APIENTRY glUniform3f (GLint location, GLfloat x, GLfloat y, GLfloat z); -GL_APICALL void GL_APIENTRY glUniform3fv (GLint location, GLsizei count, const GLfloat* v); -GL_APICALL void GL_APIENTRY glUniform3i (GLint location, GLint x, GLint y, GLint z); -GL_APICALL void GL_APIENTRY glUniform3iv (GLint location, GLsizei count, const GLint* v); -GL_APICALL void GL_APIENTRY glUniform4f (GLint location, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -GL_APICALL void GL_APIENTRY glUniform4fv (GLint location, GLsizei count, const GLfloat* v); -GL_APICALL void GL_APIENTRY glUniform4i (GLint location, GLint x, GLint y, GLint z, GLint w); -GL_APICALL void GL_APIENTRY glUniform4iv (GLint location, GLsizei count, const GLint* v); -GL_APICALL void GL_APIENTRY glUniformMatrix2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); -GL_APICALL void GL_APIENTRY glUniformMatrix3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); -GL_APICALL void GL_APIENTRY glUniformMatrix4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); -GL_APICALL void GL_APIENTRY glUseProgram (GLuint program); -GL_APICALL void GL_APIENTRY glValidateProgram (GLuint program); -GL_APICALL void GL_APIENTRY glVertexAttrib1f (GLuint indx, GLfloat x); -GL_APICALL void GL_APIENTRY glVertexAttrib1fv (GLuint indx, const GLfloat* values); -GL_APICALL void GL_APIENTRY glVertexAttrib2f (GLuint indx, GLfloat x, GLfloat y); -GL_APICALL void GL_APIENTRY glVertexAttrib2fv (GLuint indx, const GLfloat* values); -GL_APICALL void GL_APIENTRY glVertexAttrib3f (GLuint indx, GLfloat x, GLfloat y, GLfloat z); -GL_APICALL void GL_APIENTRY glVertexAttrib3fv (GLuint indx, const GLfloat* values); -GL_APICALL void GL_APIENTRY glVertexAttrib4f (GLuint indx, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -GL_APICALL void GL_APIENTRY glVertexAttrib4fv (GLuint indx, const GLfloat* values); -GL_APICALL void GL_APIENTRY glVertexAttribPointer (GLuint indx, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid* ptr); -GL_APICALL void GL_APIENTRY glViewport (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); +typedef void (GL_APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (GL_APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name); +typedef void (GL_APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); +typedef void (GL_APIENTRYP PFNGLBINDFRAMEBUFFERPROC) (GLenum target, GLuint framebuffer); +typedef void (GL_APIENTRYP PFNGLBINDRENDERBUFFERPROC) (GLenum target, GLuint renderbuffer); +typedef void (GL_APIENTRYP PFNGLBINDTEXTUREPROC) (GLenum target, GLuint texture); +typedef void (GL_APIENTRYP PFNGLBLENDCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha); +typedef void (GL_APIENTRYP PFNGLBLENDFUNCPROC) (GLenum sfactor, GLenum dfactor); +typedef void (GL_APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +typedef void (GL_APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +typedef void (GL_APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +typedef GLenum (GL_APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSPROC) (GLenum target); +typedef void (GL_APIENTRYP PFNGLCLEARPROC) (GLbitfield mask); +typedef void (GL_APIENTRYP PFNGLCLEARCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +typedef void (GL_APIENTRYP PFNGLCLEARDEPTHFPROC) (GLfloat d); +typedef void (GL_APIENTRYP PFNGLCLEARSTENCILPROC) (GLint s); +typedef void (GL_APIENTRYP PFNGLCOLORMASKPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +typedef void (GL_APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader); +typedef void (GL_APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +typedef void (GL_APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (GL_APIENTRYP PFNGLCOPYTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (GL_APIENTRYP PFNGLCOPYTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef GLuint (GL_APIENTRYP PFNGLCREATEPROGRAMPROC) (void); +typedef GLuint (GL_APIENTRYP PFNGLCREATESHADERPROC) (GLenum type); +typedef void (GL_APIENTRYP PFNGLCULLFACEPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); +typedef void (GL_APIENTRYP PFNGLDELETEFRAMEBUFFERSPROC) (GLsizei n, const GLuint *framebuffers); +typedef void (GL_APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program); +typedef void (GL_APIENTRYP PFNGLDELETERENDERBUFFERSPROC) (GLsizei n, const GLuint *renderbuffers); +typedef void (GL_APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader); +typedef void (GL_APIENTRYP PFNGLDELETETEXTURESPROC) (GLsizei n, const GLuint *textures); +typedef void (GL_APIENTRYP PFNGLDEPTHFUNCPROC) (GLenum func); +typedef void (GL_APIENTRYP PFNGLDEPTHMASKPROC) (GLboolean flag); +typedef void (GL_APIENTRYP PFNGLDEPTHRANGEFPROC) (GLfloat n, GLfloat f); +typedef void (GL_APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (GL_APIENTRYP PFNGLDISABLEPROC) (GLenum cap); +typedef void (GL_APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (GL_APIENTRYP PFNGLDRAWARRAYSPROC) (GLenum mode, GLint first, GLsizei count); +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices); +typedef void (GL_APIENTRYP PFNGLENABLEPROC) (GLenum cap); +typedef void (GL_APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (GL_APIENTRYP PFNGLFINISHPROC) (void); +typedef void (GL_APIENTRYP PFNGLFLUSHPROC) (void); +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFERPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (GL_APIENTRYP PFNGLFRONTFACEPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef void (GL_APIENTRYP PFNGLGENERATEMIPMAPPROC) (GLenum target); +typedef void (GL_APIENTRYP PFNGLGENFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers); +typedef void (GL_APIENTRYP PFNGLGENRENDERBUFFERSPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (GL_APIENTRYP PFNGLGENTEXTURESPROC) (GLsizei n, GLuint *textures); +typedef void (GL_APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (GL_APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (GL_APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *shaders); +typedef GLint (GL_APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (GL_APIENTRYP PFNGLGETBOOLEANVPROC) (GLenum pname, GLboolean *data); +typedef void (GL_APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef GLenum (GL_APIENTRYP PFNGLGETERRORPROC) (void); +typedef void (GL_APIENTRYP PFNGLGETFLOATVPROC) (GLenum pname, GLfloat *data); +typedef void (GL_APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETINTEGERVPROC) (GLenum pname, GLint *data); +typedef void (GL_APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (GL_APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (GL_APIENTRYP PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); +typedef void (GL_APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +typedef const GLubyte *(GL_APIENTRYP PFNGLGETSTRINGPROC) (GLenum name); +typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params); +typedef void (GL_APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params); +typedef GLint (GL_APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (GL_APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (GL_APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, void **pointer); +typedef void (GL_APIENTRYP PFNGLHINTPROC) (GLenum target, GLenum mode); +typedef GLboolean (GL_APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); +typedef GLboolean (GL_APIENTRYP PFNGLISENABLEDPROC) (GLenum cap); +typedef GLboolean (GL_APIENTRYP PFNGLISFRAMEBUFFERPROC) (GLuint framebuffer); +typedef GLboolean (GL_APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); +typedef GLboolean (GL_APIENTRYP PFNGLISRENDERBUFFERPROC) (GLuint renderbuffer); +typedef GLboolean (GL_APIENTRYP PFNGLISSHADERPROC) (GLuint shader); +typedef GLboolean (GL_APIENTRYP PFNGLISTEXTUREPROC) (GLuint texture); +typedef void (GL_APIENTRYP PFNGLLINEWIDTHPROC) (GLfloat width); +typedef void (GL_APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); +typedef void (GL_APIENTRYP PFNGLPIXELSTOREIPROC) (GLenum pname, GLint param); +typedef void (GL_APIENTRYP PFNGLPOLYGONOFFSETPROC) (GLfloat factor, GLfloat units); +typedef void (GL_APIENTRYP PFNGLREADPIXELSPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, void *pixels); +typedef void (GL_APIENTRYP PFNGLRELEASESHADERCOMPILERPROC) (void); +typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLfloat value, GLboolean invert); +typedef void (GL_APIENTRYP PFNGLSCISSORPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryFormat, const void *binary, GLsizei length); +typedef void (GL_APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar *const*string, const GLint *length); +typedef void (GL_APIENTRYP PFNGLSTENCILFUNCPROC) (GLenum func, GLint ref, GLuint mask); +typedef void (GL_APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum face, GLenum func, GLint ref, GLuint mask); +typedef void (GL_APIENTRYP PFNGLSTENCILMASKPROC) (GLuint mask); +typedef void (GL_APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask); +typedef void (GL_APIENTRYP PFNGLSTENCILOPPROC) (GLenum fail, GLenum zfail, GLenum zpass); +typedef void (GL_APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +typedef void (GL_APIENTRYP PFNGLTEXIMAGE2DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (GL_APIENTRYP PFNGLTEXPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (GL_APIENTRYP PFNGLTEXPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIPROC) (GLenum target, GLenum pname, GLint param); +typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (GL_APIENTRYP PFNGLTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (GL_APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0); +typedef void (GL_APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0); +typedef void (GL_APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1); +typedef void (GL_APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1); +typedef void (GL_APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (GL_APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2); +typedef void (GL_APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (GL_APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (GL_APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program); +typedef void (GL_APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); +typedef void (GL_APIENTRYP PFNGLVIEWPORTPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +#if GL_GLES_PROTOTYPES +GL_APICALL void GL_APIENTRY glActiveTexture (GLenum texture); +GL_APICALL void GL_APIENTRY glAttachShader (GLuint program, GLuint shader); +GL_APICALL void GL_APIENTRY glBindAttribLocation (GLuint program, GLuint index, const GLchar *name); +GL_APICALL void GL_APIENTRY glBindBuffer (GLenum target, GLuint buffer); +GL_APICALL void GL_APIENTRY glBindFramebuffer (GLenum target, GLuint framebuffer); +GL_APICALL void GL_APIENTRY glBindRenderbuffer (GLenum target, GLuint renderbuffer); +GL_APICALL void GL_APIENTRY glBindTexture (GLenum target, GLuint texture); +GL_APICALL void GL_APIENTRY glBlendColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +GL_APICALL void GL_APIENTRY glBlendEquation (GLenum mode); +GL_APICALL void GL_APIENTRY glBlendEquationSeparate (GLenum modeRGB, GLenum modeAlpha); +GL_APICALL void GL_APIENTRY glBlendFunc (GLenum sfactor, GLenum dfactor); +GL_APICALL void GL_APIENTRY glBlendFuncSeparate (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +GL_APICALL void GL_APIENTRY glBufferData (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +GL_APICALL void GL_APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +GL_APICALL GLenum GL_APIENTRY glCheckFramebufferStatus (GLenum target); +GL_APICALL void GL_APIENTRY glClear (GLbitfield mask); +GL_APICALL void GL_APIENTRY glClearColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +GL_APICALL void GL_APIENTRY glClearDepthf (GLfloat d); +GL_APICALL void GL_APIENTRY glClearStencil (GLint s); +GL_APICALL void GL_APIENTRY glColorMask (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +GL_APICALL void GL_APIENTRY glCompileShader (GLuint shader); +GL_APICALL void GL_APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +GL_APICALL void GL_APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GL_APICALL void GL_APIENTRY glCopyTexImage2D (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GL_APICALL void GL_APIENTRY glCopyTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GL_APICALL GLuint GL_APIENTRY glCreateProgram (void); +GL_APICALL GLuint GL_APIENTRY glCreateShader (GLenum type); +GL_APICALL void GL_APIENTRY glCullFace (GLenum mode); +GL_APICALL void GL_APIENTRY glDeleteBuffers (GLsizei n, const GLuint *buffers); +GL_APICALL void GL_APIENTRY glDeleteFramebuffers (GLsizei n, const GLuint *framebuffers); +GL_APICALL void GL_APIENTRY glDeleteProgram (GLuint program); +GL_APICALL void GL_APIENTRY glDeleteRenderbuffers (GLsizei n, const GLuint *renderbuffers); +GL_APICALL void GL_APIENTRY glDeleteShader (GLuint shader); +GL_APICALL void GL_APIENTRY glDeleteTextures (GLsizei n, const GLuint *textures); +GL_APICALL void GL_APIENTRY glDepthFunc (GLenum func); +GL_APICALL void GL_APIENTRY glDepthMask (GLboolean flag); +GL_APICALL void GL_APIENTRY glDepthRangef (GLfloat n, GLfloat f); +GL_APICALL void GL_APIENTRY glDetachShader (GLuint program, GLuint shader); +GL_APICALL void GL_APIENTRY glDisable (GLenum cap); +GL_APICALL void GL_APIENTRY glDisableVertexAttribArray (GLuint index); +GL_APICALL void GL_APIENTRY glDrawArrays (GLenum mode, GLint first, GLsizei count); +GL_APICALL void GL_APIENTRY glDrawElements (GLenum mode, GLsizei count, GLenum type, const void *indices); +GL_APICALL void GL_APIENTRY glEnable (GLenum cap); +GL_APICALL void GL_APIENTRY glEnableVertexAttribArray (GLuint index); +GL_APICALL void GL_APIENTRY glFinish (void); +GL_APICALL void GL_APIENTRY glFlush (void); +GL_APICALL void GL_APIENTRY glFramebufferRenderbuffer (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GL_APICALL void GL_APIENTRY glFramebufferTexture2D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GL_APICALL void GL_APIENTRY glFrontFace (GLenum mode); +GL_APICALL void GL_APIENTRY glGenBuffers (GLsizei n, GLuint *buffers); +GL_APICALL void GL_APIENTRY glGenerateMipmap (GLenum target); +GL_APICALL void GL_APIENTRY glGenFramebuffers (GLsizei n, GLuint *framebuffers); +GL_APICALL void GL_APIENTRY glGenRenderbuffers (GLsizei n, GLuint *renderbuffers); +GL_APICALL void GL_APIENTRY glGenTextures (GLsizei n, GLuint *textures); +GL_APICALL void GL_APIENTRY glGetActiveAttrib (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +GL_APICALL void GL_APIENTRY glGetActiveUniform (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +GL_APICALL void GL_APIENTRY glGetAttachedShaders (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *shaders); +GL_APICALL GLint GL_APIENTRY glGetAttribLocation (GLuint program, const GLchar *name); +GL_APICALL void GL_APIENTRY glGetBooleanv (GLenum pname, GLboolean *data); +GL_APICALL void GL_APIENTRY glGetBufferParameteriv (GLenum target, GLenum pname, GLint *params); +GL_APICALL GLenum GL_APIENTRY glGetError (void); +GL_APICALL void GL_APIENTRY glGetFloatv (GLenum pname, GLfloat *data); +GL_APICALL void GL_APIENTRY glGetFramebufferAttachmentParameteriv (GLenum target, GLenum attachment, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetIntegerv (GLenum pname, GLint *data); +GL_APICALL void GL_APIENTRY glGetProgramiv (GLuint program, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetProgramInfoLog (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GL_APICALL void GL_APIENTRY glGetRenderbufferParameteriv (GLenum target, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetShaderiv (GLuint shader, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetShaderInfoLog (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GL_APICALL void GL_APIENTRY glGetShaderPrecisionFormat (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); +GL_APICALL void GL_APIENTRY glGetShaderSource (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +GL_APICALL const GLubyte *GL_APIENTRY glGetString (GLenum name); +GL_APICALL void GL_APIENTRY glGetTexParameterfv (GLenum target, GLenum pname, GLfloat *params); +GL_APICALL void GL_APIENTRY glGetTexParameteriv (GLenum target, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetUniformfv (GLuint program, GLint location, GLfloat *params); +GL_APICALL void GL_APIENTRY glGetUniformiv (GLuint program, GLint location, GLint *params); +GL_APICALL GLint GL_APIENTRY glGetUniformLocation (GLuint program, const GLchar *name); +GL_APICALL void GL_APIENTRY glGetVertexAttribfv (GLuint index, GLenum pname, GLfloat *params); +GL_APICALL void GL_APIENTRY glGetVertexAttribiv (GLuint index, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, void **pointer); +GL_APICALL void GL_APIENTRY glHint (GLenum target, GLenum mode); +GL_APICALL GLboolean GL_APIENTRY glIsBuffer (GLuint buffer); +GL_APICALL GLboolean GL_APIENTRY glIsEnabled (GLenum cap); +GL_APICALL GLboolean GL_APIENTRY glIsFramebuffer (GLuint framebuffer); +GL_APICALL GLboolean GL_APIENTRY glIsProgram (GLuint program); +GL_APICALL GLboolean GL_APIENTRY glIsRenderbuffer (GLuint renderbuffer); +GL_APICALL GLboolean GL_APIENTRY glIsShader (GLuint shader); +GL_APICALL GLboolean GL_APIENTRY glIsTexture (GLuint texture); +GL_APICALL void GL_APIENTRY glLineWidth (GLfloat width); +GL_APICALL void GL_APIENTRY glLinkProgram (GLuint program); +GL_APICALL void GL_APIENTRY glPixelStorei (GLenum pname, GLint param); +GL_APICALL void GL_APIENTRY glPolygonOffset (GLfloat factor, GLfloat units); +GL_APICALL void GL_APIENTRY glReadPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, void *pixels); +GL_APICALL void GL_APIENTRY glReleaseShaderCompiler (void); +GL_APICALL void GL_APIENTRY glRenderbufferStorage (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glSampleCoverage (GLfloat value, GLboolean invert); +GL_APICALL void GL_APIENTRY glScissor (GLint x, GLint y, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryFormat, const void *binary, GLsizei length); +GL_APICALL void GL_APIENTRY glShaderSource (GLuint shader, GLsizei count, const GLchar *const*string, const GLint *length); +GL_APICALL void GL_APIENTRY glStencilFunc (GLenum func, GLint ref, GLuint mask); +GL_APICALL void GL_APIENTRY glStencilFuncSeparate (GLenum face, GLenum func, GLint ref, GLuint mask); +GL_APICALL void GL_APIENTRY glStencilMask (GLuint mask); +GL_APICALL void GL_APIENTRY glStencilMaskSeparate (GLenum face, GLuint mask); +GL_APICALL void GL_APIENTRY glStencilOp (GLenum fail, GLenum zfail, GLenum zpass); +GL_APICALL void GL_APIENTRY glStencilOpSeparate (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +GL_APICALL void GL_APIENTRY glTexImage2D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GL_APICALL void GL_APIENTRY glTexParameterf (GLenum target, GLenum pname, GLfloat param); +GL_APICALL void GL_APIENTRY glTexParameterfv (GLenum target, GLenum pname, const GLfloat *params); +GL_APICALL void GL_APIENTRY glTexParameteri (GLenum target, GLenum pname, GLint param); +GL_APICALL void GL_APIENTRY glTexParameteriv (GLenum target, GLenum pname, const GLint *params); +GL_APICALL void GL_APIENTRY glTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GL_APICALL void GL_APIENTRY glUniform1f (GLint location, GLfloat v0); +GL_APICALL void GL_APIENTRY glUniform1fv (GLint location, GLsizei count, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniform1i (GLint location, GLint v0); +GL_APICALL void GL_APIENTRY glUniform1iv (GLint location, GLsizei count, const GLint *value); +GL_APICALL void GL_APIENTRY glUniform2f (GLint location, GLfloat v0, GLfloat v1); +GL_APICALL void GL_APIENTRY glUniform2fv (GLint location, GLsizei count, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniform2i (GLint location, GLint v0, GLint v1); +GL_APICALL void GL_APIENTRY glUniform2iv (GLint location, GLsizei count, const GLint *value); +GL_APICALL void GL_APIENTRY glUniform3f (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GL_APICALL void GL_APIENTRY glUniform3fv (GLint location, GLsizei count, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniform3i (GLint location, GLint v0, GLint v1, GLint v2); +GL_APICALL void GL_APIENTRY glUniform3iv (GLint location, GLsizei count, const GLint *value); +GL_APICALL void GL_APIENTRY glUniform4f (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GL_APICALL void GL_APIENTRY glUniform4fv (GLint location, GLsizei count, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniform4i (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GL_APICALL void GL_APIENTRY glUniform4iv (GLint location, GLsizei count, const GLint *value); +GL_APICALL void GL_APIENTRY glUniformMatrix2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniformMatrix3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniformMatrix4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUseProgram (GLuint program); +GL_APICALL void GL_APIENTRY glValidateProgram (GLuint program); +GL_APICALL void GL_APIENTRY glVertexAttrib1f (GLuint index, GLfloat x); +GL_APICALL void GL_APIENTRY glVertexAttrib1fv (GLuint index, const GLfloat *v); +GL_APICALL void GL_APIENTRY glVertexAttrib2f (GLuint index, GLfloat x, GLfloat y); +GL_APICALL void GL_APIENTRY glVertexAttrib2fv (GLuint index, const GLfloat *v); +GL_APICALL void GL_APIENTRY glVertexAttrib3f (GLuint index, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glVertexAttrib3fv (GLuint index, const GLfloat *v); +GL_APICALL void GL_APIENTRY glVertexAttrib4f (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GL_APICALL void GL_APIENTRY glVertexAttrib4fv (GLuint index, const GLfloat *v); +GL_APICALL void GL_APIENTRY glVertexAttribPointer (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); +GL_APICALL void GL_APIENTRY glViewport (GLint x, GLint y, GLsizei width, GLsizei height); +#endif +#endif /* GL_ES_VERSION_2_0 */ #ifdef __cplusplus } #endif -#endif /* __gl2_h_ */ - +#endif diff --git a/libs/SDL2/include/SDL_opengles2_gl2ext.h b/libs/SDL2/include/SDL_opengles2_gl2ext.h index e8ca8b1..9448ce0 100644 --- a/libs/SDL2/include/SDL_opengles2_gl2ext.h +++ b/libs/SDL2/include/SDL_opengles2_gl2ext.h @@ -1,1395 +1,1013 @@ -#ifndef __gl2ext_h_ -#define __gl2ext_h_ - -/* $Revision: 22801 $ on $Date:: 2013-08-21 03:20:48 -0700 #$ */ +#ifndef __gles2_gl2ext_h_ +#define __gles2_gl2ext_h_ 1 #ifdef __cplusplus extern "C" { #endif /* - * This document is licensed under the SGI Free Software B License Version - * 2.0. For details, see http://oss.sgi.com/projects/FreeB/ . - */ +** Copyright 2013-2020 The Khronos Group Inc. +** SPDX-License-Identifier: MIT +** +** This header is generated from the Khronos OpenGL / OpenGL ES XML +** API Registry. The current version of the Registry, generator scripts +** used to make the header, and the header can be found at +** https://github.com/KhronosGroup/OpenGL-Registry +*/ #ifndef GL_APIENTRYP -# define GL_APIENTRYP GL_APIENTRY* +#define GL_APIENTRYP GL_APIENTRY* #endif -/* New types shared by several extensions */ +/* Generated on date 20220530 */ -#ifndef __gl3_h_ -/* These are defined with respect to in the - * Apple extension spec, but they are also used by non-APPLE - * extensions, and in the Khronos header we use the Khronos - * portable types in khrplatform.h, which must be defined. +/* Generated C header for: + * API: gles2 + * Profile: common + * Versions considered: 2\.[0-9] + * Versions emitted: _nomatch_^ + * Default extensions included: gles2 + * Additional extensions included: _nomatch_^ + * Extensions removed: _nomatch_^ */ -typedef khronos_int64_t GLint64; -typedef khronos_uint64_t GLuint64; -typedef struct __GLsync *GLsync; -#endif - -/*------------------------------------------------------------------------* - * OES extension tokens - *------------------------------------------------------------------------*/ - -/* GL_OES_compressed_ETC1_RGB8_texture */ -#ifndef GL_OES_compressed_ETC1_RGB8_texture -#define GL_ETC1_RGB8_OES 0x8D64 -#endif - -/* GL_OES_compressed_paletted_texture */ -#ifndef GL_OES_compressed_paletted_texture -#define GL_PALETTE4_RGB8_OES 0x8B90 -#define GL_PALETTE4_RGBA8_OES 0x8B91 -#define GL_PALETTE4_R5_G6_B5_OES 0x8B92 -#define GL_PALETTE4_RGBA4_OES 0x8B93 -#define GL_PALETTE4_RGB5_A1_OES 0x8B94 -#define GL_PALETTE8_RGB8_OES 0x8B95 -#define GL_PALETTE8_RGBA8_OES 0x8B96 -#define GL_PALETTE8_R5_G6_B5_OES 0x8B97 -#define GL_PALETTE8_RGBA4_OES 0x8B98 -#define GL_PALETTE8_RGB5_A1_OES 0x8B99 -#endif - -/* GL_OES_depth24 */ -#ifndef GL_OES_depth24 -#define GL_DEPTH_COMPONENT24_OES 0x81A6 -#endif - -/* GL_OES_depth32 */ -#ifndef GL_OES_depth32 -#define GL_DEPTH_COMPONENT32_OES 0x81A7 -#endif - -/* GL_OES_depth_texture */ -/* No new tokens introduced by this extension. */ - -/* GL_OES_EGL_image */ -#ifndef GL_OES_EGL_image -typedef void* GLeglImageOES; -#endif - -/* GL_OES_EGL_image_external */ -#ifndef GL_OES_EGL_image_external -/* GLeglImageOES defined in GL_OES_EGL_image already. */ -#define GL_TEXTURE_EXTERNAL_OES 0x8D65 -#define GL_SAMPLER_EXTERNAL_OES 0x8D66 -#define GL_TEXTURE_BINDING_EXTERNAL_OES 0x8D67 -#define GL_REQUIRED_TEXTURE_IMAGE_UNITS_OES 0x8D68 -#endif - -/* GL_OES_element_index_uint */ -#ifndef GL_OES_element_index_uint -#define GL_UNSIGNED_INT 0x1405 -#endif - -/* GL_OES_get_program_binary */ -#ifndef GL_OES_get_program_binary -#define GL_PROGRAM_BINARY_LENGTH_OES 0x8741 -#define GL_NUM_PROGRAM_BINARY_FORMATS_OES 0x87FE -#define GL_PROGRAM_BINARY_FORMATS_OES 0x87FF -#endif - -/* GL_OES_mapbuffer */ -#ifndef GL_OES_mapbuffer -#define GL_WRITE_ONLY_OES 0x88B9 -#define GL_BUFFER_ACCESS_OES 0x88BB -#define GL_BUFFER_MAPPED_OES 0x88BC -#define GL_BUFFER_MAP_POINTER_OES 0x88BD -#endif - -/* GL_OES_packed_depth_stencil */ -#ifndef GL_OES_packed_depth_stencil -#define GL_DEPTH_STENCIL_OES 0x84F9 -#define GL_UNSIGNED_INT_24_8_OES 0x84FA -#define GL_DEPTH24_STENCIL8_OES 0x88F0 -#endif - -/* GL_OES_required_internalformat */ -#ifndef GL_OES_required_internalformat -#define GL_ALPHA8_OES 0x803C -#define GL_DEPTH_COMPONENT16_OES 0x81A5 -/* reuse GL_DEPTH_COMPONENT24_OES */ -/* reuse GL_DEPTH24_STENCIL8_OES */ -/* reuse GL_DEPTH_COMPONENT32_OES */ -#define GL_LUMINANCE4_ALPHA4_OES 0x8043 -#define GL_LUMINANCE8_ALPHA8_OES 0x8045 -#define GL_LUMINANCE8_OES 0x8040 -#define GL_RGBA4_OES 0x8056 -#define GL_RGB5_A1_OES 0x8057 -#define GL_RGB565_OES 0x8D62 -/* reuse GL_RGB8_OES */ -/* reuse GL_RGBA8_OES */ -/* reuse GL_RGB10_EXT */ -/* reuse GL_RGB10_A2_EXT */ -#endif - -/* GL_OES_rgb8_rgba8 */ -#ifndef GL_OES_rgb8_rgba8 -#define GL_RGB8_OES 0x8051 -#define GL_RGBA8_OES 0x8058 -#endif - -/* GL_OES_standard_derivatives */ -#ifndef GL_OES_standard_derivatives -#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_OES 0x8B8B -#endif - -/* GL_OES_stencil1 */ -#ifndef GL_OES_stencil1 -#define GL_STENCIL_INDEX1_OES 0x8D46 -#endif - -/* GL_OES_stencil4 */ -#ifndef GL_OES_stencil4 -#define GL_STENCIL_INDEX4_OES 0x8D47 -#endif - -#ifndef GL_OES_surfaceless_context -#define GL_FRAMEBUFFER_UNDEFINED_OES 0x8219 -#endif - -/* GL_OES_texture_3D */ -#ifndef GL_OES_texture_3D -#define GL_TEXTURE_WRAP_R_OES 0x8072 -#define GL_TEXTURE_3D_OES 0x806F -#define GL_TEXTURE_BINDING_3D_OES 0x806A -#define GL_MAX_3D_TEXTURE_SIZE_OES 0x8073 -#define GL_SAMPLER_3D_OES 0x8B5F -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_OES 0x8CD4 -#endif - -/* GL_OES_texture_float */ -/* No new tokens introduced by this extension. */ - -/* GL_OES_texture_float_linear */ -/* No new tokens introduced by this extension. */ - -/* GL_OES_texture_half_float */ -#ifndef GL_OES_texture_half_float -#define GL_HALF_FLOAT_OES 0x8D61 -#endif - -/* GL_OES_texture_half_float_linear */ -/* No new tokens introduced by this extension. */ - -/* GL_OES_texture_npot */ -/* No new tokens introduced by this extension. */ - -/* GL_OES_vertex_array_object */ -#ifndef GL_OES_vertex_array_object -#define GL_VERTEX_ARRAY_BINDING_OES 0x85B5 -#endif - -/* GL_OES_vertex_half_float */ -/* GL_HALF_FLOAT_OES defined in GL_OES_texture_half_float already. */ - -/* GL_OES_vertex_type_10_10_10_2 */ -#ifndef GL_OES_vertex_type_10_10_10_2 -#define GL_UNSIGNED_INT_10_10_10_2_OES 0x8DF6 -#define GL_INT_10_10_10_2_OES 0x8DF7 -#endif - -/*------------------------------------------------------------------------* - * KHR extension tokens - *------------------------------------------------------------------------*/ - -#ifndef GL_KHR_debug -typedef void (GL_APIENTRYP GLDEBUGPROCKHR)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam); -#define GL_DEBUG_OUTPUT_SYNCHRONOUS_KHR 0x8242 -#define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH_KHR 0x8243 -#define GL_DEBUG_CALLBACK_FUNCTION_KHR 0x8244 -#define GL_DEBUG_CALLBACK_USER_PARAM_KHR 0x8245 -#define GL_DEBUG_SOURCE_API_KHR 0x8246 -#define GL_DEBUG_SOURCE_WINDOW_SYSTEM_KHR 0x8247 -#define GL_DEBUG_SOURCE_SHADER_COMPILER_KHR 0x8248 -#define GL_DEBUG_SOURCE_THIRD_PARTY_KHR 0x8249 -#define GL_DEBUG_SOURCE_APPLICATION_KHR 0x824A -#define GL_DEBUG_SOURCE_OTHER_KHR 0x824B -#define GL_DEBUG_TYPE_ERROR_KHR 0x824C -#define GL_DEBUG_TYPE_DEPRECATED_BEHAVIOR_KHR 0x824D -#define GL_DEBUG_TYPE_UNDEFINED_BEHAVIOR_KHR 0x824E -#define GL_DEBUG_TYPE_PORTABILITY_KHR 0x824F -#define GL_DEBUG_TYPE_PERFORMANCE_KHR 0x8250 -#define GL_DEBUG_TYPE_OTHER_KHR 0x8251 -#define GL_DEBUG_TYPE_MARKER_KHR 0x8268 -#define GL_DEBUG_TYPE_PUSH_GROUP_KHR 0x8269 -#define GL_DEBUG_TYPE_POP_GROUP_KHR 0x826A -#define GL_DEBUG_SEVERITY_NOTIFICATION_KHR 0x826B -#define GL_MAX_DEBUG_GROUP_STACK_DEPTH_KHR 0x826C -#define GL_DEBUG_GROUP_STACK_DEPTH_KHR 0x826D -#define GL_BUFFER_KHR 0x82E0 -#define GL_SHADER_KHR 0x82E1 -#define GL_PROGRAM_KHR 0x82E2 -#define GL_QUERY_KHR 0x82E3 -/* PROGRAM_PIPELINE only in GL */ -#define GL_SAMPLER_KHR 0x82E6 -/* DISPLAY_LIST only in GL */ -#define GL_MAX_LABEL_LENGTH_KHR 0x82E8 -#define GL_MAX_DEBUG_MESSAGE_LENGTH_KHR 0x9143 -#define GL_MAX_DEBUG_LOGGED_MESSAGES_KHR 0x9144 -#define GL_DEBUG_LOGGED_MESSAGES_KHR 0x9145 -#define GL_DEBUG_SEVERITY_HIGH_KHR 0x9146 -#define GL_DEBUG_SEVERITY_MEDIUM_KHR 0x9147 -#define GL_DEBUG_SEVERITY_LOW_KHR 0x9148 -#define GL_DEBUG_OUTPUT_KHR 0x92E0 -#define GL_CONTEXT_FLAG_DEBUG_BIT_KHR 0x00000002 -#define GL_STACK_OVERFLOW_KHR 0x0503 -#define GL_STACK_UNDERFLOW_KHR 0x0504 -#endif - -#ifndef GL_KHR_texture_compression_astc_ldr -#define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0 -#define GL_COMPRESSED_RGBA_ASTC_5x4_KHR 0x93B1 -#define GL_COMPRESSED_RGBA_ASTC_5x5_KHR 0x93B2 -#define GL_COMPRESSED_RGBA_ASTC_6x5_KHR 0x93B3 -#define GL_COMPRESSED_RGBA_ASTC_6x6_KHR 0x93B4 -#define GL_COMPRESSED_RGBA_ASTC_8x5_KHR 0x93B5 -#define GL_COMPRESSED_RGBA_ASTC_8x6_KHR 0x93B6 -#define GL_COMPRESSED_RGBA_ASTC_8x8_KHR 0x93B7 -#define GL_COMPRESSED_RGBA_ASTC_10x5_KHR 0x93B8 -#define GL_COMPRESSED_RGBA_ASTC_10x6_KHR 0x93B9 -#define GL_COMPRESSED_RGBA_ASTC_10x8_KHR 0x93BA -#define GL_COMPRESSED_RGBA_ASTC_10x10_KHR 0x93BB -#define GL_COMPRESSED_RGBA_ASTC_12x10_KHR 0x93BC -#define GL_COMPRESSED_RGBA_ASTC_12x12_KHR 0x93BD -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_4x4_KHR 0x93D0 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x4_KHR 0x93D1 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x5_KHR 0x93D2 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x5_KHR 0x93D3 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x6_KHR 0x93D4 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x5_KHR 0x93D5 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x6_KHR 0x93D6 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x8_KHR 0x93D7 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x5_KHR 0x93D8 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x6_KHR 0x93D9 -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x8_KHR 0x93DA -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x10_KHR 0x93DB -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x10_KHR 0x93DC -#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x12_KHR 0x93DD -#endif - -/*------------------------------------------------------------------------* - * AMD extension tokens - *------------------------------------------------------------------------*/ - -/* GL_AMD_compressed_3DC_texture */ -#ifndef GL_AMD_compressed_3DC_texture -#define GL_3DC_X_AMD 0x87F9 -#define GL_3DC_XY_AMD 0x87FA -#endif - -/* GL_AMD_compressed_ATC_texture */ -#ifndef GL_AMD_compressed_ATC_texture -#define GL_ATC_RGB_AMD 0x8C92 -#define GL_ATC_RGBA_EXPLICIT_ALPHA_AMD 0x8C93 -#define GL_ATC_RGBA_INTERPOLATED_ALPHA_AMD 0x87EE -#endif - -/* GL_AMD_performance_monitor */ -#ifndef GL_AMD_performance_monitor -#define GL_COUNTER_TYPE_AMD 0x8BC0 -#define GL_COUNTER_RANGE_AMD 0x8BC1 -#define GL_UNSIGNED_INT64_AMD 0x8BC2 -#define GL_PERCENTAGE_AMD 0x8BC3 -#define GL_PERFMON_RESULT_AVAILABLE_AMD 0x8BC4 -#define GL_PERFMON_RESULT_SIZE_AMD 0x8BC5 -#define GL_PERFMON_RESULT_AMD 0x8BC6 -#endif - -/* GL_AMD_program_binary_Z400 */ -#ifndef GL_AMD_program_binary_Z400 -#define GL_Z400_BINARY_AMD 0x8740 -#endif - -/*------------------------------------------------------------------------* - * ANGLE extension tokens - *------------------------------------------------------------------------*/ - -/* GL_ANGLE_depth_texture */ -#ifndef GL_ANGLE_depth_texture -#define GL_DEPTH_COMPONENT 0x1902 -#define GL_DEPTH_STENCIL_OES 0x84F9 -#define GL_UNSIGNED_SHORT 0x1403 -#define GL_UNSIGNED_INT 0x1405 -#define GL_UNSIGNED_INT_24_8_OES 0x84FA -#define GL_DEPTH_COMPONENT16 0x81A5 -#define GL_DEPTH_COMPONENT32_OES 0x81A7 -#define GL_DEPTH24_STENCIL8_OES 0x88F0 -#endif - -/* GL_ANGLE_framebuffer_blit */ -#ifndef GL_ANGLE_framebuffer_blit -#define GL_READ_FRAMEBUFFER_ANGLE 0x8CA8 -#define GL_DRAW_FRAMEBUFFER_ANGLE 0x8CA9 -#define GL_DRAW_FRAMEBUFFER_BINDING_ANGLE 0x8CA6 -#define GL_READ_FRAMEBUFFER_BINDING_ANGLE 0x8CAA -#endif - -/* GL_ANGLE_framebuffer_multisample */ -#ifndef GL_ANGLE_framebuffer_multisample -#define GL_RENDERBUFFER_SAMPLES_ANGLE 0x8CAB -#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_ANGLE 0x8D56 -#define GL_MAX_SAMPLES_ANGLE 0x8D57 -#endif - -/* GL_ANGLE_instanced_arrays */ -#ifndef GL_ANGLE_instanced_arrays -#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_ANGLE 0x88FE -#endif - -/* GL_ANGLE_pack_reverse_row_order */ -#ifndef GL_ANGLE_pack_reverse_row_order -#define GL_PACK_REVERSE_ROW_ORDER_ANGLE 0x93A4 -#endif - -/* GL_ANGLE_program_binary */ -#ifndef GL_ANGLE_program_binary -#define GL_PROGRAM_BINARY_ANGLE 0x93A6 -#endif - -/* GL_ANGLE_texture_compression_dxt3 */ -#ifndef GL_ANGLE_texture_compression_dxt3 -#define GL_COMPRESSED_RGBA_S3TC_DXT3_ANGLE 0x83F2 -#endif - -/* GL_ANGLE_texture_compression_dxt5 */ -#ifndef GL_ANGLE_texture_compression_dxt5 -#define GL_COMPRESSED_RGBA_S3TC_DXT5_ANGLE 0x83F3 -#endif - -/* GL_ANGLE_texture_usage */ -#ifndef GL_ANGLE_texture_usage -#define GL_TEXTURE_USAGE_ANGLE 0x93A2 -#define GL_FRAMEBUFFER_ATTACHMENT_ANGLE 0x93A3 -#endif - -/* GL_ANGLE_translated_shader_source */ -#ifndef GL_ANGLE_translated_shader_source -#define GL_TRANSLATED_SHADER_SOURCE_LENGTH_ANGLE 0x93A0 -#endif - -/*------------------------------------------------------------------------* - * APPLE extension tokens - *------------------------------------------------------------------------*/ - -/* GL_APPLE_copy_texture_levels */ -/* No new tokens introduced by this extension. */ - -/* GL_APPLE_framebuffer_multisample */ -#ifndef GL_APPLE_framebuffer_multisample -#define GL_RENDERBUFFER_SAMPLES_APPLE 0x8CAB -#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_APPLE 0x8D56 -#define GL_MAX_SAMPLES_APPLE 0x8D57 -#define GL_READ_FRAMEBUFFER_APPLE 0x8CA8 -#define GL_DRAW_FRAMEBUFFER_APPLE 0x8CA9 -#define GL_DRAW_FRAMEBUFFER_BINDING_APPLE 0x8CA6 -#define GL_READ_FRAMEBUFFER_BINDING_APPLE 0x8CAA -#endif - -/* GL_APPLE_rgb_422 */ -#ifndef GL_APPLE_rgb_422 -#define GL_RGB_422_APPLE 0x8A1F -#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA -#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB -#endif - -/* GL_APPLE_sync */ -#ifndef GL_APPLE_sync - -#define GL_SYNC_OBJECT_APPLE 0x8A53 -#define GL_MAX_SERVER_WAIT_TIMEOUT_APPLE 0x9111 -#define GL_OBJECT_TYPE_APPLE 0x9112 -#define GL_SYNC_CONDITION_APPLE 0x9113 -#define GL_SYNC_STATUS_APPLE 0x9114 -#define GL_SYNC_FLAGS_APPLE 0x9115 -#define GL_SYNC_FENCE_APPLE 0x9116 -#define GL_SYNC_GPU_COMMANDS_COMPLETE_APPLE 0x9117 -#define GL_UNSIGNALED_APPLE 0x9118 -#define GL_SIGNALED_APPLE 0x9119 -#define GL_ALREADY_SIGNALED_APPLE 0x911A -#define GL_TIMEOUT_EXPIRED_APPLE 0x911B -#define GL_CONDITION_SATISFIED_APPLE 0x911C -#define GL_WAIT_FAILED_APPLE 0x911D -#define GL_SYNC_FLUSH_COMMANDS_BIT_APPLE 0x00000001 -#define GL_TIMEOUT_IGNORED_APPLE 0xFFFFFFFFFFFFFFFFull -#endif - -/* GL_APPLE_texture_format_BGRA8888 */ -#ifndef GL_APPLE_texture_format_BGRA8888 -#define GL_BGRA_EXT 0x80E1 -#endif - -/* GL_APPLE_texture_max_level */ -#ifndef GL_APPLE_texture_max_level -#define GL_TEXTURE_MAX_LEVEL_APPLE 0x813D -#endif - -/*------------------------------------------------------------------------* - * ARM extension tokens - *------------------------------------------------------------------------*/ - -/* GL_ARM_mali_program_binary */ -#ifndef GL_ARM_mali_program_binary -#define GL_MALI_PROGRAM_BINARY_ARM 0x8F61 -#endif - -/* GL_ARM_mali_shader_binary */ -#ifndef GL_ARM_mali_shader_binary -#define GL_MALI_SHADER_BINARY_ARM 0x8F60 -#endif - -/* GL_ARM_rgba8 */ -/* No new tokens introduced by this extension. */ - -/*------------------------------------------------------------------------* - * EXT extension tokens - *------------------------------------------------------------------------*/ - -/* GL_EXT_blend_minmax */ -#ifndef GL_EXT_blend_minmax -#define GL_MIN_EXT 0x8007 -#define GL_MAX_EXT 0x8008 -#endif - -/* GL_EXT_color_buffer_half_float */ -#ifndef GL_EXT_color_buffer_half_float -#define GL_RGBA16F_EXT 0x881A -#define GL_RGB16F_EXT 0x881B -#define GL_RG16F_EXT 0x822F -#define GL_R16F_EXT 0x822D -#define GL_FRAMEBUFFER_ATTACHMENT_COMPONENT_TYPE_EXT 0x8211 -#define GL_UNSIGNED_NORMALIZED_EXT 0x8C17 -#endif - -/* GL_EXT_debug_label */ -#ifndef GL_EXT_debug_label -#define GL_PROGRAM_PIPELINE_OBJECT_EXT 0x8A4F -#define GL_PROGRAM_OBJECT_EXT 0x8B40 -#define GL_SHADER_OBJECT_EXT 0x8B48 -#define GL_BUFFER_OBJECT_EXT 0x9151 -#define GL_QUERY_OBJECT_EXT 0x9153 -#define GL_VERTEX_ARRAY_OBJECT_EXT 0x9154 -#endif - -/* GL_EXT_debug_marker */ -/* No new tokens introduced by this extension. */ - -/* GL_EXT_discard_framebuffer */ -#ifndef GL_EXT_discard_framebuffer -#define GL_COLOR_EXT 0x1800 -#define GL_DEPTH_EXT 0x1801 -#define GL_STENCIL_EXT 0x1802 -#endif - -#ifndef GL_EXT_disjoint_timer_query -#define GL_QUERY_COUNTER_BITS_EXT 0x8864 -#define GL_CURRENT_QUERY_EXT 0x8865 -#define GL_QUERY_RESULT_EXT 0x8866 -#define GL_QUERY_RESULT_AVAILABLE_EXT 0x8867 -#define GL_TIME_ELAPSED_EXT 0x88BF -#define GL_TIMESTAMP_EXT 0x8E28 -#define GL_GPU_DISJOINT_EXT 0x8FBB -#endif - -#ifndef GL_EXT_draw_buffers -#define GL_EXT_draw_buffers 1 -#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF -#define GL_MAX_DRAW_BUFFERS_EXT 0x8824 -#define GL_DRAW_BUFFER0_EXT 0x8825 -#define GL_DRAW_BUFFER1_EXT 0x8826 -#define GL_DRAW_BUFFER2_EXT 0x8827 -#define GL_DRAW_BUFFER3_EXT 0x8828 -#define GL_DRAW_BUFFER4_EXT 0x8829 -#define GL_DRAW_BUFFER5_EXT 0x882A -#define GL_DRAW_BUFFER6_EXT 0x882B -#define GL_DRAW_BUFFER7_EXT 0x882C -#define GL_DRAW_BUFFER8_EXT 0x882D -#define GL_DRAW_BUFFER9_EXT 0x882E -#define GL_DRAW_BUFFER10_EXT 0x882F -#define GL_DRAW_BUFFER11_EXT 0x8830 -#define GL_DRAW_BUFFER12_EXT 0x8831 -#define GL_DRAW_BUFFER13_EXT 0x8832 -#define GL_DRAW_BUFFER14_EXT 0x8833 -#define GL_DRAW_BUFFER15_EXT 0x8834 -#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 -#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 -#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 -#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 -#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 -#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 -#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 -#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 -#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 -#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 -#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA -#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB -#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC -#define GL_COLOR_ATTACHMENT13_EXT 0x8CED -#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE -#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF -#endif - -/* GL_EXT_map_buffer_range */ -#ifndef GL_EXT_map_buffer_range -#define GL_MAP_READ_BIT_EXT 0x0001 -#define GL_MAP_WRITE_BIT_EXT 0x0002 -#define GL_MAP_INVALIDATE_RANGE_BIT_EXT 0x0004 -#define GL_MAP_INVALIDATE_BUFFER_BIT_EXT 0x0008 -#define GL_MAP_FLUSH_EXPLICIT_BIT_EXT 0x0010 -#define GL_MAP_UNSYNCHRONIZED_BIT_EXT 0x0020 -#endif - -/* GL_EXT_multisampled_render_to_texture */ -#ifndef GL_EXT_multisampled_render_to_texture -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_SAMPLES_EXT 0x8D6C -/* reuse values from GL_EXT_framebuffer_multisample (desktop extension) */ -#define GL_RENDERBUFFER_SAMPLES_EXT 0x8CAB -#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_EXT 0x8D56 -#define GL_MAX_SAMPLES_EXT 0x8D57 -#endif - -/* GL_EXT_multiview_draw_buffers */ -#ifndef GL_EXT_multiview_draw_buffers -#define GL_COLOR_ATTACHMENT_EXT 0x90F0 -#define GL_MULTIVIEW_EXT 0x90F1 -#define GL_DRAW_BUFFER_EXT 0x0C01 -#define GL_READ_BUFFER_EXT 0x0C02 -#define GL_MAX_MULTIVIEW_BUFFERS_EXT 0x90F2 -#endif - -/* GL_EXT_multi_draw_arrays */ -/* No new tokens introduced by this extension. */ - -/* GL_EXT_occlusion_query_boolean */ -#ifndef GL_EXT_occlusion_query_boolean -#define GL_ANY_SAMPLES_PASSED_EXT 0x8C2F -#define GL_ANY_SAMPLES_PASSED_CONSERVATIVE_EXT 0x8D6A -#define GL_CURRENT_QUERY_EXT 0x8865 -#define GL_QUERY_RESULT_EXT 0x8866 -#define GL_QUERY_RESULT_AVAILABLE_EXT 0x8867 -#endif - -/* GL_EXT_read_format_bgra */ -#ifndef GL_EXT_read_format_bgra -#define GL_BGRA_EXT 0x80E1 -#define GL_UNSIGNED_SHORT_4_4_4_4_REV_EXT 0x8365 -#define GL_UNSIGNED_SHORT_1_5_5_5_REV_EXT 0x8366 -#endif - -/* GL_EXT_robustness */ -#ifndef GL_EXT_robustness -/* reuse GL_NO_ERROR */ -#define GL_GUILTY_CONTEXT_RESET_EXT 0x8253 -#define GL_INNOCENT_CONTEXT_RESET_EXT 0x8254 -#define GL_UNKNOWN_CONTEXT_RESET_EXT 0x8255 -#define GL_CONTEXT_ROBUST_ACCESS_EXT 0x90F3 -#define GL_RESET_NOTIFICATION_STRATEGY_EXT 0x8256 -#define GL_LOSE_CONTEXT_ON_RESET_EXT 0x8252 -#define GL_NO_RESET_NOTIFICATION_EXT 0x8261 -#endif - -/* GL_EXT_separate_shader_objects */ -#ifndef GL_EXT_separate_shader_objects -#define GL_VERTEX_SHADER_BIT_EXT 0x00000001 -#define GL_FRAGMENT_SHADER_BIT_EXT 0x00000002 -#define GL_ALL_SHADER_BITS_EXT 0xFFFFFFFF -#define GL_PROGRAM_SEPARABLE_EXT 0x8258 -#define GL_ACTIVE_PROGRAM_EXT 0x8259 -#define GL_PROGRAM_PIPELINE_BINDING_EXT 0x825A -#endif - -/* GL_EXT_shader_framebuffer_fetch */ -#ifndef GL_EXT_shader_framebuffer_fetch -#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 -#endif - -/* GL_EXT_shader_texture_lod */ -/* No new tokens introduced by this extension. */ - -/* GL_EXT_shadow_samplers */ -#ifndef GL_EXT_shadow_samplers -#define GL_TEXTURE_COMPARE_MODE_EXT 0x884C -#define GL_TEXTURE_COMPARE_FUNC_EXT 0x884D -#define GL_COMPARE_REF_TO_TEXTURE_EXT 0x884E -#define GL_SAMPLER_2D_SHADOW_EXT 0x8B62 -#endif - -/* GL_EXT_sRGB */ -#ifndef GL_EXT_sRGB -#define GL_SRGB_EXT 0x8C40 -#define GL_SRGB_ALPHA_EXT 0x8C42 -#define GL_SRGB8_ALPHA8_EXT 0x8C43 -#define GL_FRAMEBUFFER_ATTACHMENT_COLOR_ENCODING_EXT 0x8210 -#endif - -/* GL_EXT_sRGB_write_control */ -#ifndef GL_EXT_sRGB_write_control -#define GL_EXT_sRGB_write_control 1 -#define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 -#endif - -/* GL_EXT_texture_compression_dxt1 */ -#ifndef GL_EXT_texture_compression_dxt1 -#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 -#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 -#endif - -/* GL_EXT_texture_filter_anisotropic */ -#ifndef GL_EXT_texture_filter_anisotropic -#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE -#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF -#endif - -/* GL_EXT_texture_format_BGRA8888 */ -#ifndef GL_EXT_texture_format_BGRA8888 -#define GL_BGRA_EXT 0x80E1 -#endif - -/* GL_EXT_texture_rg */ -#ifndef GL_EXT_texture_rg -#define GL_RED_EXT 0x1903 -#define GL_RG_EXT 0x8227 -#define GL_R8_EXT 0x8229 -#define GL_RG8_EXT 0x822B -#endif - -/* GL_EXT_texture_sRGB_decode */ -#ifndef GL_EXT_texture_sRGB_decode -#define GL_EXT_texture_sRGB_decode 1 -#define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48 -#define GL_DECODE_EXT 0x8A49 -#define GL_SKIP_DECODE_EXT 0x8A4A -#endif - -/* GL_EXT_texture_storage */ -#ifndef GL_EXT_texture_storage -#define GL_TEXTURE_IMMUTABLE_FORMAT_EXT 0x912F -#define GL_ALPHA8_EXT 0x803C -#define GL_LUMINANCE8_EXT 0x8040 -#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 -#define GL_RGBA32F_EXT 0x8814 -#define GL_RGB32F_EXT 0x8815 -#define GL_ALPHA32F_EXT 0x8816 -#define GL_LUMINANCE32F_EXT 0x8818 -#define GL_LUMINANCE_ALPHA32F_EXT 0x8819 -/* reuse GL_RGBA16F_EXT */ -/* reuse GL_RGB16F_EXT */ -#define GL_ALPHA16F_EXT 0x881C -#define GL_LUMINANCE16F_EXT 0x881E -#define GL_LUMINANCE_ALPHA16F_EXT 0x881F -#define GL_RGB10_A2_EXT 0x8059 -#define GL_RGB10_EXT 0x8052 -#define GL_BGRA8_EXT 0x93A1 -#define GL_R8_EXT 0x8229 -#define GL_RG8_EXT 0x822B -#define GL_R32F_EXT 0x822E -#define GL_RG32F_EXT 0x8230 -#define GL_R16F_EXT 0x822D -#define GL_RG16F_EXT 0x822F -#endif - -/* GL_EXT_texture_type_2_10_10_10_REV */ -#ifndef GL_EXT_texture_type_2_10_10_10_REV -#define GL_UNSIGNED_INT_2_10_10_10_REV_EXT 0x8368 -#endif - -/* GL_EXT_unpack_subimage */ -#ifndef GL_EXT_unpack_subimage -#define GL_UNPACK_ROW_LENGTH_EXT 0x0CF2 -#define GL_UNPACK_SKIP_ROWS_EXT 0x0CF3 -#define GL_UNPACK_SKIP_PIXELS_EXT 0x0CF4 -#endif - -/*------------------------------------------------------------------------* - * DMP extension tokens - *------------------------------------------------------------------------*/ - -/* GL_DMP_shader_binary */ -#ifndef GL_DMP_shader_binary -#define GL_SHADER_BINARY_DMP 0x9250 -#endif - -/*------------------------------------------------------------------------* - * FJ extension tokens - *------------------------------------------------------------------------*/ - -/* GL_FJ_shader_binary_GCCSO */ -#ifndef GL_FJ_shader_binary_GCCSO -#define GL_GCCSO_SHADER_BINARY_FJ 0x9260 -#endif - -/*------------------------------------------------------------------------* - * IMG extension tokens - *------------------------------------------------------------------------*/ - -/* GL_IMG_program_binary */ -#ifndef GL_IMG_program_binary -#define GL_SGX_PROGRAM_BINARY_IMG 0x9130 -#endif - -/* GL_IMG_read_format */ -#ifndef GL_IMG_read_format -#define GL_BGRA_IMG 0x80E1 -#define GL_UNSIGNED_SHORT_4_4_4_4_REV_IMG 0x8365 -#endif - -/* GL_IMG_shader_binary */ -#ifndef GL_IMG_shader_binary -#define GL_SGX_BINARY_IMG 0x8C0A -#endif - -/* GL_IMG_texture_compression_pvrtc */ -#ifndef GL_IMG_texture_compression_pvrtc -#define GL_COMPRESSED_RGB_PVRTC_4BPPV1_IMG 0x8C00 -#define GL_COMPRESSED_RGB_PVRTC_2BPPV1_IMG 0x8C01 -#define GL_COMPRESSED_RGBA_PVRTC_4BPPV1_IMG 0x8C02 -#define GL_COMPRESSED_RGBA_PVRTC_2BPPV1_IMG 0x8C03 -#endif - -/* GL_IMG_texture_compression_pvrtc2 */ -#ifndef GL_IMG_texture_compression_pvrtc2 -#define GL_COMPRESSED_RGBA_PVRTC_2BPPV2_IMG 0x9137 -#define GL_COMPRESSED_RGBA_PVRTC_4BPPV2_IMG 0x9138 -#endif - -/* GL_IMG_multisampled_render_to_texture */ -#ifndef GL_IMG_multisampled_render_to_texture -#define GL_RENDERBUFFER_SAMPLES_IMG 0x9133 -#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_IMG 0x9134 -#define GL_MAX_SAMPLES_IMG 0x9135 -#define GL_TEXTURE_SAMPLES_IMG 0x9136 -#endif - -/*------------------------------------------------------------------------* - * NV extension tokens - *------------------------------------------------------------------------*/ - -/* GL_NV_coverage_sample */ -#ifndef GL_NV_coverage_sample -#define GL_COVERAGE_COMPONENT_NV 0x8ED0 -#define GL_COVERAGE_COMPONENT4_NV 0x8ED1 -#define GL_COVERAGE_ATTACHMENT_NV 0x8ED2 -#define GL_COVERAGE_BUFFERS_NV 0x8ED3 -#define GL_COVERAGE_SAMPLES_NV 0x8ED4 -#define GL_COVERAGE_ALL_FRAGMENTS_NV 0x8ED5 -#define GL_COVERAGE_EDGE_FRAGMENTS_NV 0x8ED6 -#define GL_COVERAGE_AUTOMATIC_NV 0x8ED7 -#define GL_COVERAGE_BUFFER_BIT_NV 0x00008000 -#endif - -/* GL_NV_depth_nonlinear */ -#ifndef GL_NV_depth_nonlinear -#define GL_DEPTH_COMPONENT16_NONLINEAR_NV 0x8E2C -#endif - -/* GL_NV_draw_buffers */ -#ifndef GL_NV_draw_buffers -#define GL_MAX_DRAW_BUFFERS_NV 0x8824 -#define GL_DRAW_BUFFER0_NV 0x8825 -#define GL_DRAW_BUFFER1_NV 0x8826 -#define GL_DRAW_BUFFER2_NV 0x8827 -#define GL_DRAW_BUFFER3_NV 0x8828 -#define GL_DRAW_BUFFER4_NV 0x8829 -#define GL_DRAW_BUFFER5_NV 0x882A -#define GL_DRAW_BUFFER6_NV 0x882B -#define GL_DRAW_BUFFER7_NV 0x882C -#define GL_DRAW_BUFFER8_NV 0x882D -#define GL_DRAW_BUFFER9_NV 0x882E -#define GL_DRAW_BUFFER10_NV 0x882F -#define GL_DRAW_BUFFER11_NV 0x8830 -#define GL_DRAW_BUFFER12_NV 0x8831 -#define GL_DRAW_BUFFER13_NV 0x8832 -#define GL_DRAW_BUFFER14_NV 0x8833 -#define GL_DRAW_BUFFER15_NV 0x8834 -#define GL_COLOR_ATTACHMENT0_NV 0x8CE0 -#define GL_COLOR_ATTACHMENT1_NV 0x8CE1 -#define GL_COLOR_ATTACHMENT2_NV 0x8CE2 -#define GL_COLOR_ATTACHMENT3_NV 0x8CE3 -#define GL_COLOR_ATTACHMENT4_NV 0x8CE4 -#define GL_COLOR_ATTACHMENT5_NV 0x8CE5 -#define GL_COLOR_ATTACHMENT6_NV 0x8CE6 -#define GL_COLOR_ATTACHMENT7_NV 0x8CE7 -#define GL_COLOR_ATTACHMENT8_NV 0x8CE8 -#define GL_COLOR_ATTACHMENT9_NV 0x8CE9 -#define GL_COLOR_ATTACHMENT10_NV 0x8CEA -#define GL_COLOR_ATTACHMENT11_NV 0x8CEB -#define GL_COLOR_ATTACHMENT12_NV 0x8CEC -#define GL_COLOR_ATTACHMENT13_NV 0x8CED -#define GL_COLOR_ATTACHMENT14_NV 0x8CEE -#define GL_COLOR_ATTACHMENT15_NV 0x8CEF -#endif - -/* GL_NV_draw_instanced */ -/* No new tokens introduced by this extension. */ - -/* GL_NV_fbo_color_attachments */ -#ifndef GL_NV_fbo_color_attachments -#define GL_MAX_COLOR_ATTACHMENTS_NV 0x8CDF -/* GL_COLOR_ATTACHMENT{0-15}_NV defined in GL_NV_draw_buffers already. */ -#endif - -/* GL_NV_fence */ -#ifndef GL_NV_fence -#define GL_ALL_COMPLETED_NV 0x84F2 -#define GL_FENCE_STATUS_NV 0x84F3 -#define GL_FENCE_CONDITION_NV 0x84F4 -#endif - -/* GL_NV_framebuffer_blit */ -#ifndef GL_NV_framebuffer_blit -#define GL_READ_FRAMEBUFFER_NV 0x8CA8 -#define GL_DRAW_FRAMEBUFFER_NV 0x8CA9 -#define GL_DRAW_FRAMEBUFFER_BINDING_NV 0x8CA6 -#define GL_READ_FRAMEBUFFER_BINDING_NV 0x8CAA -#endif - -/* GL_NV_framebuffer_multisample */ -#ifndef GL_NV_framebuffer_multisample -#define GL_RENDERBUFFER_SAMPLES_NV 0x8CAB -#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_NV 0x8D56 -#define GL_MAX_SAMPLES_NV 0x8D57 -#endif - -/* GL_NV_generate_mipmap_sRGB */ -/* No new tokens introduced by this extension. */ - -/* GL_NV_instanced_arrays */ -#ifndef GL_NV_instanced_arrays -#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_NV 0x88FE -#endif - -/* GL_NV_read_buffer */ -#ifndef GL_NV_read_buffer -#define GL_READ_BUFFER_NV 0x0C02 -#endif - -/* GL_NV_read_buffer_front */ -/* No new tokens introduced by this extension. */ - -/* GL_NV_read_depth */ -/* No new tokens introduced by this extension. */ - -/* GL_NV_read_depth_stencil */ -/* No new tokens introduced by this extension. */ - -/* GL_NV_read_stencil */ -/* No new tokens introduced by this extension. */ - -/* GL_NV_shadow_samplers_array */ -#ifndef GL_NV_shadow_samplers_array -#define GL_SAMPLER_2D_ARRAY_SHADOW_NV 0x8DC4 -#endif - -/* GL_NV_shadow_samplers_cube */ -#ifndef GL_NV_shadow_samplers_cube -#define GL_SAMPLER_CUBE_SHADOW_NV 0x8DC5 -#endif - -/* GL_NV_sRGB_formats */ -#ifndef GL_NV_sRGB_formats -#define GL_SLUMINANCE_NV 0x8C46 -#define GL_SLUMINANCE_ALPHA_NV 0x8C44 -#define GL_SRGB8_NV 0x8C41 -#define GL_SLUMINANCE8_NV 0x8C47 -#define GL_SLUMINANCE8_ALPHA8_NV 0x8C45 -#define GL_COMPRESSED_SRGB_S3TC_DXT1_NV 0x8C4C -#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_NV 0x8C4D -#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_NV 0x8C4E -#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_NV 0x8C4F -#define GL_ETC1_SRGB8_NV 0x88EE -#endif - -/* GL_NV_texture_border_clamp */ -#ifndef GL_NV_texture_border_clamp -#define GL_TEXTURE_BORDER_COLOR_NV 0x1004 -#define GL_CLAMP_TO_BORDER_NV 0x812D -#endif - -/* GL_NV_texture_compression_s3tc_update */ -/* No new tokens introduced by this extension. */ - -/* GL_NV_texture_npot_2D_mipmap */ -/* No new tokens introduced by this extension. */ - -/*------------------------------------------------------------------------* - * QCOM extension tokens - *------------------------------------------------------------------------*/ - -/* GL_QCOM_alpha_test */ -#ifndef GL_QCOM_alpha_test -#define GL_ALPHA_TEST_QCOM 0x0BC0 -#define GL_ALPHA_TEST_FUNC_QCOM 0x0BC1 -#define GL_ALPHA_TEST_REF_QCOM 0x0BC2 -#endif - -/* GL_QCOM_binning_control */ -#ifndef GL_QCOM_binning_control -#define GL_BINNING_CONTROL_HINT_QCOM 0x8FB0 -#define GL_CPU_OPTIMIZED_QCOM 0x8FB1 -#define GL_GPU_OPTIMIZED_QCOM 0x8FB2 -#define GL_RENDER_DIRECT_TO_FRAMEBUFFER_QCOM 0x8FB3 -#endif - -/* GL_QCOM_driver_control */ -/* No new tokens introduced by this extension. */ - -/* GL_QCOM_extended_get */ -#ifndef GL_QCOM_extended_get -#define GL_TEXTURE_WIDTH_QCOM 0x8BD2 -#define GL_TEXTURE_HEIGHT_QCOM 0x8BD3 -#define GL_TEXTURE_DEPTH_QCOM 0x8BD4 -#define GL_TEXTURE_INTERNAL_FORMAT_QCOM 0x8BD5 -#define GL_TEXTURE_FORMAT_QCOM 0x8BD6 -#define GL_TEXTURE_TYPE_QCOM 0x8BD7 -#define GL_TEXTURE_IMAGE_VALID_QCOM 0x8BD8 -#define GL_TEXTURE_NUM_LEVELS_QCOM 0x8BD9 -#define GL_TEXTURE_TARGET_QCOM 0x8BDA -#define GL_TEXTURE_OBJECT_VALID_QCOM 0x8BDB -#define GL_STATE_RESTORE 0x8BDC -#endif - -/* GL_QCOM_extended_get2 */ -/* No new tokens introduced by this extension. */ - -/* GL_QCOM_perfmon_global_mode */ -#ifndef GL_QCOM_perfmon_global_mode -#define GL_PERFMON_GLOBAL_MODE_QCOM 0x8FA0 -#endif - -/* GL_QCOM_writeonly_rendering */ -#ifndef GL_QCOM_writeonly_rendering -#define GL_WRITEONLY_RENDERING_QCOM 0x8823 -#endif - -/* GL_QCOM_tiled_rendering */ -#ifndef GL_QCOM_tiled_rendering -#define GL_COLOR_BUFFER_BIT0_QCOM 0x00000001 -#define GL_COLOR_BUFFER_BIT1_QCOM 0x00000002 -#define GL_COLOR_BUFFER_BIT2_QCOM 0x00000004 -#define GL_COLOR_BUFFER_BIT3_QCOM 0x00000008 -#define GL_COLOR_BUFFER_BIT4_QCOM 0x00000010 -#define GL_COLOR_BUFFER_BIT5_QCOM 0x00000020 -#define GL_COLOR_BUFFER_BIT6_QCOM 0x00000040 -#define GL_COLOR_BUFFER_BIT7_QCOM 0x00000080 -#define GL_DEPTH_BUFFER_BIT0_QCOM 0x00000100 -#define GL_DEPTH_BUFFER_BIT1_QCOM 0x00000200 -#define GL_DEPTH_BUFFER_BIT2_QCOM 0x00000400 -#define GL_DEPTH_BUFFER_BIT3_QCOM 0x00000800 -#define GL_DEPTH_BUFFER_BIT4_QCOM 0x00001000 -#define GL_DEPTH_BUFFER_BIT5_QCOM 0x00002000 -#define GL_DEPTH_BUFFER_BIT6_QCOM 0x00004000 -#define GL_DEPTH_BUFFER_BIT7_QCOM 0x00008000 -#define GL_STENCIL_BUFFER_BIT0_QCOM 0x00010000 -#define GL_STENCIL_BUFFER_BIT1_QCOM 0x00020000 -#define GL_STENCIL_BUFFER_BIT2_QCOM 0x00040000 -#define GL_STENCIL_BUFFER_BIT3_QCOM 0x00080000 -#define GL_STENCIL_BUFFER_BIT4_QCOM 0x00100000 -#define GL_STENCIL_BUFFER_BIT5_QCOM 0x00200000 -#define GL_STENCIL_BUFFER_BIT6_QCOM 0x00400000 -#define GL_STENCIL_BUFFER_BIT7_QCOM 0x00800000 -#define GL_MULTISAMPLE_BUFFER_BIT0_QCOM 0x01000000 -#define GL_MULTISAMPLE_BUFFER_BIT1_QCOM 0x02000000 -#define GL_MULTISAMPLE_BUFFER_BIT2_QCOM 0x04000000 -#define GL_MULTISAMPLE_BUFFER_BIT3_QCOM 0x08000000 -#define GL_MULTISAMPLE_BUFFER_BIT4_QCOM 0x10000000 -#define GL_MULTISAMPLE_BUFFER_BIT5_QCOM 0x20000000 -#define GL_MULTISAMPLE_BUFFER_BIT6_QCOM 0x40000000 -#define GL_MULTISAMPLE_BUFFER_BIT7_QCOM 0x80000000 -#endif - -/*------------------------------------------------------------------------* - * VIV extension tokens - *------------------------------------------------------------------------*/ - -/* GL_VIV_shader_binary */ -#ifndef GL_VIV_shader_binary -#define GL_SHADER_BINARY_VIV 0x8FC4 -#endif - -/*------------------------------------------------------------------------* - * End of extension tokens, start of corresponding extension functions - *------------------------------------------------------------------------*/ - -/*------------------------------------------------------------------------* - * OES extension functions - *------------------------------------------------------------------------*/ - -/* GL_OES_compressed_ETC1_RGB8_texture */ -#ifndef GL_OES_compressed_ETC1_RGB8_texture -#define GL_OES_compressed_ETC1_RGB8_texture 1 -#endif - -/* GL_OES_compressed_paletted_texture */ -#ifndef GL_OES_compressed_paletted_texture -#define GL_OES_compressed_paletted_texture 1 -#endif - -/* GL_OES_depth24 */ -#ifndef GL_OES_depth24 -#define GL_OES_depth24 1 -#endif - -/* GL_OES_depth32 */ -#ifndef GL_OES_depth32 -#define GL_OES_depth32 1 -#endif - -/* GL_OES_depth_texture */ -#ifndef GL_OES_depth_texture -#define GL_OES_depth_texture 1 -#endif - -/* GL_OES_EGL_image */ -#ifndef GL_OES_EGL_image -#define GL_OES_EGL_image 1 +#ifndef GL_KHR_blend_equation_advanced +#define GL_KHR_blend_equation_advanced 1 +#define GL_MULTIPLY_KHR 0x9294 +#define GL_SCREEN_KHR 0x9295 +#define GL_OVERLAY_KHR 0x9296 +#define GL_DARKEN_KHR 0x9297 +#define GL_LIGHTEN_KHR 0x9298 +#define GL_COLORDODGE_KHR 0x9299 +#define GL_COLORBURN_KHR 0x929A +#define GL_HARDLIGHT_KHR 0x929B +#define GL_SOFTLIGHT_KHR 0x929C +#define GL_DIFFERENCE_KHR 0x929E +#define GL_EXCLUSION_KHR 0x92A0 +#define GL_HSL_HUE_KHR 0x92AD +#define GL_HSL_SATURATION_KHR 0x92AE +#define GL_HSL_COLOR_KHR 0x92AF +#define GL_HSL_LUMINOSITY_KHR 0x92B0 +typedef void (GL_APIENTRYP PFNGLBLENDBARRIERKHRPROC) (void); #ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glEGLImageTargetTexture2DOES (GLenum target, GLeglImageOES image); -GL_APICALL void GL_APIENTRY glEGLImageTargetRenderbufferStorageOES (GLenum target, GLeglImageOES image); -#endif -typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETTEXTURE2DOESPROC) (GLenum target, GLeglImageOES image); -typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETRENDERBUFFERSTORAGEOESPROC) (GLenum target, GLeglImageOES image); +GL_APICALL void GL_APIENTRY glBlendBarrierKHR (void); #endif +#endif /* GL_KHR_blend_equation_advanced */ -/* GL_OES_EGL_image_external */ -#ifndef GL_OES_EGL_image_external -#define GL_OES_EGL_image_external 1 -/* glEGLImageTargetTexture2DOES defined in GL_OES_EGL_image already. */ -#endif +#ifndef GL_KHR_blend_equation_advanced_coherent +#define GL_KHR_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_KHR 0x9285 +#endif /* GL_KHR_blend_equation_advanced_coherent */ -/* GL_OES_element_index_uint */ -#ifndef GL_OES_element_index_uint -#define GL_OES_element_index_uint 1 -#endif - -/* GL_OES_fbo_render_mipmap */ -#ifndef GL_OES_fbo_render_mipmap -#define GL_OES_fbo_render_mipmap 1 -#endif - -/* GL_OES_fragment_precision_high */ -#ifndef GL_OES_fragment_precision_high -#define GL_OES_fragment_precision_high 1 -#endif - -/* GL_OES_get_program_binary */ -#ifndef GL_OES_get_program_binary -#define GL_OES_get_program_binary 1 -#ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glGetProgramBinaryOES (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, GLvoid *binary); -GL_APICALL void GL_APIENTRY glProgramBinaryOES (GLuint program, GLenum binaryFormat, const GLvoid *binary, GLint length); -#endif -typedef void (GL_APIENTRYP PFNGLGETPROGRAMBINARYOESPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, GLvoid *binary); -typedef void (GL_APIENTRYP PFNGLPROGRAMBINARYOESPROC) (GLuint program, GLenum binaryFormat, const GLvoid *binary, GLint length); -#endif - -/* GL_OES_mapbuffer */ -#ifndef GL_OES_mapbuffer -#define GL_OES_mapbuffer 1 -#ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void* GL_APIENTRY glMapBufferOES (GLenum target, GLenum access); -GL_APICALL GLboolean GL_APIENTRY glUnmapBufferOES (GLenum target); -GL_APICALL void GL_APIENTRY glGetBufferPointervOES (GLenum target, GLenum pname, GLvoid **params); -#endif -typedef void* (GL_APIENTRYP PFNGLMAPBUFFEROESPROC) (GLenum target, GLenum access); -typedef GLboolean (GL_APIENTRYP PFNGLUNMAPBUFFEROESPROC) (GLenum target); -typedef void (GL_APIENTRYP PFNGLGETBUFFERPOINTERVOESPROC) (GLenum target, GLenum pname, GLvoid **params); -#endif - -/* GL_OES_packed_depth_stencil */ -#ifndef GL_OES_packed_depth_stencil -#define GL_OES_packed_depth_stencil 1 -#endif - -/* GL_OES_required_internalformat */ -#ifndef GL_OES_required_internalformat -#define GL_OES_required_internalformat 1 -#endif - -/* GL_OES_rgb8_rgba8 */ -#ifndef GL_OES_rgb8_rgba8 -#define GL_OES_rgb8_rgba8 1 -#endif - -/* GL_OES_standard_derivatives */ -#ifndef GL_OES_standard_derivatives -#define GL_OES_standard_derivatives 1 -#endif - -/* GL_OES_stencil1 */ -#ifndef GL_OES_stencil1 -#define GL_OES_stencil1 1 -#endif - -/* GL_OES_stencil4 */ -#ifndef GL_OES_stencil4 -#define GL_OES_stencil4 1 -#endif - -#ifndef GL_OES_surfaceless_context -#define GL_OES_surfaceless_context 1 -#endif - -/* GL_OES_texture_3D */ -#ifndef GL_OES_texture_3D -#define GL_OES_texture_3D 1 -#ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glTexImage3DOES (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid* pixels); -GL_APICALL void GL_APIENTRY glTexSubImage3DOES (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid* pixels); -GL_APICALL void GL_APIENTRY glCopyTexSubImage3DOES (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); -GL_APICALL void GL_APIENTRY glCompressedTexImage3DOES (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid* data); -GL_APICALL void GL_APIENTRY glCompressedTexSubImage3DOES (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid* data); -GL_APICALL void GL_APIENTRY glFramebufferTexture3DOES (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); -#endif -typedef void (GL_APIENTRYP PFNGLTEXIMAGE3DOESPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid* pixels); -typedef void (GL_APIENTRYP PFNGLTEXSUBIMAGE3DOESPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid* pixels); -typedef void (GL_APIENTRYP PFNGLCOPYTEXSUBIMAGE3DOESPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (GL_APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DOESPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid* data); -typedef void (GL_APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DOESPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid* data); -typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DOESPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); -#endif - -/* GL_OES_texture_float */ -#ifndef GL_OES_texture_float -#define GL_OES_texture_float 1 -#endif - -/* GL_OES_texture_float_linear */ -#ifndef GL_OES_texture_float_linear -#define GL_OES_texture_float_linear 1 -#endif - -/* GL_OES_texture_half_float */ -#ifndef GL_OES_texture_half_float -#define GL_OES_texture_half_float 1 -#endif - -/* GL_OES_texture_half_float_linear */ -#ifndef GL_OES_texture_half_float_linear -#define GL_OES_texture_half_float_linear 1 -#endif - -/* GL_OES_texture_npot */ -#ifndef GL_OES_texture_npot -#define GL_OES_texture_npot 1 -#endif - -/* GL_OES_vertex_array_object */ -#ifndef GL_OES_vertex_array_object -#define GL_OES_vertex_array_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glBindVertexArrayOES (GLuint array); -GL_APICALL void GL_APIENTRY glDeleteVertexArraysOES (GLsizei n, const GLuint *arrays); -GL_APICALL void GL_APIENTRY glGenVertexArraysOES (GLsizei n, GLuint *arrays); -GL_APICALL GLboolean GL_APIENTRY glIsVertexArrayOES (GLuint array); -#endif -typedef void (GL_APIENTRYP PFNGLBINDVERTEXARRAYOESPROC) (GLuint array); -typedef void (GL_APIENTRYP PFNGLDELETEVERTEXARRAYSOESPROC) (GLsizei n, const GLuint *arrays); -typedef void (GL_APIENTRYP PFNGLGENVERTEXARRAYSOESPROC) (GLsizei n, GLuint *arrays); -typedef GLboolean (GL_APIENTRYP PFNGLISVERTEXARRAYOESPROC) (GLuint array); -#endif - -/* GL_OES_vertex_half_float */ -#ifndef GL_OES_vertex_half_float -#define GL_OES_vertex_half_float 1 -#endif - -/* GL_OES_vertex_type_10_10_10_2 */ -#ifndef GL_OES_vertex_type_10_10_10_2 -#define GL_OES_vertex_type_10_10_10_2 1 -#endif - -/*------------------------------------------------------------------------* - * KHR extension functions - *------------------------------------------------------------------------*/ +#ifndef GL_KHR_context_flush_control +#define GL_KHR_context_flush_control 1 +#define GL_CONTEXT_RELEASE_BEHAVIOR_KHR 0x82FB +#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH_KHR 0x82FC +#endif /* GL_KHR_context_flush_control */ #ifndef GL_KHR_debug #define GL_KHR_debug 1 -#ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glDebugMessageControlKHR (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); -GL_APICALL void GL_APIENTRY glDebugMessageInsertKHR (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); -GL_APICALL void GL_APIENTRY glDebugMessageCallbackKHR (GLDEBUGPROCKHR callback, const void *userParam); -GL_APICALL GLuint GL_APIENTRY glGetDebugMessageLogKHR (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); -GL_APICALL void GL_APIENTRY glPushDebugGroupKHR (GLenum source, GLuint id, GLsizei length, const GLchar *message); -GL_APICALL void GL_APIENTRY glPopDebugGroupKHR (void); -GL_APICALL void GL_APIENTRY glObjectLabelKHR (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); -GL_APICALL void GL_APIENTRY glGetObjectLabelKHR (GLenum identifier, GLuint name, GLsizei bufSize, GLsizei *length, GLchar *label); -GL_APICALL void GL_APIENTRY glObjectPtrLabelKHR (const void *ptr, GLsizei length, const GLchar *label); -GL_APICALL void GL_APIENTRY glGetObjectPtrLabelKHR (const void *ptr, GLsizei bufSize, GLsizei *length, GLchar *label); -GL_APICALL void GL_APIENTRY glGetPointervKHR (GLenum pname, GLvoid **params); -#endif +typedef void (GL_APIENTRY *GLDEBUGPROCKHR)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam); +#define GL_SAMPLER 0x82E6 +#define GL_DEBUG_OUTPUT_SYNCHRONOUS_KHR 0x8242 +#define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH_KHR 0x8243 +#define GL_DEBUG_CALLBACK_FUNCTION_KHR 0x8244 +#define GL_DEBUG_CALLBACK_USER_PARAM_KHR 0x8245 +#define GL_DEBUG_SOURCE_API_KHR 0x8246 +#define GL_DEBUG_SOURCE_WINDOW_SYSTEM_KHR 0x8247 +#define GL_DEBUG_SOURCE_SHADER_COMPILER_KHR 0x8248 +#define GL_DEBUG_SOURCE_THIRD_PARTY_KHR 0x8249 +#define GL_DEBUG_SOURCE_APPLICATION_KHR 0x824A +#define GL_DEBUG_SOURCE_OTHER_KHR 0x824B +#define GL_DEBUG_TYPE_ERROR_KHR 0x824C +#define GL_DEBUG_TYPE_DEPRECATED_BEHAVIOR_KHR 0x824D +#define GL_DEBUG_TYPE_UNDEFINED_BEHAVIOR_KHR 0x824E +#define GL_DEBUG_TYPE_PORTABILITY_KHR 0x824F +#define GL_DEBUG_TYPE_PERFORMANCE_KHR 0x8250 +#define GL_DEBUG_TYPE_OTHER_KHR 0x8251 +#define GL_DEBUG_TYPE_MARKER_KHR 0x8268 +#define GL_DEBUG_TYPE_PUSH_GROUP_KHR 0x8269 +#define GL_DEBUG_TYPE_POP_GROUP_KHR 0x826A +#define GL_DEBUG_SEVERITY_NOTIFICATION_KHR 0x826B +#define GL_MAX_DEBUG_GROUP_STACK_DEPTH_KHR 0x826C +#define GL_DEBUG_GROUP_STACK_DEPTH_KHR 0x826D +#define GL_BUFFER_KHR 0x82E0 +#define GL_SHADER_KHR 0x82E1 +#define GL_PROGRAM_KHR 0x82E2 +#define GL_VERTEX_ARRAY_KHR 0x8074 +#define GL_QUERY_KHR 0x82E3 +#define GL_PROGRAM_PIPELINE_KHR 0x82E4 +#define GL_SAMPLER_KHR 0x82E6 +#define GL_MAX_LABEL_LENGTH_KHR 0x82E8 +#define GL_MAX_DEBUG_MESSAGE_LENGTH_KHR 0x9143 +#define GL_MAX_DEBUG_LOGGED_MESSAGES_KHR 0x9144 +#define GL_DEBUG_LOGGED_MESSAGES_KHR 0x9145 +#define GL_DEBUG_SEVERITY_HIGH_KHR 0x9146 +#define GL_DEBUG_SEVERITY_MEDIUM_KHR 0x9147 +#define GL_DEBUG_SEVERITY_LOW_KHR 0x9148 +#define GL_DEBUG_OUTPUT_KHR 0x92E0 +#define GL_CONTEXT_FLAG_DEBUG_BIT_KHR 0x00000002 +#define GL_STACK_OVERFLOW_KHR 0x0503 +#define GL_STACK_UNDERFLOW_KHR 0x0504 typedef void (GL_APIENTRYP PFNGLDEBUGMESSAGECONTROLKHRPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); typedef void (GL_APIENTRYP PFNGLDEBUGMESSAGEINSERTKHRPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); typedef void (GL_APIENTRYP PFNGLDEBUGMESSAGECALLBACKKHRPROC) (GLDEBUGPROCKHR callback, const void *userParam); -typedef GLuint (GL_APIENTRYP PFNGLGETDEBUGMESSAGELOGKHRPROC) (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +typedef GLuint (GL_APIENTRYP PFNGLGETDEBUGMESSAGELOGKHRPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); typedef void (GL_APIENTRYP PFNGLPUSHDEBUGGROUPKHRPROC) (GLenum source, GLuint id, GLsizei length, const GLchar *message); typedef void (GL_APIENTRYP PFNGLPOPDEBUGGROUPKHRPROC) (void); typedef void (GL_APIENTRYP PFNGLOBJECTLABELKHRPROC) (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); typedef void (GL_APIENTRYP PFNGLGETOBJECTLABELKHRPROC) (GLenum identifier, GLuint name, GLsizei bufSize, GLsizei *length, GLchar *label); typedef void (GL_APIENTRYP PFNGLOBJECTPTRLABELKHRPROC) (const void *ptr, GLsizei length, const GLchar *label); typedef void (GL_APIENTRYP PFNGLGETOBJECTPTRLABELKHRPROC) (const void *ptr, GLsizei bufSize, GLsizei *length, GLchar *label); -typedef void (GL_APIENTRYP PFNGLGETPOINTERVKHRPROC) (GLenum pname, GLvoid **params); +typedef void (GL_APIENTRYP PFNGLGETPOINTERVKHRPROC) (GLenum pname, void **params); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glDebugMessageControlKHR (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +GL_APICALL void GL_APIENTRY glDebugMessageInsertKHR (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +GL_APICALL void GL_APIENTRY glDebugMessageCallbackKHR (GLDEBUGPROCKHR callback, const void *userParam); +GL_APICALL GLuint GL_APIENTRY glGetDebugMessageLogKHR (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +GL_APICALL void GL_APIENTRY glPushDebugGroupKHR (GLenum source, GLuint id, GLsizei length, const GLchar *message); +GL_APICALL void GL_APIENTRY glPopDebugGroupKHR (void); +GL_APICALL void GL_APIENTRY glObjectLabelKHR (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); +GL_APICALL void GL_APIENTRY glGetObjectLabelKHR (GLenum identifier, GLuint name, GLsizei bufSize, GLsizei *length, GLchar *label); +GL_APICALL void GL_APIENTRY glObjectPtrLabelKHR (const void *ptr, GLsizei length, const GLchar *label); +GL_APICALL void GL_APIENTRY glGetObjectPtrLabelKHR (const void *ptr, GLsizei bufSize, GLsizei *length, GLchar *label); +GL_APICALL void GL_APIENTRY glGetPointervKHR (GLenum pname, void **params); #endif +#endif /* GL_KHR_debug */ + +#ifndef GL_KHR_no_error +#define GL_KHR_no_error 1 +#define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 +#endif /* GL_KHR_no_error */ + +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 +typedef void (GL_APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count); +#endif +#endif /* GL_KHR_parallel_shader_compile */ + +#ifndef GL_KHR_robust_buffer_access_behavior +#define GL_KHR_robust_buffer_access_behavior 1 +#endif /* GL_KHR_robust_buffer_access_behavior */ + +#ifndef GL_KHR_robustness +#define GL_KHR_robustness 1 +#define GL_CONTEXT_ROBUST_ACCESS_KHR 0x90F3 +#define GL_LOSE_CONTEXT_ON_RESET_KHR 0x8252 +#define GL_GUILTY_CONTEXT_RESET_KHR 0x8253 +#define GL_INNOCENT_CONTEXT_RESET_KHR 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET_KHR 0x8255 +#define GL_RESET_NOTIFICATION_STRATEGY_KHR 0x8256 +#define GL_NO_RESET_NOTIFICATION_KHR 0x8261 +#define GL_CONTEXT_LOST_KHR 0x0507 +typedef GLenum (GL_APIENTRYP PFNGLGETGRAPHICSRESETSTATUSKHRPROC) (void); +typedef void (GL_APIENTRYP PFNGLREADNPIXELSKHRPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (GL_APIENTRYP PFNGLGETNUNIFORMFVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (GL_APIENTRYP PFNGLGETNUNIFORMIVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETNUNIFORMUIVKHRPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL GLenum GL_APIENTRY glGetGraphicsResetStatusKHR (void); +GL_APICALL void GL_APIENTRY glReadnPixelsKHR (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GL_APICALL void GL_APIENTRY glGetnUniformfvKHR (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +GL_APICALL void GL_APIENTRY glGetnUniformivKHR (GLuint program, GLint location, GLsizei bufSize, GLint *params); +GL_APICALL void GL_APIENTRY glGetnUniformuivKHR (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +#endif +#endif /* GL_KHR_robustness */ + +#ifndef GL_KHR_shader_subgroup +#define GL_KHR_shader_subgroup 1 +#define GL_SUBGROUP_SIZE_KHR 0x9532 +#define GL_SUBGROUP_SUPPORTED_STAGES_KHR 0x9533 +#define GL_SUBGROUP_SUPPORTED_FEATURES_KHR 0x9534 +#define GL_SUBGROUP_QUAD_ALL_STAGES_KHR 0x9535 +#define GL_SUBGROUP_FEATURE_BASIC_BIT_KHR 0x00000001 +#define GL_SUBGROUP_FEATURE_VOTE_BIT_KHR 0x00000002 +#define GL_SUBGROUP_FEATURE_ARITHMETIC_BIT_KHR 0x00000004 +#define GL_SUBGROUP_FEATURE_BALLOT_BIT_KHR 0x00000008 +#define GL_SUBGROUP_FEATURE_SHUFFLE_BIT_KHR 0x00000010 +#define GL_SUBGROUP_FEATURE_SHUFFLE_RELATIVE_BIT_KHR 0x00000020 +#define GL_SUBGROUP_FEATURE_CLUSTERED_BIT_KHR 0x00000040 +#define GL_SUBGROUP_FEATURE_QUAD_BIT_KHR 0x00000080 +#endif /* GL_KHR_shader_subgroup */ + +#ifndef GL_KHR_texture_compression_astc_hdr +#define GL_KHR_texture_compression_astc_hdr 1 +#define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0 +#define GL_COMPRESSED_RGBA_ASTC_5x4_KHR 0x93B1 +#define GL_COMPRESSED_RGBA_ASTC_5x5_KHR 0x93B2 +#define GL_COMPRESSED_RGBA_ASTC_6x5_KHR 0x93B3 +#define GL_COMPRESSED_RGBA_ASTC_6x6_KHR 0x93B4 +#define GL_COMPRESSED_RGBA_ASTC_8x5_KHR 0x93B5 +#define GL_COMPRESSED_RGBA_ASTC_8x6_KHR 0x93B6 +#define GL_COMPRESSED_RGBA_ASTC_8x8_KHR 0x93B7 +#define GL_COMPRESSED_RGBA_ASTC_10x5_KHR 0x93B8 +#define GL_COMPRESSED_RGBA_ASTC_10x6_KHR 0x93B9 +#define GL_COMPRESSED_RGBA_ASTC_10x8_KHR 0x93BA +#define GL_COMPRESSED_RGBA_ASTC_10x10_KHR 0x93BB +#define GL_COMPRESSED_RGBA_ASTC_12x10_KHR 0x93BC +#define GL_COMPRESSED_RGBA_ASTC_12x12_KHR 0x93BD +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_4x4_KHR 0x93D0 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x4_KHR 0x93D1 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x5_KHR 0x93D2 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x5_KHR 0x93D3 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x6_KHR 0x93D4 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x5_KHR 0x93D5 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x6_KHR 0x93D6 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x8_KHR 0x93D7 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x5_KHR 0x93D8 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x6_KHR 0x93D9 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x8_KHR 0x93DA +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x10_KHR 0x93DB +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x10_KHR 0x93DC +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x12_KHR 0x93DD +#endif /* GL_KHR_texture_compression_astc_hdr */ #ifndef GL_KHR_texture_compression_astc_ldr #define GL_KHR_texture_compression_astc_ldr 1 +#endif /* GL_KHR_texture_compression_astc_ldr */ + +#ifndef GL_KHR_texture_compression_astc_sliced_3d +#define GL_KHR_texture_compression_astc_sliced_3d 1 +#endif /* GL_KHR_texture_compression_astc_sliced_3d */ + +#ifndef GL_OES_EGL_image +#define GL_OES_EGL_image 1 +typedef void *GLeglImageOES; +typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETTEXTURE2DOESPROC) (GLenum target, GLeglImageOES image); +typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETRENDERBUFFERSTORAGEOESPROC) (GLenum target, GLeglImageOES image); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glEGLImageTargetTexture2DOES (GLenum target, GLeglImageOES image); +GL_APICALL void GL_APIENTRY glEGLImageTargetRenderbufferStorageOES (GLenum target, GLeglImageOES image); #endif +#endif /* GL_OES_EGL_image */ +#ifndef GL_OES_EGL_image_external +#define GL_OES_EGL_image_external 1 +#define GL_TEXTURE_EXTERNAL_OES 0x8D65 +#define GL_TEXTURE_BINDING_EXTERNAL_OES 0x8D67 +#define GL_REQUIRED_TEXTURE_IMAGE_UNITS_OES 0x8D68 +#define GL_SAMPLER_EXTERNAL_OES 0x8D66 +#endif /* GL_OES_EGL_image_external */ -/*------------------------------------------------------------------------* - * AMD extension functions - *------------------------------------------------------------------------*/ +#ifndef GL_OES_EGL_image_external_essl3 +#define GL_OES_EGL_image_external_essl3 1 +#endif /* GL_OES_EGL_image_external_essl3 */ + +#ifndef GL_OES_compressed_ETC1_RGB8_sub_texture +#define GL_OES_compressed_ETC1_RGB8_sub_texture 1 +#endif /* GL_OES_compressed_ETC1_RGB8_sub_texture */ + +#ifndef GL_OES_compressed_ETC1_RGB8_texture +#define GL_OES_compressed_ETC1_RGB8_texture 1 +#define GL_ETC1_RGB8_OES 0x8D64 +#endif /* GL_OES_compressed_ETC1_RGB8_texture */ + +#ifndef GL_OES_compressed_paletted_texture +#define GL_OES_compressed_paletted_texture 1 +#define GL_PALETTE4_RGB8_OES 0x8B90 +#define GL_PALETTE4_RGBA8_OES 0x8B91 +#define GL_PALETTE4_R5_G6_B5_OES 0x8B92 +#define GL_PALETTE4_RGBA4_OES 0x8B93 +#define GL_PALETTE4_RGB5_A1_OES 0x8B94 +#define GL_PALETTE8_RGB8_OES 0x8B95 +#define GL_PALETTE8_RGBA8_OES 0x8B96 +#define GL_PALETTE8_R5_G6_B5_OES 0x8B97 +#define GL_PALETTE8_RGBA4_OES 0x8B98 +#define GL_PALETTE8_RGB5_A1_OES 0x8B99 +#endif /* GL_OES_compressed_paletted_texture */ + +#ifndef GL_OES_copy_image +#define GL_OES_copy_image 1 +typedef void (GL_APIENTRYP PFNGLCOPYIMAGESUBDATAOESPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glCopyImageSubDataOES (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +#endif +#endif /* GL_OES_copy_image */ + +#ifndef GL_OES_depth24 +#define GL_OES_depth24 1 +#define GL_DEPTH_COMPONENT24_OES 0x81A6 +#endif /* GL_OES_depth24 */ + +#ifndef GL_OES_depth32 +#define GL_OES_depth32 1 +#define GL_DEPTH_COMPONENT32_OES 0x81A7 +#endif /* GL_OES_depth32 */ + +#ifndef GL_OES_depth_texture +#define GL_OES_depth_texture 1 +#endif /* GL_OES_depth_texture */ + +#ifndef GL_OES_draw_buffers_indexed +#define GL_OES_draw_buffers_indexed 1 +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 +typedef void (GL_APIENTRYP PFNGLENABLEIOESPROC) (GLenum target, GLuint index); +typedef void (GL_APIENTRYP PFNGLDISABLEIOESPROC) (GLenum target, GLuint index); +typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONIOESPROC) (GLuint buf, GLenum mode); +typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONSEPARATEIOESPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (GL_APIENTRYP PFNGLBLENDFUNCIOESPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (GL_APIENTRYP PFNGLBLENDFUNCSEPARATEIOESPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +typedef void (GL_APIENTRYP PFNGLCOLORMASKIOESPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +typedef GLboolean (GL_APIENTRYP PFNGLISENABLEDIOESPROC) (GLenum target, GLuint index); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glEnableiOES (GLenum target, GLuint index); +GL_APICALL void GL_APIENTRY glDisableiOES (GLenum target, GLuint index); +GL_APICALL void GL_APIENTRY glBlendEquationiOES (GLuint buf, GLenum mode); +GL_APICALL void GL_APIENTRY glBlendEquationSeparateiOES (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +GL_APICALL void GL_APIENTRY glBlendFunciOES (GLuint buf, GLenum src, GLenum dst); +GL_APICALL void GL_APIENTRY glBlendFuncSeparateiOES (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +GL_APICALL void GL_APIENTRY glColorMaskiOES (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +GL_APICALL GLboolean GL_APIENTRY glIsEnablediOES (GLenum target, GLuint index); +#endif +#endif /* GL_OES_draw_buffers_indexed */ + +#ifndef GL_OES_draw_elements_base_vertex +#define GL_OES_draw_elements_base_vertex 1 +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXOESPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (GL_APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXOESPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXOESPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glDrawElementsBaseVertexOES (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GL_APICALL void GL_APIENTRY glDrawRangeElementsBaseVertexOES (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GL_APICALL void GL_APIENTRY glDrawElementsInstancedBaseVertexOES (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +GL_APICALL void GL_APIENTRY glMultiDrawElementsBaseVertexEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); +#endif +#endif /* GL_OES_draw_elements_base_vertex */ + +#ifndef GL_OES_element_index_uint +#define GL_OES_element_index_uint 1 +#endif /* GL_OES_element_index_uint */ + +#ifndef GL_OES_fbo_render_mipmap +#define GL_OES_fbo_render_mipmap 1 +#endif /* GL_OES_fbo_render_mipmap */ + +#ifndef GL_OES_fragment_precision_high +#define GL_OES_fragment_precision_high 1 +#endif /* GL_OES_fragment_precision_high */ + +#ifndef GL_OES_geometry_point_size +#define GL_OES_geometry_point_size 1 +#endif /* GL_OES_geometry_point_size */ + +#ifndef GL_OES_geometry_shader +#define GL_OES_geometry_shader 1 +#define GL_GEOMETRY_SHADER_OES 0x8DD9 +#define GL_GEOMETRY_SHADER_BIT_OES 0x00000004 +#define GL_GEOMETRY_LINKED_VERTICES_OUT_OES 0x8916 +#define GL_GEOMETRY_LINKED_INPUT_TYPE_OES 0x8917 +#define GL_GEOMETRY_LINKED_OUTPUT_TYPE_OES 0x8918 +#define GL_GEOMETRY_SHADER_INVOCATIONS_OES 0x887F +#define GL_LAYER_PROVOKING_VERTEX_OES 0x825E +#define GL_LINES_ADJACENCY_OES 0x000A +#define GL_LINE_STRIP_ADJACENCY_OES 0x000B +#define GL_TRIANGLES_ADJACENCY_OES 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY_OES 0x000D +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_OES 0x8DDF +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS_OES 0x8A2C +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS_OES 0x8A32 +#define GL_MAX_GEOMETRY_INPUT_COMPONENTS_OES 0x9123 +#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS_OES 0x9124 +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_OES 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_OES 0x8DE1 +#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS_OES 0x8E5A +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_OES 0x8C29 +#define GL_MAX_GEOMETRY_ATOMIC_COUNTER_BUFFERS_OES 0x92CF +#define GL_MAX_GEOMETRY_ATOMIC_COUNTERS_OES 0x92D5 +#define GL_MAX_GEOMETRY_IMAGE_UNIFORMS_OES 0x90CD +#define GL_MAX_GEOMETRY_SHADER_STORAGE_BLOCKS_OES 0x90D7 +#define GL_FIRST_VERTEX_CONVENTION_OES 0x8E4D +#define GL_LAST_VERTEX_CONVENTION_OES 0x8E4E +#define GL_UNDEFINED_VERTEX_OES 0x8260 +#define GL_PRIMITIVES_GENERATED_OES 0x8C87 +#define GL_FRAMEBUFFER_DEFAULT_LAYERS_OES 0x9312 +#define GL_MAX_FRAMEBUFFER_LAYERS_OES 0x9317 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_OES 0x8DA8 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_OES 0x8DA7 +#define GL_REFERENCED_BY_GEOMETRY_SHADER_OES 0x9309 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTUREOESPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferTextureOES (GLenum target, GLenum attachment, GLuint texture, GLint level); +#endif +#endif /* GL_OES_geometry_shader */ + +#ifndef GL_OES_get_program_binary +#define GL_OES_get_program_binary 1 +#define GL_PROGRAM_BINARY_LENGTH_OES 0x8741 +#define GL_NUM_PROGRAM_BINARY_FORMATS_OES 0x87FE +#define GL_PROGRAM_BINARY_FORMATS_OES 0x87FF +typedef void (GL_APIENTRYP PFNGLGETPROGRAMBINARYOESPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +typedef void (GL_APIENTRYP PFNGLPROGRAMBINARYOESPROC) (GLuint program, GLenum binaryFormat, const void *binary, GLint length); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetProgramBinaryOES (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +GL_APICALL void GL_APIENTRY glProgramBinaryOES (GLuint program, GLenum binaryFormat, const void *binary, GLint length); +#endif +#endif /* GL_OES_get_program_binary */ + +#ifndef GL_OES_gpu_shader5 +#define GL_OES_gpu_shader5 1 +#endif /* GL_OES_gpu_shader5 */ + +#ifndef GL_OES_mapbuffer +#define GL_OES_mapbuffer 1 +#define GL_WRITE_ONLY_OES 0x88B9 +#define GL_BUFFER_ACCESS_OES 0x88BB +#define GL_BUFFER_MAPPED_OES 0x88BC +#define GL_BUFFER_MAP_POINTER_OES 0x88BD +typedef void *(GL_APIENTRYP PFNGLMAPBUFFEROESPROC) (GLenum target, GLenum access); +typedef GLboolean (GL_APIENTRYP PFNGLUNMAPBUFFEROESPROC) (GLenum target); +typedef void (GL_APIENTRYP PFNGLGETBUFFERPOINTERVOESPROC) (GLenum target, GLenum pname, void **params); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void *GL_APIENTRY glMapBufferOES (GLenum target, GLenum access); +GL_APICALL GLboolean GL_APIENTRY glUnmapBufferOES (GLenum target); +GL_APICALL void GL_APIENTRY glGetBufferPointervOES (GLenum target, GLenum pname, void **params); +#endif +#endif /* GL_OES_mapbuffer */ + +#ifndef GL_OES_packed_depth_stencil +#define GL_OES_packed_depth_stencil 1 +#define GL_DEPTH_STENCIL_OES 0x84F9 +#define GL_UNSIGNED_INT_24_8_OES 0x84FA +#define GL_DEPTH24_STENCIL8_OES 0x88F0 +#endif /* GL_OES_packed_depth_stencil */ + +#ifndef GL_OES_primitive_bounding_box +#define GL_OES_primitive_bounding_box 1 +#define GL_PRIMITIVE_BOUNDING_BOX_OES 0x92BE +typedef void (GL_APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXOESPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glPrimitiveBoundingBoxOES (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#endif +#endif /* GL_OES_primitive_bounding_box */ + +#ifndef GL_OES_required_internalformat +#define GL_OES_required_internalformat 1 +#define GL_ALPHA8_OES 0x803C +#define GL_DEPTH_COMPONENT16_OES 0x81A5 +#define GL_LUMINANCE4_ALPHA4_OES 0x8043 +#define GL_LUMINANCE8_ALPHA8_OES 0x8045 +#define GL_LUMINANCE8_OES 0x8040 +#define GL_RGBA4_OES 0x8056 +#define GL_RGB5_A1_OES 0x8057 +#define GL_RGB565_OES 0x8D62 +#define GL_RGB8_OES 0x8051 +#define GL_RGBA8_OES 0x8058 +#define GL_RGB10_EXT 0x8052 +#define GL_RGB10_A2_EXT 0x8059 +#endif /* GL_OES_required_internalformat */ + +#ifndef GL_OES_rgb8_rgba8 +#define GL_OES_rgb8_rgba8 1 +#endif /* GL_OES_rgb8_rgba8 */ + +#ifndef GL_OES_sample_shading +#define GL_OES_sample_shading 1 +#define GL_SAMPLE_SHADING_OES 0x8C36 +#define GL_MIN_SAMPLE_SHADING_VALUE_OES 0x8C37 +typedef void (GL_APIENTRYP PFNGLMINSAMPLESHADINGOESPROC) (GLfloat value); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glMinSampleShadingOES (GLfloat value); +#endif +#endif /* GL_OES_sample_shading */ + +#ifndef GL_OES_sample_variables +#define GL_OES_sample_variables 1 +#endif /* GL_OES_sample_variables */ + +#ifndef GL_OES_shader_image_atomic +#define GL_OES_shader_image_atomic 1 +#endif /* GL_OES_shader_image_atomic */ + +#ifndef GL_OES_shader_io_blocks +#define GL_OES_shader_io_blocks 1 +#endif /* GL_OES_shader_io_blocks */ + +#ifndef GL_OES_shader_multisample_interpolation +#define GL_OES_shader_multisample_interpolation 1 +#define GL_MIN_FRAGMENT_INTERPOLATION_OFFSET_OES 0x8E5B +#define GL_MAX_FRAGMENT_INTERPOLATION_OFFSET_OES 0x8E5C +#define GL_FRAGMENT_INTERPOLATION_OFFSET_BITS_OES 0x8E5D +#endif /* GL_OES_shader_multisample_interpolation */ + +#ifndef GL_OES_standard_derivatives +#define GL_OES_standard_derivatives 1 +#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_OES 0x8B8B +#endif /* GL_OES_standard_derivatives */ + +#ifndef GL_OES_stencil1 +#define GL_OES_stencil1 1 +#define GL_STENCIL_INDEX1_OES 0x8D46 +#endif /* GL_OES_stencil1 */ + +#ifndef GL_OES_stencil4 +#define GL_OES_stencil4 1 +#define GL_STENCIL_INDEX4_OES 0x8D47 +#endif /* GL_OES_stencil4 */ + +#ifndef GL_OES_surfaceless_context +#define GL_OES_surfaceless_context 1 +#define GL_FRAMEBUFFER_UNDEFINED_OES 0x8219 +#endif /* GL_OES_surfaceless_context */ + +#ifndef GL_OES_tessellation_point_size +#define GL_OES_tessellation_point_size 1 +#endif /* GL_OES_tessellation_point_size */ + +#ifndef GL_OES_tessellation_shader +#define GL_OES_tessellation_shader 1 +#define GL_PATCHES_OES 0x000E +#define GL_PATCH_VERTICES_OES 0x8E72 +#define GL_TESS_CONTROL_OUTPUT_VERTICES_OES 0x8E75 +#define GL_TESS_GEN_MODE_OES 0x8E76 +#define GL_TESS_GEN_SPACING_OES 0x8E77 +#define GL_TESS_GEN_VERTEX_ORDER_OES 0x8E78 +#define GL_TESS_GEN_POINT_MODE_OES 0x8E79 +#define GL_ISOLINES_OES 0x8E7A +#define GL_QUADS_OES 0x0007 +#define GL_FRACTIONAL_ODD_OES 0x8E7B +#define GL_FRACTIONAL_EVEN_OES 0x8E7C +#define GL_MAX_PATCH_VERTICES_OES 0x8E7D +#define GL_MAX_TESS_GEN_LEVEL_OES 0x8E7E +#define GL_MAX_TESS_CONTROL_UNIFORM_COMPONENTS_OES 0x8E7F +#define GL_MAX_TESS_EVALUATION_UNIFORM_COMPONENTS_OES 0x8E80 +#define GL_MAX_TESS_CONTROL_TEXTURE_IMAGE_UNITS_OES 0x8E81 +#define GL_MAX_TESS_EVALUATION_TEXTURE_IMAGE_UNITS_OES 0x8E82 +#define GL_MAX_TESS_CONTROL_OUTPUT_COMPONENTS_OES 0x8E83 +#define GL_MAX_TESS_PATCH_COMPONENTS_OES 0x8E84 +#define GL_MAX_TESS_CONTROL_TOTAL_OUTPUT_COMPONENTS_OES 0x8E85 +#define GL_MAX_TESS_EVALUATION_OUTPUT_COMPONENTS_OES 0x8E86 +#define GL_MAX_TESS_CONTROL_UNIFORM_BLOCKS_OES 0x8E89 +#define GL_MAX_TESS_EVALUATION_UNIFORM_BLOCKS_OES 0x8E8A +#define GL_MAX_TESS_CONTROL_INPUT_COMPONENTS_OES 0x886C +#define GL_MAX_TESS_EVALUATION_INPUT_COMPONENTS_OES 0x886D +#define GL_MAX_COMBINED_TESS_CONTROL_UNIFORM_COMPONENTS_OES 0x8E1E +#define GL_MAX_COMBINED_TESS_EVALUATION_UNIFORM_COMPONENTS_OES 0x8E1F +#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTER_BUFFERS_OES 0x92CD +#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTER_BUFFERS_OES 0x92CE +#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTERS_OES 0x92D3 +#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTERS_OES 0x92D4 +#define GL_MAX_TESS_CONTROL_IMAGE_UNIFORMS_OES 0x90CB +#define GL_MAX_TESS_EVALUATION_IMAGE_UNIFORMS_OES 0x90CC +#define GL_MAX_TESS_CONTROL_SHADER_STORAGE_BLOCKS_OES 0x90D8 +#define GL_MAX_TESS_EVALUATION_SHADER_STORAGE_BLOCKS_OES 0x90D9 +#define GL_PRIMITIVE_RESTART_FOR_PATCHES_SUPPORTED_OES 0x8221 +#define GL_IS_PER_PATCH_OES 0x92E7 +#define GL_REFERENCED_BY_TESS_CONTROL_SHADER_OES 0x9307 +#define GL_REFERENCED_BY_TESS_EVALUATION_SHADER_OES 0x9308 +#define GL_TESS_CONTROL_SHADER_OES 0x8E88 +#define GL_TESS_EVALUATION_SHADER_OES 0x8E87 +#define GL_TESS_CONTROL_SHADER_BIT_OES 0x00000008 +#define GL_TESS_EVALUATION_SHADER_BIT_OES 0x00000010 +typedef void (GL_APIENTRYP PFNGLPATCHPARAMETERIOESPROC) (GLenum pname, GLint value); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glPatchParameteriOES (GLenum pname, GLint value); +#endif +#endif /* GL_OES_tessellation_shader */ + +#ifndef GL_OES_texture_3D +#define GL_OES_texture_3D 1 +#define GL_TEXTURE_WRAP_R_OES 0x8072 +#define GL_TEXTURE_3D_OES 0x806F +#define GL_TEXTURE_BINDING_3D_OES 0x806A +#define GL_MAX_3D_TEXTURE_SIZE_OES 0x8073 +#define GL_SAMPLER_3D_OES 0x8B5F +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_OES 0x8CD4 +typedef void (GL_APIENTRYP PFNGLTEXIMAGE3DOESPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (GL_APIENTRYP PFNGLTEXSUBIMAGE3DOESPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (GL_APIENTRYP PFNGLCOPYTEXSUBIMAGE3DOESPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DOESPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (GL_APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DOESPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DOESPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexImage3DOES (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GL_APICALL void GL_APIENTRY glTexSubImage3DOES (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GL_APICALL void GL_APIENTRY glCopyTexSubImage3DOES (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glCompressedTexImage3DOES (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +GL_APICALL void GL_APIENTRY glCompressedTexSubImage3DOES (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GL_APICALL void GL_APIENTRY glFramebufferTexture3DOES (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +#endif +#endif /* GL_OES_texture_3D */ + +#ifndef GL_OES_texture_border_clamp +#define GL_OES_texture_border_clamp 1 +#define GL_TEXTURE_BORDER_COLOR_OES 0x1004 +#define GL_CLAMP_TO_BORDER_OES 0x812D +typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIIVOESPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIUIVOESPROC) (GLenum target, GLenum pname, const GLuint *params); +typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIIVOESPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIUIVOESPROC) (GLenum target, GLenum pname, GLuint *params); +typedef void (GL_APIENTRYP PFNGLSAMPLERPARAMETERIIVOESPROC) (GLuint sampler, GLenum pname, const GLint *param); +typedef void (GL_APIENTRYP PFNGLSAMPLERPARAMETERIUIVOESPROC) (GLuint sampler, GLenum pname, const GLuint *param); +typedef void (GL_APIENTRYP PFNGLGETSAMPLERPARAMETERIIVOESPROC) (GLuint sampler, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETSAMPLERPARAMETERIUIVOESPROC) (GLuint sampler, GLenum pname, GLuint *params); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexParameterIivOES (GLenum target, GLenum pname, const GLint *params); +GL_APICALL void GL_APIENTRY glTexParameterIuivOES (GLenum target, GLenum pname, const GLuint *params); +GL_APICALL void GL_APIENTRY glGetTexParameterIivOES (GLenum target, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetTexParameterIuivOES (GLenum target, GLenum pname, GLuint *params); +GL_APICALL void GL_APIENTRY glSamplerParameterIivOES (GLuint sampler, GLenum pname, const GLint *param); +GL_APICALL void GL_APIENTRY glSamplerParameterIuivOES (GLuint sampler, GLenum pname, const GLuint *param); +GL_APICALL void GL_APIENTRY glGetSamplerParameterIivOES (GLuint sampler, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetSamplerParameterIuivOES (GLuint sampler, GLenum pname, GLuint *params); +#endif +#endif /* GL_OES_texture_border_clamp */ + +#ifndef GL_OES_texture_buffer +#define GL_OES_texture_buffer 1 +#define GL_TEXTURE_BUFFER_OES 0x8C2A +#define GL_TEXTURE_BUFFER_BINDING_OES 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE_OES 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER_OES 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_OES 0x8C2D +#define GL_TEXTURE_BUFFER_OFFSET_ALIGNMENT_OES 0x919F +#define GL_SAMPLER_BUFFER_OES 0x8DC2 +#define GL_INT_SAMPLER_BUFFER_OES 0x8DD0 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER_OES 0x8DD8 +#define GL_IMAGE_BUFFER_OES 0x9051 +#define GL_INT_IMAGE_BUFFER_OES 0x905C +#define GL_UNSIGNED_INT_IMAGE_BUFFER_OES 0x9067 +#define GL_TEXTURE_BUFFER_OFFSET_OES 0x919D +#define GL_TEXTURE_BUFFER_SIZE_OES 0x919E +typedef void (GL_APIENTRYP PFNGLTEXBUFFEROESPROC) (GLenum target, GLenum internalformat, GLuint buffer); +typedef void (GL_APIENTRYP PFNGLTEXBUFFERRANGEOESPROC) (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexBufferOES (GLenum target, GLenum internalformat, GLuint buffer); +GL_APICALL void GL_APIENTRY glTexBufferRangeOES (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +#endif +#endif /* GL_OES_texture_buffer */ + +#ifndef GL_OES_texture_compression_astc +#define GL_OES_texture_compression_astc 1 +#define GL_COMPRESSED_RGBA_ASTC_3x3x3_OES 0x93C0 +#define GL_COMPRESSED_RGBA_ASTC_4x3x3_OES 0x93C1 +#define GL_COMPRESSED_RGBA_ASTC_4x4x3_OES 0x93C2 +#define GL_COMPRESSED_RGBA_ASTC_4x4x4_OES 0x93C3 +#define GL_COMPRESSED_RGBA_ASTC_5x4x4_OES 0x93C4 +#define GL_COMPRESSED_RGBA_ASTC_5x5x4_OES 0x93C5 +#define GL_COMPRESSED_RGBA_ASTC_5x5x5_OES 0x93C6 +#define GL_COMPRESSED_RGBA_ASTC_6x5x5_OES 0x93C7 +#define GL_COMPRESSED_RGBA_ASTC_6x6x5_OES 0x93C8 +#define GL_COMPRESSED_RGBA_ASTC_6x6x6_OES 0x93C9 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_3x3x3_OES 0x93E0 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_4x3x3_OES 0x93E1 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_4x4x3_OES 0x93E2 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_4x4x4_OES 0x93E3 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x4x4_OES 0x93E4 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x5x4_OES 0x93E5 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x5x5_OES 0x93E6 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x5x5_OES 0x93E7 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x6x5_OES 0x93E8 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x6x6_OES 0x93E9 +#endif /* GL_OES_texture_compression_astc */ + +#ifndef GL_OES_texture_cube_map_array +#define GL_OES_texture_cube_map_array 1 +#define GL_TEXTURE_CUBE_MAP_ARRAY_OES 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_OES 0x900A +#define GL_SAMPLER_CUBE_MAP_ARRAY_OES 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_OES 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_OES 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_OES 0x900F +#define GL_IMAGE_CUBE_MAP_ARRAY_OES 0x9054 +#define GL_INT_IMAGE_CUBE_MAP_ARRAY_OES 0x905F +#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY_OES 0x906A +#endif /* GL_OES_texture_cube_map_array */ + +#ifndef GL_OES_texture_float +#define GL_OES_texture_float 1 +#endif /* GL_OES_texture_float */ + +#ifndef GL_OES_texture_float_linear +#define GL_OES_texture_float_linear 1 +#endif /* GL_OES_texture_float_linear */ + +#ifndef GL_OES_texture_half_float +#define GL_OES_texture_half_float 1 +#define GL_HALF_FLOAT_OES 0x8D61 +#endif /* GL_OES_texture_half_float */ + +#ifndef GL_OES_texture_half_float_linear +#define GL_OES_texture_half_float_linear 1 +#endif /* GL_OES_texture_half_float_linear */ + +#ifndef GL_OES_texture_npot +#define GL_OES_texture_npot 1 +#endif /* GL_OES_texture_npot */ + +#ifndef GL_OES_texture_stencil8 +#define GL_OES_texture_stencil8 1 +#define GL_STENCIL_INDEX_OES 0x1901 +#define GL_STENCIL_INDEX8_OES 0x8D48 +#endif /* GL_OES_texture_stencil8 */ + +#ifndef GL_OES_texture_storage_multisample_2d_array +#define GL_OES_texture_storage_multisample_2d_array 1 +#define GL_TEXTURE_2D_MULTISAMPLE_ARRAY_OES 0x9102 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE_ARRAY_OES 0x9105 +#define GL_SAMPLER_2D_MULTISAMPLE_ARRAY_OES 0x910B +#define GL_INT_SAMPLER_2D_MULTISAMPLE_ARRAY_OES 0x910C +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE_ARRAY_OES 0x910D +typedef void (GL_APIENTRYP PFNGLTEXSTORAGE3DMULTISAMPLEOESPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexStorage3DMultisampleOES (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +#endif +#endif /* GL_OES_texture_storage_multisample_2d_array */ + +#ifndef GL_OES_texture_view +#define GL_OES_texture_view 1 +#define GL_TEXTURE_VIEW_MIN_LEVEL_OES 0x82DB +#define GL_TEXTURE_VIEW_NUM_LEVELS_OES 0x82DC +#define GL_TEXTURE_VIEW_MIN_LAYER_OES 0x82DD +#define GL_TEXTURE_VIEW_NUM_LAYERS_OES 0x82DE +#define GL_TEXTURE_IMMUTABLE_LEVELS 0x82DF +typedef void (GL_APIENTRYP PFNGLTEXTUREVIEWOESPROC) (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTextureViewOES (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); +#endif +#endif /* GL_OES_texture_view */ + +#ifndef GL_OES_vertex_array_object +#define GL_OES_vertex_array_object 1 +#define GL_VERTEX_ARRAY_BINDING_OES 0x85B5 +typedef void (GL_APIENTRYP PFNGLBINDVERTEXARRAYOESPROC) (GLuint array); +typedef void (GL_APIENTRYP PFNGLDELETEVERTEXARRAYSOESPROC) (GLsizei n, const GLuint *arrays); +typedef void (GL_APIENTRYP PFNGLGENVERTEXARRAYSOESPROC) (GLsizei n, GLuint *arrays); +typedef GLboolean (GL_APIENTRYP PFNGLISVERTEXARRAYOESPROC) (GLuint array); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBindVertexArrayOES (GLuint array); +GL_APICALL void GL_APIENTRY glDeleteVertexArraysOES (GLsizei n, const GLuint *arrays); +GL_APICALL void GL_APIENTRY glGenVertexArraysOES (GLsizei n, GLuint *arrays); +GL_APICALL GLboolean GL_APIENTRY glIsVertexArrayOES (GLuint array); +#endif +#endif /* GL_OES_vertex_array_object */ + +#ifndef GL_OES_vertex_half_float +#define GL_OES_vertex_half_float 1 +#endif /* GL_OES_vertex_half_float */ + +#ifndef GL_OES_vertex_type_10_10_10_2 +#define GL_OES_vertex_type_10_10_10_2 1 +#define GL_UNSIGNED_INT_10_10_10_2_OES 0x8DF6 +#define GL_INT_10_10_10_2_OES 0x8DF7 +#endif /* GL_OES_vertex_type_10_10_10_2 */ + +#ifndef GL_OES_viewport_array +#define GL_OES_viewport_array 1 +#define GL_MAX_VIEWPORTS_OES 0x825B +#define GL_VIEWPORT_SUBPIXEL_BITS_OES 0x825C +#define GL_VIEWPORT_BOUNDS_RANGE_OES 0x825D +#define GL_VIEWPORT_INDEX_PROVOKING_VERTEX_OES 0x825F +typedef void (GL_APIENTRYP PFNGLVIEWPORTARRAYVOESPROC) (GLuint first, GLsizei count, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLVIEWPORTINDEXEDFOESPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +typedef void (GL_APIENTRYP PFNGLVIEWPORTINDEXEDFVOESPROC) (GLuint index, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLSCISSORARRAYVOESPROC) (GLuint first, GLsizei count, const GLint *v); +typedef void (GL_APIENTRYP PFNGLSCISSORINDEXEDOESPROC) (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLSCISSORINDEXEDVOESPROC) (GLuint index, const GLint *v); +typedef void (GL_APIENTRYP PFNGLDEPTHRANGEARRAYFVOESPROC) (GLuint first, GLsizei count, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLDEPTHRANGEINDEXEDFOESPROC) (GLuint index, GLfloat n, GLfloat f); +typedef void (GL_APIENTRYP PFNGLGETFLOATI_VOESPROC) (GLenum target, GLuint index, GLfloat *data); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glViewportArrayvOES (GLuint first, GLsizei count, const GLfloat *v); +GL_APICALL void GL_APIENTRY glViewportIndexedfOES (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +GL_APICALL void GL_APIENTRY glViewportIndexedfvOES (GLuint index, const GLfloat *v); +GL_APICALL void GL_APIENTRY glScissorArrayvOES (GLuint first, GLsizei count, const GLint *v); +GL_APICALL void GL_APIENTRY glScissorIndexedOES (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glScissorIndexedvOES (GLuint index, const GLint *v); +GL_APICALL void GL_APIENTRY glDepthRangeArrayfvOES (GLuint first, GLsizei count, const GLfloat *v); +GL_APICALL void GL_APIENTRY glDepthRangeIndexedfOES (GLuint index, GLfloat n, GLfloat f); +GL_APICALL void GL_APIENTRY glGetFloati_vOES (GLenum target, GLuint index, GLfloat *data); +#endif +#endif /* GL_OES_viewport_array */ -/* GL_AMD_compressed_3DC_texture */ #ifndef GL_AMD_compressed_3DC_texture #define GL_AMD_compressed_3DC_texture 1 -#endif +#define GL_3DC_X_AMD 0x87F9 +#define GL_3DC_XY_AMD 0x87FA +#endif /* GL_AMD_compressed_3DC_texture */ -/* GL_AMD_compressed_ATC_texture */ #ifndef GL_AMD_compressed_ATC_texture #define GL_AMD_compressed_ATC_texture 1 -#endif +#define GL_ATC_RGB_AMD 0x8C92 +#define GL_ATC_RGBA_EXPLICIT_ALPHA_AMD 0x8C93 +#define GL_ATC_RGBA_INTERPOLATED_ALPHA_AMD 0x87EE +#endif /* GL_AMD_compressed_ATC_texture */ + +#ifndef GL_AMD_framebuffer_multisample_advanced +#define GL_AMD_framebuffer_multisample_advanced 1 +#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2 +#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3 +#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4 +#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5 +#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6 +#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7 +typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_AMD_framebuffer_multisample_advanced */ -/* AMD_performance_monitor */ #ifndef GL_AMD_performance_monitor #define GL_AMD_performance_monitor 1 +#define GL_COUNTER_TYPE_AMD 0x8BC0 +#define GL_COUNTER_RANGE_AMD 0x8BC1 +#define GL_UNSIGNED_INT64_AMD 0x8BC2 +#define GL_PERCENTAGE_AMD 0x8BC3 +#define GL_PERFMON_RESULT_AVAILABLE_AMD 0x8BC4 +#define GL_PERFMON_RESULT_SIZE_AMD 0x8BC5 +#define GL_PERFMON_RESULT_AMD 0x8BC6 +typedef void (GL_APIENTRYP PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint *numGroups, GLsizei groupsSize, GLuint *groups); +typedef void (GL_APIENTRYP PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); +typedef void (GL_APIENTRYP PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); +typedef void (GL_APIENTRYP PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); +typedef void (GL_APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, void *data); +typedef void (GL_APIENTRYP PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); +typedef void (GL_APIENTRYP PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); +typedef void (GL_APIENTRYP PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); +typedef void (GL_APIENTRYP PFNGLBEGINPERFMONITORAMDPROC) (GLuint monitor); +typedef void (GL_APIENTRYP PFNGLENDPERFMONITORAMDPROC) (GLuint monitor); +typedef void (GL_APIENTRYP PFNGLGETPERFMONITORCOUNTERDATAAMDPROC) (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glGetPerfMonitorGroupsAMD (GLint *numGroups, GLsizei groupsSize, GLuint *groups); GL_APICALL void GL_APIENTRY glGetPerfMonitorCountersAMD (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); GL_APICALL void GL_APIENTRY glGetPerfMonitorGroupStringAMD (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); GL_APICALL void GL_APIENTRY glGetPerfMonitorCounterStringAMD (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); -GL_APICALL void GL_APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, GLvoid *data); +GL_APICALL void GL_APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, void *data); GL_APICALL void GL_APIENTRY glGenPerfMonitorsAMD (GLsizei n, GLuint *monitors); GL_APICALL void GL_APIENTRY glDeletePerfMonitorsAMD (GLsizei n, GLuint *monitors); -GL_APICALL void GL_APIENTRY glSelectPerfMonitorCountersAMD (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *countersList); +GL_APICALL void GL_APIENTRY glSelectPerfMonitorCountersAMD (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); GL_APICALL void GL_APIENTRY glBeginPerfMonitorAMD (GLuint monitor); GL_APICALL void GL_APIENTRY glEndPerfMonitorAMD (GLuint monitor); GL_APICALL void GL_APIENTRY glGetPerfMonitorCounterDataAMD (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); #endif -typedef void (GL_APIENTRYP PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint *numGroups, GLsizei groupsSize, GLuint *groups); -typedef void (GL_APIENTRYP PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); -typedef void (GL_APIENTRYP PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); -typedef void (GL_APIENTRYP PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); -typedef void (GL_APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, GLvoid *data); -typedef void (GL_APIENTRYP PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); -typedef void (GL_APIENTRYP PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); -typedef void (GL_APIENTRYP PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *countersList); -typedef void (GL_APIENTRYP PFNGLBEGINPERFMONITORAMDPROC) (GLuint monitor); -typedef void (GL_APIENTRYP PFNGLENDPERFMONITORAMDPROC) (GLuint monitor); -typedef void (GL_APIENTRYP PFNGLGETPERFMONITORCOUNTERDATAAMDPROC) (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); -#endif +#endif /* GL_AMD_performance_monitor */ -/* GL_AMD_program_binary_Z400 */ #ifndef GL_AMD_program_binary_Z400 #define GL_AMD_program_binary_Z400 1 -#endif +#define GL_Z400_BINARY_AMD 0x8740 +#endif /* GL_AMD_program_binary_Z400 */ -/*------------------------------------------------------------------------* - * ANGLE extension functions - *------------------------------------------------------------------------*/ +#ifndef GL_ANDROID_extension_pack_es31a +#define GL_ANDROID_extension_pack_es31a 1 +#endif /* GL_ANDROID_extension_pack_es31a */ -/* GL_ANGLE_depth_texture */ #ifndef GL_ANGLE_depth_texture #define GL_ANGLE_depth_texture 1 -#endif +#endif /* GL_ANGLE_depth_texture */ -/* GL_ANGLE_framebuffer_blit */ #ifndef GL_ANGLE_framebuffer_blit #define GL_ANGLE_framebuffer_blit 1 +#define GL_READ_FRAMEBUFFER_ANGLE 0x8CA8 +#define GL_DRAW_FRAMEBUFFER_ANGLE 0x8CA9 +#define GL_DRAW_FRAMEBUFFER_BINDING_ANGLE 0x8CA6 +#define GL_READ_FRAMEBUFFER_BINDING_ANGLE 0x8CAA +typedef void (GL_APIENTRYP PFNGLBLITFRAMEBUFFERANGLEPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glBlitFramebufferANGLE (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); #endif -typedef void (GL_APIENTRYP PFNGLBLITFRAMEBUFFERANGLEPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); -#endif +#endif /* GL_ANGLE_framebuffer_blit */ -/* GL_ANGLE_framebuffer_multisample */ #ifndef GL_ANGLE_framebuffer_multisample #define GL_ANGLE_framebuffer_multisample 1 +#define GL_RENDERBUFFER_SAMPLES_ANGLE 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_ANGLE 0x8D56 +#define GL_MAX_SAMPLES_ANGLE 0x8D57 +typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEANGLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleANGLE (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); #endif -typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEANGLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); -#endif +#endif /* GL_ANGLE_framebuffer_multisample */ #ifndef GL_ANGLE_instanced_arrays #define GL_ANGLE_instanced_arrays 1 +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_ANGLE 0x88FE +typedef void (GL_APIENTRYP PFNGLDRAWARRAYSINSTANCEDANGLEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDANGLEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIBDIVISORANGLEPROC) (GLuint index, GLuint divisor); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDrawArraysInstancedANGLE (GLenum mode, GLint first, GLsizei count, GLsizei primcount); GL_APICALL void GL_APIENTRY glDrawElementsInstancedANGLE (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); GL_APICALL void GL_APIENTRY glVertexAttribDivisorANGLE (GLuint index, GLuint divisor); #endif -typedef void (GL_APIENTRYP PFNGLDRAWARRAYSINSTANCEDANGLEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); -typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDANGLEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); -typedef void (GL_APIENTRYP PFNGLVERTEXATTRIBDIVISORANGLEPROC) (GLuint index, GLuint divisor); -#endif +#endif /* GL_ANGLE_instanced_arrays */ -/* GL_ANGLE_pack_reverse_row_order */ #ifndef GL_ANGLE_pack_reverse_row_order #define GL_ANGLE_pack_reverse_row_order 1 -#endif +#define GL_PACK_REVERSE_ROW_ORDER_ANGLE 0x93A4 +#endif /* GL_ANGLE_pack_reverse_row_order */ -/* GL_ANGLE_program_binary */ #ifndef GL_ANGLE_program_binary #define GL_ANGLE_program_binary 1 -#endif +#define GL_PROGRAM_BINARY_ANGLE 0x93A6 +#endif /* GL_ANGLE_program_binary */ -/* GL_ANGLE_texture_compression_dxt3 */ #ifndef GL_ANGLE_texture_compression_dxt3 #define GL_ANGLE_texture_compression_dxt3 1 -#endif +#define GL_COMPRESSED_RGBA_S3TC_DXT3_ANGLE 0x83F2 +#endif /* GL_ANGLE_texture_compression_dxt3 */ -/* GL_ANGLE_texture_compression_dxt5 */ #ifndef GL_ANGLE_texture_compression_dxt5 #define GL_ANGLE_texture_compression_dxt5 1 -#endif +#define GL_COMPRESSED_RGBA_S3TC_DXT5_ANGLE 0x83F3 +#endif /* GL_ANGLE_texture_compression_dxt5 */ -/* GL_ANGLE_texture_usage */ #ifndef GL_ANGLE_texture_usage #define GL_ANGLE_texture_usage 1 -#endif +#define GL_TEXTURE_USAGE_ANGLE 0x93A2 +#define GL_FRAMEBUFFER_ATTACHMENT_ANGLE 0x93A3 +#endif /* GL_ANGLE_texture_usage */ #ifndef GL_ANGLE_translated_shader_source #define GL_ANGLE_translated_shader_source 1 +#define GL_TRANSLATED_SHADER_SOURCE_LENGTH_ANGLE 0x93A0 +typedef void (GL_APIENTRYP PFNGLGETTRANSLATEDSHADERSOURCEANGLEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); #ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glGetTranslatedShaderSourceANGLE (GLuint shader, GLsizei bufsize, GLsizei *length, GLchar *source); -#endif -typedef void (GL_APIENTRYP PFNGLGETTRANSLATEDSHADERSOURCEANGLEPROC) (GLuint shader, GLsizei bufsize, GLsizei *length, GLchar *source); +GL_APICALL void GL_APIENTRY glGetTranslatedShaderSourceANGLE (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); #endif +#endif /* GL_ANGLE_translated_shader_source */ -/*------------------------------------------------------------------------* - * APPLE extension functions - *------------------------------------------------------------------------*/ +#ifndef GL_APPLE_clip_distance +#define GL_APPLE_clip_distance 1 +#define GL_MAX_CLIP_DISTANCES_APPLE 0x0D32 +#define GL_CLIP_DISTANCE0_APPLE 0x3000 +#define GL_CLIP_DISTANCE1_APPLE 0x3001 +#define GL_CLIP_DISTANCE2_APPLE 0x3002 +#define GL_CLIP_DISTANCE3_APPLE 0x3003 +#define GL_CLIP_DISTANCE4_APPLE 0x3004 +#define GL_CLIP_DISTANCE5_APPLE 0x3005 +#define GL_CLIP_DISTANCE6_APPLE 0x3006 +#define GL_CLIP_DISTANCE7_APPLE 0x3007 +#endif /* GL_APPLE_clip_distance */ + +#ifndef GL_APPLE_color_buffer_packed_float +#define GL_APPLE_color_buffer_packed_float 1 +#endif /* GL_APPLE_color_buffer_packed_float */ -/* GL_APPLE_copy_texture_levels */ #ifndef GL_APPLE_copy_texture_levels #define GL_APPLE_copy_texture_levels 1 +typedef void (GL_APIENTRYP PFNGLCOPYTEXTURELEVELSAPPLEPROC) (GLuint destinationTexture, GLuint sourceTexture, GLint sourceBaseLevel, GLsizei sourceLevelCount); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glCopyTextureLevelsAPPLE (GLuint destinationTexture, GLuint sourceTexture, GLint sourceBaseLevel, GLsizei sourceLevelCount); #endif -typedef void (GL_APIENTRYP PFNGLCOPYTEXTURELEVELSAPPLEPROC) (GLuint destinationTexture, GLuint sourceTexture, GLint sourceBaseLevel, GLsizei sourceLevelCount); -#endif +#endif /* GL_APPLE_copy_texture_levels */ -/* GL_APPLE_framebuffer_multisample */ #ifndef GL_APPLE_framebuffer_multisample #define GL_APPLE_framebuffer_multisample 1 +#define GL_RENDERBUFFER_SAMPLES_APPLE 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_APPLE 0x8D56 +#define GL_MAX_SAMPLES_APPLE 0x8D57 +#define GL_READ_FRAMEBUFFER_APPLE 0x8CA8 +#define GL_DRAW_FRAMEBUFFER_APPLE 0x8CA9 +#define GL_DRAW_FRAMEBUFFER_BINDING_APPLE 0x8CA6 +#define GL_READ_FRAMEBUFFER_BINDING_APPLE 0x8CAA +typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEAPPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLRESOLVEMULTISAMPLEFRAMEBUFFERAPPLEPROC) (void); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleAPPLE (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); GL_APICALL void GL_APIENTRY glResolveMultisampleFramebufferAPPLE (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEAPPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); -typedef void (GL_APIENTRYP PFNGLRESOLVEMULTISAMPLEFRAMEBUFFERAPPLEPROC) (void); #endif +#endif /* GL_APPLE_framebuffer_multisample */ -/* GL_APPLE_rgb_422 */ #ifndef GL_APPLE_rgb_422 #define GL_APPLE_rgb_422 1 -#endif +#define GL_RGB_422_APPLE 0x8A1F +#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB +#define GL_RGB_RAW_422_APPLE 0x8A51 +#endif /* GL_APPLE_rgb_422 */ -/* GL_APPLE_sync */ #ifndef GL_APPLE_sync #define GL_APPLE_sync 1 +#define GL_SYNC_OBJECT_APPLE 0x8A53 +#define GL_MAX_SERVER_WAIT_TIMEOUT_APPLE 0x9111 +#define GL_OBJECT_TYPE_APPLE 0x9112 +#define GL_SYNC_CONDITION_APPLE 0x9113 +#define GL_SYNC_STATUS_APPLE 0x9114 +#define GL_SYNC_FLAGS_APPLE 0x9115 +#define GL_SYNC_FENCE_APPLE 0x9116 +#define GL_SYNC_GPU_COMMANDS_COMPLETE_APPLE 0x9117 +#define GL_UNSIGNALED_APPLE 0x9118 +#define GL_SIGNALED_APPLE 0x9119 +#define GL_ALREADY_SIGNALED_APPLE 0x911A +#define GL_TIMEOUT_EXPIRED_APPLE 0x911B +#define GL_CONDITION_SATISFIED_APPLE 0x911C +#define GL_WAIT_FAILED_APPLE 0x911D +#define GL_SYNC_FLUSH_COMMANDS_BIT_APPLE 0x00000001 +#define GL_TIMEOUT_IGNORED_APPLE 0xFFFFFFFFFFFFFFFFull +typedef GLsync (GL_APIENTRYP PFNGLFENCESYNCAPPLEPROC) (GLenum condition, GLbitfield flags); +typedef GLboolean (GL_APIENTRYP PFNGLISSYNCAPPLEPROC) (GLsync sync); +typedef void (GL_APIENTRYP PFNGLDELETESYNCAPPLEPROC) (GLsync sync); +typedef GLenum (GL_APIENTRYP PFNGLCLIENTWAITSYNCAPPLEPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); +typedef void (GL_APIENTRYP PFNGLWAITSYNCAPPLEPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); +typedef void (GL_APIENTRYP PFNGLGETINTEGER64VAPPLEPROC) (GLenum pname, GLint64 *params); +typedef void (GL_APIENTRYP PFNGLGETSYNCIVAPPLEPROC) (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL GLsync GL_APIENTRY glFenceSyncAPPLE (GLenum condition, GLbitfield flags); GL_APICALL GLboolean GL_APIENTRY glIsSyncAPPLE (GLsync sync); @@ -1397,95 +1015,283 @@ GL_APICALL void GL_APIENTRY glDeleteSyncAPPLE (GLsync sync); GL_APICALL GLenum GL_APIENTRY glClientWaitSyncAPPLE (GLsync sync, GLbitfield flags, GLuint64 timeout); GL_APICALL void GL_APIENTRY glWaitSyncAPPLE (GLsync sync, GLbitfield flags, GLuint64 timeout); GL_APICALL void GL_APIENTRY glGetInteger64vAPPLE (GLenum pname, GLint64 *params); -GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); -#endif -typedef GLsync (GL_APIENTRYP PFNGLFENCESYNCAPPLEPROC) (GLenum condition, GLbitfield flags); -typedef GLboolean (GL_APIENTRYP PFNGLISSYNCAPPLEPROC) (GLsync sync); -typedef void (GL_APIENTRYP PFNGLDELETESYNCAPPLEPROC) (GLsync sync); -typedef GLenum (GL_APIENTRYP PFNGLCLIENTWAITSYNCAPPLEPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); -typedef void (GL_APIENTRYP PFNGLWAITSYNCAPPLEPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); -typedef void (GL_APIENTRYP PFNGLGETINTEGER64VAPPLEPROC) (GLenum pname, GLint64 *params); -typedef void (GL_APIENTRYP PFNGLGETSYNCIVAPPLEPROC) (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values); #endif +#endif /* GL_APPLE_sync */ -/* GL_APPLE_texture_format_BGRA8888 */ #ifndef GL_APPLE_texture_format_BGRA8888 #define GL_APPLE_texture_format_BGRA8888 1 -#endif +#define GL_BGRA_EXT 0x80E1 +#define GL_BGRA8_EXT 0x93A1 +#endif /* GL_APPLE_texture_format_BGRA8888 */ -/* GL_APPLE_texture_max_level */ #ifndef GL_APPLE_texture_max_level #define GL_APPLE_texture_max_level 1 -#endif +#define GL_TEXTURE_MAX_LEVEL_APPLE 0x813D +#endif /* GL_APPLE_texture_max_level */ -/*------------------------------------------------------------------------* - * ARM extension functions - *------------------------------------------------------------------------*/ +#ifndef GL_APPLE_texture_packed_float +#define GL_APPLE_texture_packed_float 1 +#define GL_UNSIGNED_INT_10F_11F_11F_REV_APPLE 0x8C3B +#define GL_UNSIGNED_INT_5_9_9_9_REV_APPLE 0x8C3E +#define GL_R11F_G11F_B10F_APPLE 0x8C3A +#define GL_RGB9_E5_APPLE 0x8C3D +#endif /* GL_APPLE_texture_packed_float */ -/* GL_ARM_mali_program_binary */ #ifndef GL_ARM_mali_program_binary #define GL_ARM_mali_program_binary 1 -#endif +#define GL_MALI_PROGRAM_BINARY_ARM 0x8F61 +#endif /* GL_ARM_mali_program_binary */ -/* GL_ARM_mali_shader_binary */ #ifndef GL_ARM_mali_shader_binary #define GL_ARM_mali_shader_binary 1 -#endif +#define GL_MALI_SHADER_BINARY_ARM 0x8F60 +#endif /* GL_ARM_mali_shader_binary */ -/* GL_ARM_rgba8 */ #ifndef GL_ARM_rgba8 #define GL_ARM_rgba8 1 +#endif /* GL_ARM_rgba8 */ + +#ifndef GL_ARM_shader_framebuffer_fetch +#define GL_ARM_shader_framebuffer_fetch 1 +#define GL_FETCH_PER_SAMPLE_ARM 0x8F65 +#define GL_FRAGMENT_SHADER_FRAMEBUFFER_FETCH_MRT_ARM 0x8F66 +#endif /* GL_ARM_shader_framebuffer_fetch */ + +#ifndef GL_ARM_shader_framebuffer_fetch_depth_stencil +#define GL_ARM_shader_framebuffer_fetch_depth_stencil 1 +#endif /* GL_ARM_shader_framebuffer_fetch_depth_stencil */ + +#ifndef GL_ARM_texture_unnormalized_coordinates +#define GL_ARM_texture_unnormalized_coordinates 1 +#define GL_TEXTURE_UNNORMALIZED_COORDINATES_ARM 0x8F6A +#endif /* GL_ARM_texture_unnormalized_coordinates */ + +#ifndef GL_DMP_program_binary +#define GL_DMP_program_binary 1 +#define GL_SMAPHS30_PROGRAM_BINARY_DMP 0x9251 +#define GL_SMAPHS_PROGRAM_BINARY_DMP 0x9252 +#define GL_DMP_PROGRAM_BINARY_DMP 0x9253 +#endif /* GL_DMP_program_binary */ + +#ifndef GL_DMP_shader_binary +#define GL_DMP_shader_binary 1 +#define GL_SHADER_BINARY_DMP 0x9250 +#endif /* GL_DMP_shader_binary */ + +#ifndef GL_EXT_EGL_image_array +#define GL_EXT_EGL_image_array 1 +#endif /* GL_EXT_EGL_image_array */ + +#ifndef GL_EXT_EGL_image_storage +#define GL_EXT_EGL_image_storage 1 +typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list); +typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list); +GL_APICALL void GL_APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list); #endif +#endif /* GL_EXT_EGL_image_storage */ -/*------------------------------------------------------------------------* - * EXT extension functions - *------------------------------------------------------------------------*/ +#ifndef GL_EXT_EGL_image_storage_compression +#define GL_EXT_EGL_image_storage_compression 1 +#define GL_SURFACE_COMPRESSION_EXT 0x96C0 +#define GL_SURFACE_COMPRESSION_FIXED_RATE_NONE_EXT 0x96C1 +#define GL_SURFACE_COMPRESSION_FIXED_RATE_DEFAULT_EXT 0x96C2 +#endif /* GL_EXT_EGL_image_storage_compression */ + +#ifndef GL_EXT_YUV_target +#define GL_EXT_YUV_target 1 +#define GL_SAMPLER_EXTERNAL_2D_Y2Y_EXT 0x8BE7 +#endif /* GL_EXT_YUV_target */ + +#ifndef GL_EXT_base_instance +#define GL_EXT_base_instance 1 +typedef void (GL_APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEEXTPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glDrawArraysInstancedBaseInstanceEXT (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); +GL_APICALL void GL_APIENTRY glDrawElementsInstancedBaseInstanceEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); +GL_APICALL void GL_APIENTRY glDrawElementsInstancedBaseVertexBaseInstanceEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); +#endif +#endif /* GL_EXT_base_instance */ + +#ifndef GL_EXT_blend_func_extended +#define GL_EXT_blend_func_extended 1 +#define GL_SRC1_COLOR_EXT 0x88F9 +#define GL_SRC1_ALPHA_EXT 0x8589 +#define GL_ONE_MINUS_SRC1_COLOR_EXT 0x88FA +#define GL_ONE_MINUS_SRC1_ALPHA_EXT 0x88FB +#define GL_SRC_ALPHA_SATURATE_EXT 0x0308 +#define GL_LOCATION_INDEX_EXT 0x930F +#define GL_MAX_DUAL_SOURCE_DRAW_BUFFERS_EXT 0x88FC +typedef void (GL_APIENTRYP PFNGLBINDFRAGDATALOCATIONINDEXEDEXTPROC) (GLuint program, GLuint colorNumber, GLuint index, const GLchar *name); +typedef void (GL_APIENTRYP PFNGLBINDFRAGDATALOCATIONEXTPROC) (GLuint program, GLuint color, const GLchar *name); +typedef GLint (GL_APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONINDEXEXTPROC) (GLuint program, GLenum programInterface, const GLchar *name); +typedef GLint (GL_APIENTRYP PFNGLGETFRAGDATAINDEXEXTPROC) (GLuint program, const GLchar *name); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBindFragDataLocationIndexedEXT (GLuint program, GLuint colorNumber, GLuint index, const GLchar *name); +GL_APICALL void GL_APIENTRY glBindFragDataLocationEXT (GLuint program, GLuint color, const GLchar *name); +GL_APICALL GLint GL_APIENTRY glGetProgramResourceLocationIndexEXT (GLuint program, GLenum programInterface, const GLchar *name); +GL_APICALL GLint GL_APIENTRY glGetFragDataIndexEXT (GLuint program, const GLchar *name); +#endif +#endif /* GL_EXT_blend_func_extended */ -/* GL_EXT_blend_minmax */ #ifndef GL_EXT_blend_minmax #define GL_EXT_blend_minmax 1 -#endif +#define GL_MIN_EXT 0x8007 +#define GL_MAX_EXT 0x8008 +#endif /* GL_EXT_blend_minmax */ + +#ifndef GL_EXT_buffer_storage +#define GL_EXT_buffer_storage 1 +#define GL_MAP_READ_BIT 0x0001 +#define GL_MAP_WRITE_BIT 0x0002 +#define GL_MAP_PERSISTENT_BIT_EXT 0x0040 +#define GL_MAP_COHERENT_BIT_EXT 0x0080 +#define GL_DYNAMIC_STORAGE_BIT_EXT 0x0100 +#define GL_CLIENT_STORAGE_BIT_EXT 0x0200 +#define GL_CLIENT_MAPPED_BUFFER_BARRIER_BIT_EXT 0x00004000 +#define GL_BUFFER_IMMUTABLE_STORAGE_EXT 0x821F +#define GL_BUFFER_STORAGE_FLAGS_EXT 0x8220 +typedef void (GL_APIENTRYP PFNGLBUFFERSTORAGEEXTPROC) (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBufferStorageEXT (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags); +#endif +#endif /* GL_EXT_buffer_storage */ + +#ifndef GL_EXT_clear_texture +#define GL_EXT_clear_texture 1 +typedef void (GL_APIENTRYP PFNGLCLEARTEXIMAGEEXTPROC) (GLuint texture, GLint level, GLenum format, GLenum type, const void *data); +typedef void (GL_APIENTRYP PFNGLCLEARTEXSUBIMAGEEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glClearTexImageEXT (GLuint texture, GLint level, GLenum format, GLenum type, const void *data); +GL_APICALL void GL_APIENTRY glClearTexSubImageEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data); +#endif +#endif /* GL_EXT_clear_texture */ + +#ifndef GL_EXT_clip_control +#define GL_EXT_clip_control 1 +#define GL_LOWER_LEFT_EXT 0x8CA1 +#define GL_UPPER_LEFT_EXT 0x8CA2 +#define GL_NEGATIVE_ONE_TO_ONE_EXT 0x935E +#define GL_ZERO_TO_ONE_EXT 0x935F +#define GL_CLIP_ORIGIN_EXT 0x935C +#define GL_CLIP_DEPTH_MODE_EXT 0x935D +typedef void (GL_APIENTRYP PFNGLCLIPCONTROLEXTPROC) (GLenum origin, GLenum depth); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glClipControlEXT (GLenum origin, GLenum depth); +#endif +#endif /* GL_EXT_clip_control */ + +#ifndef GL_EXT_clip_cull_distance +#define GL_EXT_clip_cull_distance 1 +#define GL_MAX_CLIP_DISTANCES_EXT 0x0D32 +#define GL_MAX_CULL_DISTANCES_EXT 0x82F9 +#define GL_MAX_COMBINED_CLIP_AND_CULL_DISTANCES_EXT 0x82FA +#define GL_CLIP_DISTANCE0_EXT 0x3000 +#define GL_CLIP_DISTANCE1_EXT 0x3001 +#define GL_CLIP_DISTANCE2_EXT 0x3002 +#define GL_CLIP_DISTANCE3_EXT 0x3003 +#define GL_CLIP_DISTANCE4_EXT 0x3004 +#define GL_CLIP_DISTANCE5_EXT 0x3005 +#define GL_CLIP_DISTANCE6_EXT 0x3006 +#define GL_CLIP_DISTANCE7_EXT 0x3007 +#endif /* GL_EXT_clip_cull_distance */ + +#ifndef GL_EXT_color_buffer_float +#define GL_EXT_color_buffer_float 1 +#endif /* GL_EXT_color_buffer_float */ -/* GL_EXT_color_buffer_half_float */ #ifndef GL_EXT_color_buffer_half_float #define GL_EXT_color_buffer_half_float 1 -#endif +#define GL_RGBA16F_EXT 0x881A +#define GL_RGB16F_EXT 0x881B +#define GL_RG16F_EXT 0x822F +#define GL_R16F_EXT 0x822D +#define GL_FRAMEBUFFER_ATTACHMENT_COMPONENT_TYPE_EXT 0x8211 +#define GL_UNSIGNED_NORMALIZED_EXT 0x8C17 +#endif /* GL_EXT_color_buffer_half_float */ + +#ifndef GL_EXT_conservative_depth +#define GL_EXT_conservative_depth 1 +#endif /* GL_EXT_conservative_depth */ + +#ifndef GL_EXT_copy_image +#define GL_EXT_copy_image 1 +typedef void (GL_APIENTRYP PFNGLCOPYIMAGESUBDATAEXTPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glCopyImageSubDataEXT (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +#endif +#endif /* GL_EXT_copy_image */ -/* GL_EXT_debug_label */ #ifndef GL_EXT_debug_label #define GL_EXT_debug_label 1 +#define GL_PROGRAM_PIPELINE_OBJECT_EXT 0x8A4F +#define GL_PROGRAM_OBJECT_EXT 0x8B40 +#define GL_SHADER_OBJECT_EXT 0x8B48 +#define GL_BUFFER_OBJECT_EXT 0x9151 +#define GL_QUERY_OBJECT_EXT 0x9153 +#define GL_VERTEX_ARRAY_OBJECT_EXT 0x9154 +#define GL_TRANSFORM_FEEDBACK 0x8E22 +typedef void (GL_APIENTRYP PFNGLLABELOBJECTEXTPROC) (GLenum type, GLuint object, GLsizei length, const GLchar *label); +typedef void (GL_APIENTRYP PFNGLGETOBJECTLABELEXTPROC) (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glLabelObjectEXT (GLenum type, GLuint object, GLsizei length, const GLchar *label); GL_APICALL void GL_APIENTRY glGetObjectLabelEXT (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); #endif -typedef void (GL_APIENTRYP PFNGLLABELOBJECTEXTPROC) (GLenum type, GLuint object, GLsizei length, const GLchar *label); -typedef void (GL_APIENTRYP PFNGLGETOBJECTLABELEXTPROC) (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); -#endif +#endif /* GL_EXT_debug_label */ -/* GL_EXT_debug_marker */ #ifndef GL_EXT_debug_marker #define GL_EXT_debug_marker 1 +typedef void (GL_APIENTRYP PFNGLINSERTEVENTMARKEREXTPROC) (GLsizei length, const GLchar *marker); +typedef void (GL_APIENTRYP PFNGLPUSHGROUPMARKEREXTPROC) (GLsizei length, const GLchar *marker); +typedef void (GL_APIENTRYP PFNGLPOPGROUPMARKEREXTPROC) (void); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glInsertEventMarkerEXT (GLsizei length, const GLchar *marker); GL_APICALL void GL_APIENTRY glPushGroupMarkerEXT (GLsizei length, const GLchar *marker); GL_APICALL void GL_APIENTRY glPopGroupMarkerEXT (void); #endif -typedef void (GL_APIENTRYP PFNGLINSERTEVENTMARKEREXTPROC) (GLsizei length, const GLchar *marker); -typedef void (GL_APIENTRYP PFNGLPUSHGROUPMARKEREXTPROC) (GLsizei length, const GLchar *marker); -typedef void (GL_APIENTRYP PFNGLPOPGROUPMARKEREXTPROC) (void); -#endif +#endif /* GL_EXT_debug_marker */ + +#ifndef GL_EXT_depth_clamp +#define GL_EXT_depth_clamp 1 +#define GL_DEPTH_CLAMP_EXT 0x864F +#endif /* GL_EXT_depth_clamp */ -/* GL_EXT_discard_framebuffer */ #ifndef GL_EXT_discard_framebuffer #define GL_EXT_discard_framebuffer 1 +#define GL_COLOR_EXT 0x1800 +#define GL_DEPTH_EXT 0x1801 +#define GL_STENCIL_EXT 0x1802 +typedef void (GL_APIENTRYP PFNGLDISCARDFRAMEBUFFEREXTPROC) (GLenum target, GLsizei numAttachments, const GLenum *attachments); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDiscardFramebufferEXT (GLenum target, GLsizei numAttachments, const GLenum *attachments); #endif -typedef void (GL_APIENTRYP PFNGLDISCARDFRAMEBUFFEREXTPROC) (GLenum target, GLsizei numAttachments, const GLenum *attachments); -#endif +#endif /* GL_EXT_discard_framebuffer */ #ifndef GL_EXT_disjoint_timer_query #define GL_EXT_disjoint_timer_query 1 +#define GL_QUERY_COUNTER_BITS_EXT 0x8864 +#define GL_CURRENT_QUERY_EXT 0x8865 +#define GL_QUERY_RESULT_EXT 0x8866 +#define GL_QUERY_RESULT_AVAILABLE_EXT 0x8867 +#define GL_TIME_ELAPSED_EXT 0x88BF +#define GL_TIMESTAMP_EXT 0x8E28 +#define GL_GPU_DISJOINT_EXT 0x8FBB +typedef void (GL_APIENTRYP PFNGLGENQUERIESEXTPROC) (GLsizei n, GLuint *ids); +typedef void (GL_APIENTRYP PFNGLDELETEQUERIESEXTPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (GL_APIENTRYP PFNGLISQUERYEXTPROC) (GLuint id); +typedef void (GL_APIENTRYP PFNGLBEGINQUERYEXTPROC) (GLenum target, GLuint id); +typedef void (GL_APIENTRYP PFNGLENDQUERYEXTPROC) (GLenum target); +typedef void (GL_APIENTRYP PFNGLQUERYCOUNTEREXTPROC) (GLuint id, GLenum target); +typedef void (GL_APIENTRYP PFNGLGETQUERYIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETQUERYOBJECTIVEXTPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETQUERYOBJECTUIVEXTPROC) (GLuint id, GLenum pname, GLuint *params); +typedef void (GL_APIENTRYP PFNGLGETQUERYOBJECTI64VEXTPROC) (GLuint id, GLenum pname, GLint64 *params); +typedef void (GL_APIENTRYP PFNGLGETQUERYOBJECTUI64VEXTPROC) (GLuint id, GLenum pname, GLuint64 *params); +typedef void (GL_APIENTRYP PFNGLGETINTEGER64VEXTPROC) (GLenum pname, GLint64 *data); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glGenQueriesEXT (GLsizei n, GLuint *ids); GL_APICALL void GL_APIENTRY glDeleteQueriesEXT (GLsizei n, const GLuint *ids); @@ -1498,209 +1304,991 @@ GL_APICALL void GL_APIENTRY glGetQueryObjectivEXT (GLuint id, GLenum pname, GLin GL_APICALL void GL_APIENTRY glGetQueryObjectuivEXT (GLuint id, GLenum pname, GLuint *params); GL_APICALL void GL_APIENTRY glGetQueryObjecti64vEXT (GLuint id, GLenum pname, GLint64 *params); GL_APICALL void GL_APIENTRY glGetQueryObjectui64vEXT (GLuint id, GLenum pname, GLuint64 *params); +GL_APICALL void GL_APIENTRY glGetInteger64vEXT (GLenum pname, GLint64 *data); #endif -typedef void (GL_APIENTRYP PFNGLGENQUERIESEXTPROC) (GLsizei n, GLuint *ids); -typedef void (GL_APIENTRYP PFNGLDELETEQUERIESEXTPROC) (GLsizei n, const GLuint *ids); -typedef GLboolean (GL_APIENTRYP PFNGLISQUERYEXTPROC) (GLuint id); -typedef void (GL_APIENTRYP PFNGLBEGINQUERYEXTPROC) (GLenum target, GLuint id); -typedef void (GL_APIENTRYP PFNGLENDQUERYEXTPROC) (GLenum target); -typedef void (GL_APIENTRYP PFNGLQUERYCOUNTEREXTPROC) (GLuint id, GLenum target); -typedef void (GL_APIENTRYP PFNGLGETQUERYIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (GL_APIENTRYP PFNGLGETQUERYOBJECTIVEXTPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (GL_APIENTRYP PFNGLGETQUERYOBJECTUIVEXTPROC) (GLuint id, GLenum pname, GLuint *params); -typedef void (GL_APIENTRYP PFNGLGETQUERYOBJECTI64VEXTPROC) (GLuint id, GLenum pname, GLint64 *params); -typedef void (GL_APIENTRYP PFNGLGETQUERYOBJECTUI64VEXTPROC) (GLuint id, GLenum pname, GLuint64 *params); #endif /* GL_EXT_disjoint_timer_query */ #ifndef GL_EXT_draw_buffers #define GL_EXT_draw_buffers 1 +#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF +#define GL_MAX_DRAW_BUFFERS_EXT 0x8824 +#define GL_DRAW_BUFFER0_EXT 0x8825 +#define GL_DRAW_BUFFER1_EXT 0x8826 +#define GL_DRAW_BUFFER2_EXT 0x8827 +#define GL_DRAW_BUFFER3_EXT 0x8828 +#define GL_DRAW_BUFFER4_EXT 0x8829 +#define GL_DRAW_BUFFER5_EXT 0x882A +#define GL_DRAW_BUFFER6_EXT 0x882B +#define GL_DRAW_BUFFER7_EXT 0x882C +#define GL_DRAW_BUFFER8_EXT 0x882D +#define GL_DRAW_BUFFER9_EXT 0x882E +#define GL_DRAW_BUFFER10_EXT 0x882F +#define GL_DRAW_BUFFER11_EXT 0x8830 +#define GL_DRAW_BUFFER12_EXT 0x8831 +#define GL_DRAW_BUFFER13_EXT 0x8832 +#define GL_DRAW_BUFFER14_EXT 0x8833 +#define GL_DRAW_BUFFER15_EXT 0x8834 +#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 +#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 +#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 +#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 +#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 +#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 +#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 +#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 +#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 +#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 +#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA +#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB +#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC +#define GL_COLOR_ATTACHMENT13_EXT 0x8CED +#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE +#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF +typedef void (GL_APIENTRYP PFNGLDRAWBUFFERSEXTPROC) (GLsizei n, const GLenum *bufs); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDrawBuffersEXT (GLsizei n, const GLenum *bufs); #endif -typedef void (GL_APIENTRYP PFNGLDRAWBUFFERSEXTPROC) (GLsizei n, const GLenum *bufs); #endif /* GL_EXT_draw_buffers */ -/* GL_EXT_map_buffer_range */ +#ifndef GL_EXT_draw_buffers_indexed +#define GL_EXT_draw_buffers_indexed 1 +typedef void (GL_APIENTRYP PFNGLENABLEIEXTPROC) (GLenum target, GLuint index); +typedef void (GL_APIENTRYP PFNGLDISABLEIEXTPROC) (GLenum target, GLuint index); +typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONIEXTPROC) (GLuint buf, GLenum mode); +typedef void (GL_APIENTRYP PFNGLBLENDEQUATIONSEPARATEIEXTPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (GL_APIENTRYP PFNGLBLENDFUNCIEXTPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (GL_APIENTRYP PFNGLBLENDFUNCSEPARATEIEXTPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +typedef void (GL_APIENTRYP PFNGLCOLORMASKIEXTPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +typedef GLboolean (GL_APIENTRYP PFNGLISENABLEDIEXTPROC) (GLenum target, GLuint index); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glEnableiEXT (GLenum target, GLuint index); +GL_APICALL void GL_APIENTRY glDisableiEXT (GLenum target, GLuint index); +GL_APICALL void GL_APIENTRY glBlendEquationiEXT (GLuint buf, GLenum mode); +GL_APICALL void GL_APIENTRY glBlendEquationSeparateiEXT (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +GL_APICALL void GL_APIENTRY glBlendFunciEXT (GLuint buf, GLenum src, GLenum dst); +GL_APICALL void GL_APIENTRY glBlendFuncSeparateiEXT (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +GL_APICALL void GL_APIENTRY glColorMaskiEXT (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +GL_APICALL GLboolean GL_APIENTRY glIsEnablediEXT (GLenum target, GLuint index); +#endif +#endif /* GL_EXT_draw_buffers_indexed */ + +#ifndef GL_EXT_draw_elements_base_vertex +#define GL_EXT_draw_elements_base_vertex 1 +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (GL_APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glDrawElementsBaseVertexEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GL_APICALL void GL_APIENTRY glDrawRangeElementsBaseVertexEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GL_APICALL void GL_APIENTRY glDrawElementsInstancedBaseVertexEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +#endif +#endif /* GL_EXT_draw_elements_base_vertex */ + +#ifndef GL_EXT_draw_instanced +#define GL_EXT_draw_instanced 1 +typedef void (GL_APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount); +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glDrawArraysInstancedEXT (GLenum mode, GLint start, GLsizei count, GLsizei primcount); +GL_APICALL void GL_APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#endif +#endif /* GL_EXT_draw_instanced */ + +#ifndef GL_EXT_draw_transform_feedback +#define GL_EXT_draw_transform_feedback 1 +typedef void (GL_APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKEXTPROC) (GLenum mode, GLuint id); +typedef void (GL_APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKINSTANCEDEXTPROC) (GLenum mode, GLuint id, GLsizei instancecount); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glDrawTransformFeedbackEXT (GLenum mode, GLuint id); +GL_APICALL void GL_APIENTRY glDrawTransformFeedbackInstancedEXT (GLenum mode, GLuint id, GLsizei instancecount); +#endif +#endif /* GL_EXT_draw_transform_feedback */ + +#ifndef GL_EXT_external_buffer +#define GL_EXT_external_buffer 1 +typedef void *GLeglClientBufferEXT; +typedef void (GL_APIENTRYP PFNGLBUFFERSTORAGEEXTERNALEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBufferStorageExternalEXT (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +GL_APICALL void GL_APIENTRY glNamedBufferStorageExternalEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#endif +#endif /* GL_EXT_external_buffer */ + +#ifndef GL_EXT_float_blend +#define GL_EXT_float_blend 1 +#endif /* GL_EXT_float_blend */ + +#ifndef GL_EXT_fragment_shading_rate +#define GL_EXT_fragment_shading_rate 1 +#define GL_SHADING_RATE_1X1_PIXELS_EXT 0x96A6 +#define GL_SHADING_RATE_1X2_PIXELS_EXT 0x96A7 +#define GL_SHADING_RATE_2X1_PIXELS_EXT 0x96A8 +#define GL_SHADING_RATE_2X2_PIXELS_EXT 0x96A9 +#define GL_SHADING_RATE_1X4_PIXELS_EXT 0x96AA +#define GL_SHADING_RATE_4X1_PIXELS_EXT 0x96AB +#define GL_SHADING_RATE_4X2_PIXELS_EXT 0x96AC +#define GL_SHADING_RATE_2X4_PIXELS_EXT 0x96AD +#define GL_SHADING_RATE_4X4_PIXELS_EXT 0x96AE +#define GL_SHADING_RATE_EXT 0x96D0 +#define GL_SHADING_RATE_ATTACHMENT_EXT 0x96D1 +#define GL_FRAGMENT_SHADING_RATE_COMBINER_OP_KEEP_EXT 0x96D2 +#define GL_FRAGMENT_SHADING_RATE_COMBINER_OP_REPLACE_EXT 0x96D3 +#define GL_FRAGMENT_SHADING_RATE_COMBINER_OP_MIN_EXT 0x96D4 +#define GL_FRAGMENT_SHADING_RATE_COMBINER_OP_MAX_EXT 0x96D5 +#define GL_FRAGMENT_SHADING_RATE_COMBINER_OP_MUL_EXT 0x96D6 +#define GL_MIN_FRAGMENT_SHADING_RATE_ATTACHMENT_TEXEL_WIDTH_EXT 0x96D7 +#define GL_MAX_FRAGMENT_SHADING_RATE_ATTACHMENT_TEXEL_WIDTH_EXT 0x96D8 +#define GL_MIN_FRAGMENT_SHADING_RATE_ATTACHMENT_TEXEL_HEIGHT_EXT 0x96D9 +#define GL_MAX_FRAGMENT_SHADING_RATE_ATTACHMENT_TEXEL_HEIGHT_EXT 0x96DA +#define GL_MAX_FRAGMENT_SHADING_RATE_ATTACHMENT_TEXEL_ASPECT_RATIO_EXT 0x96DB +#define GL_MAX_FRAGMENT_SHADING_RATE_ATTACHMENT_LAYERS_EXT 0x96DC +#define GL_FRAGMENT_SHADING_RATE_WITH_SHADER_DEPTH_STENCIL_WRITES_SUPPORTED_EXT 0x96DD +#define GL_FRAGMENT_SHADING_RATE_WITH_SAMPLE_MASK_SUPPORTED_EXT 0x96DE +#define GL_FRAGMENT_SHADING_RATE_ATTACHMENT_WITH_DEFAULT_FRAMEBUFFER_SUPPORTED_EXT 0x96DF +#define GL_FRAGMENT_SHADING_RATE_NON_TRIVIAL_COMBINERS_SUPPORTED_EXT 0x8F6F +typedef void (GL_APIENTRYP PFNGLGETFRAGMENTSHADINGRATESEXTPROC) (GLsizei samples, GLsizei maxCount, GLsizei *count, GLenum *shadingRates); +typedef void (GL_APIENTRYP PFNGLSHADINGRATEEXTPROC) (GLenum rate); +typedef void (GL_APIENTRYP PFNGLSHADINGRATECOMBINEROPSEXTPROC) (GLenum combinerOp0, GLenum combinerOp1); +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERSHADINGRATEEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint baseLayer, GLsizei numLayers, GLsizei texelWidth, GLsizei texelHeight); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetFragmentShadingRatesEXT (GLsizei samples, GLsizei maxCount, GLsizei *count, GLenum *shadingRates); +GL_APICALL void GL_APIENTRY glShadingRateEXT (GLenum rate); +GL_APICALL void GL_APIENTRY glShadingRateCombinerOpsEXT (GLenum combinerOp0, GLenum combinerOp1); +GL_APICALL void GL_APIENTRY glFramebufferShadingRateEXT (GLenum target, GLenum attachment, GLuint texture, GLint baseLayer, GLsizei numLayers, GLsizei texelWidth, GLsizei texelHeight); +#endif +#endif /* GL_EXT_fragment_shading_rate */ + +#ifndef GL_EXT_geometry_point_size +#define GL_EXT_geometry_point_size 1 +#endif /* GL_EXT_geometry_point_size */ + +#ifndef GL_EXT_geometry_shader +#define GL_EXT_geometry_shader 1 +#define GL_GEOMETRY_SHADER_EXT 0x8DD9 +#define GL_GEOMETRY_SHADER_BIT_EXT 0x00000004 +#define GL_GEOMETRY_LINKED_VERTICES_OUT_EXT 0x8916 +#define GL_GEOMETRY_LINKED_INPUT_TYPE_EXT 0x8917 +#define GL_GEOMETRY_LINKED_OUTPUT_TYPE_EXT 0x8918 +#define GL_GEOMETRY_SHADER_INVOCATIONS_EXT 0x887F +#define GL_LAYER_PROVOKING_VERTEX_EXT 0x825E +#define GL_LINES_ADJACENCY_EXT 0x000A +#define GL_LINE_STRIP_ADJACENCY_EXT 0x000B +#define GL_TRIANGLES_ADJACENCY_EXT 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY_EXT 0x000D +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS_EXT 0x8A2C +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8A32 +#define GL_MAX_GEOMETRY_INPUT_COMPONENTS_EXT 0x9123 +#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS_EXT 0x9124 +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1 +#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS_EXT 0x8E5A +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29 +#define GL_MAX_GEOMETRY_ATOMIC_COUNTER_BUFFERS_EXT 0x92CF +#define GL_MAX_GEOMETRY_ATOMIC_COUNTERS_EXT 0x92D5 +#define GL_MAX_GEOMETRY_IMAGE_UNIFORMS_EXT 0x90CD +#define GL_MAX_GEOMETRY_SHADER_STORAGE_BLOCKS_EXT 0x90D7 +#define GL_FIRST_VERTEX_CONVENTION_EXT 0x8E4D +#define GL_LAST_VERTEX_CONVENTION_EXT 0x8E4E +#define GL_UNDEFINED_VERTEX_EXT 0x8260 +#define GL_PRIMITIVES_GENERATED_EXT 0x8C87 +#define GL_FRAMEBUFFER_DEFAULT_LAYERS_EXT 0x9312 +#define GL_MAX_FRAMEBUFFER_LAYERS_EXT 0x9317 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7 +#define GL_REFERENCED_BY_GEOMETRY_SHADER_EXT 0x9309 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferTextureEXT (GLenum target, GLenum attachment, GLuint texture, GLint level); +#endif +#endif /* GL_EXT_geometry_shader */ + +#ifndef GL_EXT_gpu_shader5 +#define GL_EXT_gpu_shader5 1 +#endif /* GL_EXT_gpu_shader5 */ + +#ifndef GL_EXT_instanced_arrays +#define GL_EXT_instanced_arrays 1 +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_EXT 0x88FE +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIBDIVISOREXTPROC) (GLuint index, GLuint divisor); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glVertexAttribDivisorEXT (GLuint index, GLuint divisor); +#endif +#endif /* GL_EXT_instanced_arrays */ + #ifndef GL_EXT_map_buffer_range #define GL_EXT_map_buffer_range 1 +#define GL_MAP_READ_BIT_EXT 0x0001 +#define GL_MAP_WRITE_BIT_EXT 0x0002 +#define GL_MAP_INVALIDATE_RANGE_BIT_EXT 0x0004 +#define GL_MAP_INVALIDATE_BUFFER_BIT_EXT 0x0008 +#define GL_MAP_FLUSH_EXPLICIT_BIT_EXT 0x0010 +#define GL_MAP_UNSYNCHRONIZED_BIT_EXT 0x0020 +typedef void *(GL_APIENTRYP PFNGLMAPBUFFERRANGEEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef void (GL_APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr length); #ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void* GL_APIENTRY glMapBufferRangeEXT (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); +GL_APICALL void *GL_APIENTRY glMapBufferRangeEXT (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); GL_APICALL void GL_APIENTRY glFlushMappedBufferRangeEXT (GLenum target, GLintptr offset, GLsizeiptr length); #endif -typedef void* (GL_APIENTRYP PFNGLMAPBUFFERRANGEEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); -typedef void (GL_APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr length); -#endif +#endif /* GL_EXT_map_buffer_range */ + +#ifndef GL_EXT_memory_object +#define GL_EXT_memory_object 1 +#define GL_TEXTURE_TILING_EXT 0x9580 +#define GL_DEDICATED_MEMORY_OBJECT_EXT 0x9581 +#define GL_PROTECTED_MEMORY_OBJECT_EXT 0x959B +#define GL_NUM_TILING_TYPES_EXT 0x9582 +#define GL_TILING_TYPES_EXT 0x9583 +#define GL_OPTIMAL_TILING_EXT 0x9584 +#define GL_LINEAR_TILING_EXT 0x9585 +#define GL_NUM_DEVICE_UUIDS_EXT 0x9596 +#define GL_DEVICE_UUID_EXT 0x9597 +#define GL_DRIVER_UUID_EXT 0x9598 +#define GL_UUID_SIZE_EXT 16 +typedef void (GL_APIENTRYP PFNGLGETUNSIGNEDBYTEVEXTPROC) (GLenum pname, GLubyte *data); +typedef void (GL_APIENTRYP PFNGLGETUNSIGNEDBYTEI_VEXTPROC) (GLenum target, GLuint index, GLubyte *data); +typedef void (GL_APIENTRYP PFNGLDELETEMEMORYOBJECTSEXTPROC) (GLsizei n, const GLuint *memoryObjects); +typedef GLboolean (GL_APIENTRYP PFNGLISMEMORYOBJECTEXTPROC) (GLuint memoryObject); +typedef void (GL_APIENTRYP PFNGLCREATEMEMORYOBJECTSEXTPROC) (GLsizei n, GLuint *memoryObjects); +typedef void (GL_APIENTRYP PFNGLMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, const GLint *params); +typedef void (GL_APIENTRYP PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLBUFFERSTORAGEMEMEXTPROC) (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM2DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM3DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC) (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetUnsignedBytevEXT (GLenum pname, GLubyte *data); +GL_APICALL void GL_APIENTRY glGetUnsignedBytei_vEXT (GLenum target, GLuint index, GLubyte *data); +GL_APICALL void GL_APIENTRY glDeleteMemoryObjectsEXT (GLsizei n, const GLuint *memoryObjects); +GL_APICALL GLboolean GL_APIENTRY glIsMemoryObjectEXT (GLuint memoryObject); +GL_APICALL void GL_APIENTRY glCreateMemoryObjectsEXT (GLsizei n, GLuint *memoryObjects); +GL_APICALL void GL_APIENTRY glMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, const GLint *params); +GL_APICALL void GL_APIENTRY glGetMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glTexStorageMem2DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem2DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem3DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem3DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glBufferStorageMemEXT (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem2DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem2DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem3DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem3DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glNamedBufferStorageMemEXT (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_EXT_memory_object */ + +#ifndef GL_EXT_memory_object_fd +#define GL_EXT_memory_object_fd 1 +#define GL_HANDLE_TYPE_OPAQUE_FD_EXT 0x9586 +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYFDEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportMemoryFdEXT (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_memory_object_fd */ + +#ifndef GL_EXT_memory_object_win32 +#define GL_EXT_memory_object_win32 1 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_EXT 0x9587 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_KMT_EXT 0x9588 +#define GL_DEVICE_LUID_EXT 0x9599 +#define GL_DEVICE_NODE_MASK_EXT 0x959A +#define GL_LUID_SIZE_EXT 8 +#define GL_HANDLE_TYPE_D3D12_TILEPOOL_EXT 0x9589 +#define GL_HANDLE_TYPE_D3D12_RESOURCE_EXT 0x958A +#define GL_HANDLE_TYPE_D3D11_IMAGE_EXT 0x958B +#define GL_HANDLE_TYPE_D3D11_IMAGE_KMT_EXT 0x958C +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYWIN32NAMEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportMemoryWin32HandleEXT (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +GL_APICALL void GL_APIENTRY glImportMemoryWin32NameEXT (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_memory_object_win32 */ + +#ifndef GL_EXT_multi_draw_arrays +#define GL_EXT_multi_draw_arrays 1 +typedef void (GL_APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glMultiDrawArraysEXT (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +GL_APICALL void GL_APIENTRY glMultiDrawElementsEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount); +#endif +#endif /* GL_EXT_multi_draw_arrays */ + +#ifndef GL_EXT_multi_draw_indirect +#define GL_EXT_multi_draw_indirect 1 +typedef void (GL_APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTEXTPROC) (GLenum mode, const void *indirect, GLsizei drawcount, GLsizei stride); +typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTEXTPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glMultiDrawArraysIndirectEXT (GLenum mode, const void *indirect, GLsizei drawcount, GLsizei stride); +GL_APICALL void GL_APIENTRY glMultiDrawElementsIndirectEXT (GLenum mode, GLenum type, const void *indirect, GLsizei drawcount, GLsizei stride); +#endif +#endif /* GL_EXT_multi_draw_indirect */ + +#ifndef GL_EXT_multisampled_compatibility +#define GL_EXT_multisampled_compatibility 1 +#define GL_MULTISAMPLE_EXT 0x809D +#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F +#endif /* GL_EXT_multisampled_compatibility */ -/* GL_EXT_multisampled_render_to_texture */ #ifndef GL_EXT_multisampled_render_to_texture #define GL_EXT_multisampled_render_to_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleEXT (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); -GL_APICALL void GL_APIENTRY glFramebufferTexture2DMultisampleEXT (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLsizei samples); -#endif +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_SAMPLES_EXT 0x8D6C +#define GL_RENDERBUFFER_SAMPLES_EXT 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_EXT 0x8D56 +#define GL_MAX_SAMPLES_EXT 0x8D57 typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DMULTISAMPLEEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLsizei samples); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleEXT (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glFramebufferTexture2DMultisampleEXT (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLsizei samples); #endif +#endif /* GL_EXT_multisampled_render_to_texture */ + +#ifndef GL_EXT_multisampled_render_to_texture2 +#define GL_EXT_multisampled_render_to_texture2 1 +#endif /* GL_EXT_multisampled_render_to_texture2 */ -/* GL_EXT_multiview_draw_buffers */ #ifndef GL_EXT_multiview_draw_buffers #define GL_EXT_multiview_draw_buffers 1 +#define GL_COLOR_ATTACHMENT_EXT 0x90F0 +#define GL_MULTIVIEW_EXT 0x90F1 +#define GL_DRAW_BUFFER_EXT 0x0C01 +#define GL_READ_BUFFER_EXT 0x0C02 +#define GL_MAX_MULTIVIEW_BUFFERS_EXT 0x90F2 +typedef void (GL_APIENTRYP PFNGLREADBUFFERINDEXEDEXTPROC) (GLenum src, GLint index); +typedef void (GL_APIENTRYP PFNGLDRAWBUFFERSINDEXEDEXTPROC) (GLint n, const GLenum *location, const GLint *indices); +typedef void (GL_APIENTRYP PFNGLGETINTEGERI_VEXTPROC) (GLenum target, GLuint index, GLint *data); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glReadBufferIndexedEXT (GLenum src, GLint index); GL_APICALL void GL_APIENTRY glDrawBuffersIndexedEXT (GLint n, const GLenum *location, const GLint *indices); GL_APICALL void GL_APIENTRY glGetIntegeri_vEXT (GLenum target, GLuint index, GLint *data); #endif -typedef void (GL_APIENTRYP PFNGLREADBUFFERINDEXEDEXTPROC) (GLenum src, GLint index); -typedef void (GL_APIENTRYP PFNGLDRAWBUFFERSINDEXEDEXTPROC) (GLint n, const GLenum *location, const GLint *indices); -typedef void (GL_APIENTRYP PFNGLGETINTEGERI_VEXTPROC) (GLenum target, GLuint index, GLint *data); -#endif +#endif /* GL_EXT_multiview_draw_buffers */ -#ifndef GL_EXT_multi_draw_arrays -#define GL_EXT_multi_draw_arrays 1 -#ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glMultiDrawArraysEXT (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); -GL_APICALL void GL_APIENTRY glMultiDrawElementsEXT (GLenum mode, const GLsizei *count, GLenum type, const GLvoid **indices, GLsizei primcount); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (GL_APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); -typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid **indices, GLsizei primcount); -#endif +#ifndef GL_EXT_multiview_tessellation_geometry_shader +#define GL_EXT_multiview_tessellation_geometry_shader 1 +#endif /* GL_EXT_multiview_tessellation_geometry_shader */ + +#ifndef GL_EXT_multiview_texture_multisample +#define GL_EXT_multiview_texture_multisample 1 +#endif /* GL_EXT_multiview_texture_multisample */ + +#ifndef GL_EXT_multiview_timer_query +#define GL_EXT_multiview_timer_query 1 +#endif /* GL_EXT_multiview_timer_query */ -/* GL_EXT_occlusion_query_boolean */ #ifndef GL_EXT_occlusion_query_boolean #define GL_EXT_occlusion_query_boolean 1 -/* All entry points also exist in GL_EXT_disjoint_timer_query */ -#endif +#define GL_ANY_SAMPLES_PASSED_EXT 0x8C2F +#define GL_ANY_SAMPLES_PASSED_CONSERVATIVE_EXT 0x8D6A +#endif /* GL_EXT_occlusion_query_boolean */ + +#ifndef GL_EXT_polygon_offset_clamp +#define GL_EXT_polygon_offset_clamp 1 +#define GL_POLYGON_OFFSET_CLAMP_EXT 0x8E1B +typedef void (GL_APIENTRYP PFNGLPOLYGONOFFSETCLAMPEXTPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glPolygonOffsetClampEXT (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_EXT_polygon_offset_clamp */ + +#ifndef GL_EXT_post_depth_coverage +#define GL_EXT_post_depth_coverage 1 +#endif /* GL_EXT_post_depth_coverage */ + +#ifndef GL_EXT_primitive_bounding_box +#define GL_EXT_primitive_bounding_box 1 +#define GL_PRIMITIVE_BOUNDING_BOX_EXT 0x92BE +typedef void (GL_APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXEXTPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glPrimitiveBoundingBoxEXT (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#endif +#endif /* GL_EXT_primitive_bounding_box */ + +#ifndef GL_EXT_protected_textures +#define GL_EXT_protected_textures 1 +#define GL_CONTEXT_FLAG_PROTECTED_CONTENT_BIT_EXT 0x00000010 +#define GL_TEXTURE_PROTECTED_EXT 0x8BFA +#endif /* GL_EXT_protected_textures */ + +#ifndef GL_EXT_pvrtc_sRGB +#define GL_EXT_pvrtc_sRGB 1 +#define GL_COMPRESSED_SRGB_PVRTC_2BPPV1_EXT 0x8A54 +#define GL_COMPRESSED_SRGB_PVRTC_4BPPV1_EXT 0x8A55 +#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_2BPPV1_EXT 0x8A56 +#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_4BPPV1_EXT 0x8A57 +#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_2BPPV2_IMG 0x93F0 +#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_4BPPV2_IMG 0x93F1 +#endif /* GL_EXT_pvrtc_sRGB */ + +#ifndef GL_EXT_raster_multisample +#define GL_EXT_raster_multisample 1 +#define GL_RASTER_MULTISAMPLE_EXT 0x9327 +#define GL_RASTER_SAMPLES_EXT 0x9328 +#define GL_MAX_RASTER_SAMPLES_EXT 0x9329 +#define GL_RASTER_FIXED_SAMPLE_LOCATIONS_EXT 0x932A +#define GL_MULTISAMPLE_RASTERIZATION_ALLOWED_EXT 0x932B +#define GL_EFFECTIVE_RASTER_SAMPLES_EXT 0x932C +typedef void (GL_APIENTRYP PFNGLRASTERSAMPLESEXTPROC) (GLuint samples, GLboolean fixedsamplelocations); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glRasterSamplesEXT (GLuint samples, GLboolean fixedsamplelocations); +#endif +#endif /* GL_EXT_raster_multisample */ -/* GL_EXT_read_format_bgra */ #ifndef GL_EXT_read_format_bgra #define GL_EXT_read_format_bgra 1 -#endif +#define GL_UNSIGNED_SHORT_4_4_4_4_REV_EXT 0x8365 +#define GL_UNSIGNED_SHORT_1_5_5_5_REV_EXT 0x8366 +#endif /* GL_EXT_read_format_bgra */ + +#ifndef GL_EXT_render_snorm +#define GL_EXT_render_snorm 1 +#define GL_R8_SNORM 0x8F94 +#define GL_RG8_SNORM 0x8F95 +#define GL_RGBA8_SNORM 0x8F97 +#define GL_R16_SNORM_EXT 0x8F98 +#define GL_RG16_SNORM_EXT 0x8F99 +#define GL_RGBA16_SNORM_EXT 0x8F9B +#endif /* GL_EXT_render_snorm */ -/* GL_EXT_robustness */ #ifndef GL_EXT_robustness #define GL_EXT_robustness 1 +#define GL_GUILTY_CONTEXT_RESET_EXT 0x8253 +#define GL_INNOCENT_CONTEXT_RESET_EXT 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET_EXT 0x8255 +#define GL_CONTEXT_ROBUST_ACCESS_EXT 0x90F3 +#define GL_RESET_NOTIFICATION_STRATEGY_EXT 0x8256 +#define GL_LOSE_CONTEXT_ON_RESET_EXT 0x8252 +#define GL_NO_RESET_NOTIFICATION_EXT 0x8261 +typedef GLenum (GL_APIENTRYP PFNGLGETGRAPHICSRESETSTATUSEXTPROC) (void); +typedef void (GL_APIENTRYP PFNGLREADNPIXELSEXTPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (GL_APIENTRYP PFNGLGETNUNIFORMFVEXTPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (GL_APIENTRYP PFNGLGETNUNIFORMIVEXTPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL GLenum GL_APIENTRY glGetGraphicsResetStatusEXT (void); -GL_APICALL void GL_APIENTRY glReadnPixelsEXT (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, GLvoid *data); +GL_APICALL void GL_APIENTRY glReadnPixelsEXT (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); GL_APICALL void GL_APIENTRY glGetnUniformfvEXT (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); GL_APICALL void GL_APIENTRY glGetnUniformivEXT (GLuint program, GLint location, GLsizei bufSize, GLint *params); #endif -typedef GLenum (GL_APIENTRYP PFNGLGETGRAPHICSRESETSTATUSEXTPROC) (void); -typedef void (GL_APIENTRYP PFNGLREADNPIXELSEXTPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, GLvoid *data); -typedef void (GL_APIENTRYP PFNGLGETNUNIFORMFVEXTPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); -typedef void (GL_APIENTRYP PFNGLGETNUNIFORMIVEXTPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); -#endif +#endif /* GL_EXT_robustness */ + +#ifndef GL_EXT_sRGB +#define GL_EXT_sRGB 1 +#define GL_SRGB_EXT 0x8C40 +#define GL_SRGB_ALPHA_EXT 0x8C42 +#define GL_SRGB8_ALPHA8_EXT 0x8C43 +#define GL_FRAMEBUFFER_ATTACHMENT_COLOR_ENCODING_EXT 0x8210 +#endif /* GL_EXT_sRGB */ + +#ifndef GL_EXT_sRGB_write_control +#define GL_EXT_sRGB_write_control 1 +#define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 +#endif /* GL_EXT_sRGB_write_control */ + +#ifndef GL_EXT_semaphore +#define GL_EXT_semaphore 1 +#define GL_LAYOUT_GENERAL_EXT 0x958D +#define GL_LAYOUT_COLOR_ATTACHMENT_EXT 0x958E +#define GL_LAYOUT_DEPTH_STENCIL_ATTACHMENT_EXT 0x958F +#define GL_LAYOUT_DEPTH_STENCIL_READ_ONLY_EXT 0x9590 +#define GL_LAYOUT_SHADER_READ_ONLY_EXT 0x9591 +#define GL_LAYOUT_TRANSFER_SRC_EXT 0x9592 +#define GL_LAYOUT_TRANSFER_DST_EXT 0x9593 +#define GL_LAYOUT_DEPTH_READ_ONLY_STENCIL_ATTACHMENT_EXT 0x9530 +#define GL_LAYOUT_DEPTH_ATTACHMENT_STENCIL_READ_ONLY_EXT 0x9531 +typedef void (GL_APIENTRYP PFNGLGENSEMAPHORESEXTPROC) (GLsizei n, GLuint *semaphores); +typedef void (GL_APIENTRYP PFNGLDELETESEMAPHORESEXTPROC) (GLsizei n, const GLuint *semaphores); +typedef GLboolean (GL_APIENTRYP PFNGLISSEMAPHOREEXTPROC) (GLuint semaphore); +typedef void (GL_APIENTRYP PFNGLSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, const GLuint64 *params); +typedef void (GL_APIENTRYP PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, GLuint64 *params); +typedef void (GL_APIENTRYP PFNGLWAITSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +typedef void (GL_APIENTRYP PFNGLSIGNALSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGenSemaphoresEXT (GLsizei n, GLuint *semaphores); +GL_APICALL void GL_APIENTRY glDeleteSemaphoresEXT (GLsizei n, const GLuint *semaphores); +GL_APICALL GLboolean GL_APIENTRY glIsSemaphoreEXT (GLuint semaphore); +GL_APICALL void GL_APIENTRY glSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, const GLuint64 *params); +GL_APICALL void GL_APIENTRY glGetSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, GLuint64 *params); +GL_APICALL void GL_APIENTRY glWaitSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +GL_APICALL void GL_APIENTRY glSignalSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#endif +#endif /* GL_EXT_semaphore */ + +#ifndef GL_EXT_semaphore_fd +#define GL_EXT_semaphore_fd 1 +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREFDEXTPROC) (GLuint semaphore, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportSemaphoreFdEXT (GLuint semaphore, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_semaphore_fd */ + +#ifndef GL_EXT_semaphore_win32 +#define GL_EXT_semaphore_win32 1 +#define GL_HANDLE_TYPE_D3D12_FENCE_EXT 0x9594 +#define GL_D3D12_FENCE_VALUE_EXT 0x9595 +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC) (GLuint semaphore, GLenum handleType, void *handle); +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC) (GLuint semaphore, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportSemaphoreWin32HandleEXT (GLuint semaphore, GLenum handleType, void *handle); +GL_APICALL void GL_APIENTRY glImportSemaphoreWin32NameEXT (GLuint semaphore, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_semaphore_win32 */ + +#ifndef GL_EXT_separate_depth_stencil +#define GL_EXT_separate_depth_stencil 1 +#endif /* GL_EXT_separate_depth_stencil */ -/* GL_EXT_separate_shader_objects */ #ifndef GL_EXT_separate_shader_objects #define GL_EXT_separate_shader_objects 1 -#ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glUseProgramStagesEXT (GLuint pipeline, GLbitfield stages, GLuint program); -GL_APICALL void GL_APIENTRY glActiveShaderProgramEXT (GLuint pipeline, GLuint program); -GL_APICALL GLuint GL_APIENTRY glCreateShaderProgramvEXT (GLenum type, GLsizei count, const GLchar **strings); -GL_APICALL void GL_APIENTRY glBindProgramPipelineEXT (GLuint pipeline); -GL_APICALL void GL_APIENTRY glDeleteProgramPipelinesEXT (GLsizei n, const GLuint *pipelines); -GL_APICALL void GL_APIENTRY glGenProgramPipelinesEXT (GLsizei n, GLuint *pipelines); -GL_APICALL GLboolean GL_APIENTRY glIsProgramPipelineEXT (GLuint pipeline); -GL_APICALL void GL_APIENTRY glProgramParameteriEXT (GLuint program, GLenum pname, GLint value); -GL_APICALL void GL_APIENTRY glGetProgramPipelineivEXT (GLuint pipeline, GLenum pname, GLint *params); -GL_APICALL void GL_APIENTRY glProgramUniform1iEXT (GLuint program, GLint location, GLint x); -GL_APICALL void GL_APIENTRY glProgramUniform2iEXT (GLuint program, GLint location, GLint x, GLint y); -GL_APICALL void GL_APIENTRY glProgramUniform3iEXT (GLuint program, GLint location, GLint x, GLint y, GLint z); -GL_APICALL void GL_APIENTRY glProgramUniform4iEXT (GLuint program, GLint location, GLint x, GLint y, GLint z, GLint w); -GL_APICALL void GL_APIENTRY glProgramUniform1fEXT (GLuint program, GLint location, GLfloat x); -GL_APICALL void GL_APIENTRY glProgramUniform2fEXT (GLuint program, GLint location, GLfloat x, GLfloat y); -GL_APICALL void GL_APIENTRY glProgramUniform3fEXT (GLuint program, GLint location, GLfloat x, GLfloat y, GLfloat z); -GL_APICALL void GL_APIENTRY glProgramUniform4fEXT (GLuint program, GLint location, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -GL_APICALL void GL_APIENTRY glProgramUniform1ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); -GL_APICALL void GL_APIENTRY glProgramUniform2ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); -GL_APICALL void GL_APIENTRY glProgramUniform3ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); -GL_APICALL void GL_APIENTRY glProgramUniform4ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); -GL_APICALL void GL_APIENTRY glProgramUniform1fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); -GL_APICALL void GL_APIENTRY glProgramUniform2fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); -GL_APICALL void GL_APIENTRY glProgramUniform3fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); -GL_APICALL void GL_APIENTRY glProgramUniform4fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); -GL_APICALL void GL_APIENTRY glProgramUniformMatrix2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -GL_APICALL void GL_APIENTRY glProgramUniformMatrix3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -GL_APICALL void GL_APIENTRY glProgramUniformMatrix4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -GL_APICALL void GL_APIENTRY glValidateProgramPipelineEXT (GLuint pipeline); -GL_APICALL void GL_APIENTRY glGetProgramPipelineInfoLogEXT (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); -#endif -typedef void (GL_APIENTRYP PFNGLUSEPROGRAMSTAGESEXTPROC) (GLuint pipeline, GLbitfield stages, GLuint program); +#define GL_ACTIVE_PROGRAM_EXT 0x8259 +#define GL_VERTEX_SHADER_BIT_EXT 0x00000001 +#define GL_FRAGMENT_SHADER_BIT_EXT 0x00000002 +#define GL_ALL_SHADER_BITS_EXT 0xFFFFFFFF +#define GL_PROGRAM_SEPARABLE_EXT 0x8258 +#define GL_PROGRAM_PIPELINE_BINDING_EXT 0x825A typedef void (GL_APIENTRYP PFNGLACTIVESHADERPROGRAMEXTPROC) (GLuint pipeline, GLuint program); -typedef GLuint (GL_APIENTRYP PFNGLCREATESHADERPROGRAMVEXTPROC) (GLenum type, GLsizei count, const GLchar **strings); typedef void (GL_APIENTRYP PFNGLBINDPROGRAMPIPELINEEXTPROC) (GLuint pipeline); +typedef GLuint (GL_APIENTRYP PFNGLCREATESHADERPROGRAMVEXTPROC) (GLenum type, GLsizei count, const GLchar **strings); typedef void (GL_APIENTRYP PFNGLDELETEPROGRAMPIPELINESEXTPROC) (GLsizei n, const GLuint *pipelines); typedef void (GL_APIENTRYP PFNGLGENPROGRAMPIPELINESEXTPROC) (GLsizei n, GLuint *pipelines); +typedef void (GL_APIENTRYP PFNGLGETPROGRAMPIPELINEINFOLOGEXTPROC) (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (GL_APIENTRYP PFNGLGETPROGRAMPIPELINEIVEXTPROC) (GLuint pipeline, GLenum pname, GLint *params); typedef GLboolean (GL_APIENTRYP PFNGLISPROGRAMPIPELINEEXTPROC) (GLuint pipeline); typedef void (GL_APIENTRYP PFNGLPROGRAMPARAMETERIEXTPROC) (GLuint program, GLenum pname, GLint value); -typedef void (GL_APIENTRYP PFNGLGETPROGRAMPIPELINEIVEXTPROC) (GLuint pipeline, GLenum pname, GLint *params); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1IEXTPROC) (GLuint program, GLint location, GLint x); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2IEXTPROC) (GLuint program, GLint location, GLint x, GLint y); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3IEXTPROC) (GLuint program, GLint location, GLint x, GLint y, GLint z); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4IEXTPROC) (GLuint program, GLint location, GLint x, GLint y, GLint z, GLint w); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1FEXTPROC) (GLuint program, GLint location, GLfloat x); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2FEXTPROC) (GLuint program, GLint location, GLfloat x, GLfloat y); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3FEXTPROC) (GLuint program, GLint location, GLfloat x, GLfloat y, GLfloat z); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4FEXTPROC) (GLuint program, GLint location, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); -typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1FEXTPROC) (GLuint program, GLint location, GLfloat v0); typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1IEXTPROC) (GLuint program, GLint location, GLint v0); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUSEPROGRAMSTAGESEXTPROC) (GLuint pipeline, GLbitfield stages, GLuint program); typedef void (GL_APIENTRYP PFNGLVALIDATEPROGRAMPIPELINEEXTPROC) (GLuint pipeline); -typedef void (GL_APIENTRYP PFNGLGETPROGRAMPIPELINEINFOLOGEXTPROC) (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1UIEXTPROC) (GLuint program, GLint location, GLuint v0); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glActiveShaderProgramEXT (GLuint pipeline, GLuint program); +GL_APICALL void GL_APIENTRY glBindProgramPipelineEXT (GLuint pipeline); +GL_APICALL GLuint GL_APIENTRY glCreateShaderProgramvEXT (GLenum type, GLsizei count, const GLchar **strings); +GL_APICALL void GL_APIENTRY glDeleteProgramPipelinesEXT (GLsizei n, const GLuint *pipelines); +GL_APICALL void GL_APIENTRY glGenProgramPipelinesEXT (GLsizei n, GLuint *pipelines); +GL_APICALL void GL_APIENTRY glGetProgramPipelineInfoLogEXT (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GL_APICALL void GL_APIENTRY glGetProgramPipelineivEXT (GLuint pipeline, GLenum pname, GLint *params); +GL_APICALL GLboolean GL_APIENTRY glIsProgramPipelineEXT (GLuint pipeline); +GL_APICALL void GL_APIENTRY glProgramParameteriEXT (GLuint program, GLenum pname, GLint value); +GL_APICALL void GL_APIENTRY glProgramUniform1fEXT (GLuint program, GLint location, GLfloat v0); +GL_APICALL void GL_APIENTRY glProgramUniform1fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniform1iEXT (GLuint program, GLint location, GLint v0); +GL_APICALL void GL_APIENTRY glProgramUniform1ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GL_APICALL void GL_APIENTRY glProgramUniform2fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1); +GL_APICALL void GL_APIENTRY glProgramUniform2fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniform2iEXT (GLuint program, GLint location, GLint v0, GLint v1); +GL_APICALL void GL_APIENTRY glProgramUniform2ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GL_APICALL void GL_APIENTRY glProgramUniform3fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GL_APICALL void GL_APIENTRY glProgramUniform3fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniform3iEXT (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +GL_APICALL void GL_APIENTRY glProgramUniform3ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GL_APICALL void GL_APIENTRY glProgramUniform4fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GL_APICALL void GL_APIENTRY glProgramUniform4fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniform4iEXT (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GL_APICALL void GL_APIENTRY glProgramUniform4ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUseProgramStagesEXT (GLuint pipeline, GLbitfield stages, GLuint program); +GL_APICALL void GL_APIENTRY glValidateProgramPipelineEXT (GLuint pipeline); +GL_APICALL void GL_APIENTRY glProgramUniform1uiEXT (GLuint program, GLint location, GLuint v0); +GL_APICALL void GL_APIENTRY glProgramUniform2uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1); +GL_APICALL void GL_APIENTRY glProgramUniform3uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +GL_APICALL void GL_APIENTRY glProgramUniform4uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GL_APICALL void GL_APIENTRY glProgramUniform1uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GL_APICALL void GL_APIENTRY glProgramUniform2uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GL_APICALL void GL_APIENTRY glProgramUniform3uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GL_APICALL void GL_APIENTRY glProgramUniform4uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix2x3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix3x2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix2x4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix4x2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix3x4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); #endif +#endif /* GL_EXT_separate_shader_objects */ -/* GL_EXT_shader_framebuffer_fetch */ #ifndef GL_EXT_shader_framebuffer_fetch #define GL_EXT_shader_framebuffer_fetch 1 -#endif +#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 +#endif /* GL_EXT_shader_framebuffer_fetch */ + +#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent +#define GL_EXT_shader_framebuffer_fetch_non_coherent 1 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferFetchBarrierEXT (void); +#endif +#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */ + +#ifndef GL_EXT_shader_group_vote +#define GL_EXT_shader_group_vote 1 +#endif /* GL_EXT_shader_group_vote */ + +#ifndef GL_EXT_shader_implicit_conversions +#define GL_EXT_shader_implicit_conversions 1 +#endif /* GL_EXT_shader_implicit_conversions */ + +#ifndef GL_EXT_shader_integer_mix +#define GL_EXT_shader_integer_mix 1 +#endif /* GL_EXT_shader_integer_mix */ + +#ifndef GL_EXT_shader_io_blocks +#define GL_EXT_shader_io_blocks 1 +#endif /* GL_EXT_shader_io_blocks */ + +#ifndef GL_EXT_shader_non_constant_global_initializers +#define GL_EXT_shader_non_constant_global_initializers 1 +#endif /* GL_EXT_shader_non_constant_global_initializers */ + +#ifndef GL_EXT_shader_pixel_local_storage +#define GL_EXT_shader_pixel_local_storage 1 +#define GL_MAX_SHADER_PIXEL_LOCAL_STORAGE_FAST_SIZE_EXT 0x8F63 +#define GL_MAX_SHADER_PIXEL_LOCAL_STORAGE_SIZE_EXT 0x8F67 +#define GL_SHADER_PIXEL_LOCAL_STORAGE_EXT 0x8F64 +#endif /* GL_EXT_shader_pixel_local_storage */ + +#ifndef GL_EXT_shader_pixel_local_storage2 +#define GL_EXT_shader_pixel_local_storage2 1 +#define GL_MAX_SHADER_COMBINED_LOCAL_STORAGE_FAST_SIZE_EXT 0x9650 +#define GL_MAX_SHADER_COMBINED_LOCAL_STORAGE_SIZE_EXT 0x9651 +#define GL_FRAMEBUFFER_INCOMPLETE_INSUFFICIENT_SHADER_COMBINED_LOCAL_STORAGE_EXT 0x9652 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERPIXELLOCALSTORAGESIZEEXTPROC) (GLuint target, GLsizei size); +typedef GLsizei (GL_APIENTRYP PFNGLGETFRAMEBUFFERPIXELLOCALSTORAGESIZEEXTPROC) (GLuint target); +typedef void (GL_APIENTRYP PFNGLCLEARPIXELLOCALSTORAGEUIEXTPROC) (GLsizei offset, GLsizei n, const GLuint *values); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferPixelLocalStorageSizeEXT (GLuint target, GLsizei size); +GL_APICALL GLsizei GL_APIENTRY glGetFramebufferPixelLocalStorageSizeEXT (GLuint target); +GL_APICALL void GL_APIENTRY glClearPixelLocalStorageuiEXT (GLsizei offset, GLsizei n, const GLuint *values); +#endif +#endif /* GL_EXT_shader_pixel_local_storage2 */ + +#ifndef GL_EXT_shader_samples_identical +#define GL_EXT_shader_samples_identical 1 +#endif /* GL_EXT_shader_samples_identical */ -/* GL_EXT_shader_texture_lod */ #ifndef GL_EXT_shader_texture_lod #define GL_EXT_shader_texture_lod 1 -#endif +#endif /* GL_EXT_shader_texture_lod */ -/* GL_EXT_shadow_samplers */ #ifndef GL_EXT_shadow_samplers #define GL_EXT_shadow_samplers 1 -#endif +#define GL_TEXTURE_COMPARE_MODE_EXT 0x884C +#define GL_TEXTURE_COMPARE_FUNC_EXT 0x884D +#define GL_COMPARE_REF_TO_TEXTURE_EXT 0x884E +#define GL_SAMPLER_2D_SHADOW_EXT 0x8B62 +#endif /* GL_EXT_shadow_samplers */ -/* GL_EXT_sRGB */ -#ifndef GL_EXT_sRGB -#define GL_EXT_sRGB 1 +#ifndef GL_EXT_sparse_texture +#define GL_EXT_sparse_texture 1 +#define GL_TEXTURE_SPARSE_EXT 0x91A6 +#define GL_VIRTUAL_PAGE_SIZE_INDEX_EXT 0x91A7 +#define GL_NUM_SPARSE_LEVELS_EXT 0x91AA +#define GL_NUM_VIRTUAL_PAGE_SIZES_EXT 0x91A8 +#define GL_VIRTUAL_PAGE_SIZE_X_EXT 0x9195 +#define GL_VIRTUAL_PAGE_SIZE_Y_EXT 0x9196 +#define GL_VIRTUAL_PAGE_SIZE_Z_EXT 0x9197 +#define GL_TEXTURE_2D_ARRAY 0x8C1A +#define GL_TEXTURE_3D 0x806F +#define GL_MAX_SPARSE_TEXTURE_SIZE_EXT 0x9198 +#define GL_MAX_SPARSE_3D_TEXTURE_SIZE_EXT 0x9199 +#define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS_EXT 0x919A +#define GL_SPARSE_TEXTURE_FULL_ARRAY_CUBE_MIPMAPS_EXT 0x91A9 +typedef void (GL_APIENTRYP PFNGLTEXPAGECOMMITMENTEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexPageCommitmentEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); #endif +#endif /* GL_EXT_sparse_texture */ + +#ifndef GL_EXT_sparse_texture2 +#define GL_EXT_sparse_texture2 1 +#endif /* GL_EXT_sparse_texture2 */ + +#ifndef GL_EXT_tessellation_point_size +#define GL_EXT_tessellation_point_size 1 +#endif /* GL_EXT_tessellation_point_size */ + +#ifndef GL_EXT_tessellation_shader +#define GL_EXT_tessellation_shader 1 +#define GL_PATCHES_EXT 0x000E +#define GL_PATCH_VERTICES_EXT 0x8E72 +#define GL_TESS_CONTROL_OUTPUT_VERTICES_EXT 0x8E75 +#define GL_TESS_GEN_MODE_EXT 0x8E76 +#define GL_TESS_GEN_SPACING_EXT 0x8E77 +#define GL_TESS_GEN_VERTEX_ORDER_EXT 0x8E78 +#define GL_TESS_GEN_POINT_MODE_EXT 0x8E79 +#define GL_ISOLINES_EXT 0x8E7A +#define GL_QUADS_EXT 0x0007 +#define GL_FRACTIONAL_ODD_EXT 0x8E7B +#define GL_FRACTIONAL_EVEN_EXT 0x8E7C +#define GL_MAX_PATCH_VERTICES_EXT 0x8E7D +#define GL_MAX_TESS_GEN_LEVEL_EXT 0x8E7E +#define GL_MAX_TESS_CONTROL_UNIFORM_COMPONENTS_EXT 0x8E7F +#define GL_MAX_TESS_EVALUATION_UNIFORM_COMPONENTS_EXT 0x8E80 +#define GL_MAX_TESS_CONTROL_TEXTURE_IMAGE_UNITS_EXT 0x8E81 +#define GL_MAX_TESS_EVALUATION_TEXTURE_IMAGE_UNITS_EXT 0x8E82 +#define GL_MAX_TESS_CONTROL_OUTPUT_COMPONENTS_EXT 0x8E83 +#define GL_MAX_TESS_PATCH_COMPONENTS_EXT 0x8E84 +#define GL_MAX_TESS_CONTROL_TOTAL_OUTPUT_COMPONENTS_EXT 0x8E85 +#define GL_MAX_TESS_EVALUATION_OUTPUT_COMPONENTS_EXT 0x8E86 +#define GL_MAX_TESS_CONTROL_UNIFORM_BLOCKS_EXT 0x8E89 +#define GL_MAX_TESS_EVALUATION_UNIFORM_BLOCKS_EXT 0x8E8A +#define GL_MAX_TESS_CONTROL_INPUT_COMPONENTS_EXT 0x886C +#define GL_MAX_TESS_EVALUATION_INPUT_COMPONENTS_EXT 0x886D +#define GL_MAX_COMBINED_TESS_CONTROL_UNIFORM_COMPONENTS_EXT 0x8E1E +#define GL_MAX_COMBINED_TESS_EVALUATION_UNIFORM_COMPONENTS_EXT 0x8E1F +#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTER_BUFFERS_EXT 0x92CD +#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTER_BUFFERS_EXT 0x92CE +#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTERS_EXT 0x92D3 +#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTERS_EXT 0x92D4 +#define GL_MAX_TESS_CONTROL_IMAGE_UNIFORMS_EXT 0x90CB +#define GL_MAX_TESS_EVALUATION_IMAGE_UNIFORMS_EXT 0x90CC +#define GL_MAX_TESS_CONTROL_SHADER_STORAGE_BLOCKS_EXT 0x90D8 +#define GL_MAX_TESS_EVALUATION_SHADER_STORAGE_BLOCKS_EXT 0x90D9 +#define GL_PRIMITIVE_RESTART_FOR_PATCHES_SUPPORTED 0x8221 +#define GL_IS_PER_PATCH_EXT 0x92E7 +#define GL_REFERENCED_BY_TESS_CONTROL_SHADER_EXT 0x9307 +#define GL_REFERENCED_BY_TESS_EVALUATION_SHADER_EXT 0x9308 +#define GL_TESS_CONTROL_SHADER_EXT 0x8E88 +#define GL_TESS_EVALUATION_SHADER_EXT 0x8E87 +#define GL_TESS_CONTROL_SHADER_BIT_EXT 0x00000008 +#define GL_TESS_EVALUATION_SHADER_BIT_EXT 0x00000010 +typedef void (GL_APIENTRYP PFNGLPATCHPARAMETERIEXTPROC) (GLenum pname, GLint value); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glPatchParameteriEXT (GLenum pname, GLint value); +#endif +#endif /* GL_EXT_tessellation_shader */ + +#ifndef GL_EXT_texture_border_clamp +#define GL_EXT_texture_border_clamp 1 +#define GL_TEXTURE_BORDER_COLOR_EXT 0x1004 +#define GL_CLAMP_TO_BORDER_EXT 0x812D +typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (GL_APIENTRYP PFNGLTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, const GLuint *params); +typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, GLuint *params); +typedef void (GL_APIENTRYP PFNGLSAMPLERPARAMETERIIVEXTPROC) (GLuint sampler, GLenum pname, const GLint *param); +typedef void (GL_APIENTRYP PFNGLSAMPLERPARAMETERIUIVEXTPROC) (GLuint sampler, GLenum pname, const GLuint *param); +typedef void (GL_APIENTRYP PFNGLGETSAMPLERPARAMETERIIVEXTPROC) (GLuint sampler, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLGETSAMPLERPARAMETERIUIVEXTPROC) (GLuint sampler, GLenum pname, GLuint *params); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexParameterIivEXT (GLenum target, GLenum pname, const GLint *params); +GL_APICALL void GL_APIENTRY glTexParameterIuivEXT (GLenum target, GLenum pname, const GLuint *params); +GL_APICALL void GL_APIENTRY glGetTexParameterIivEXT (GLenum target, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetTexParameterIuivEXT (GLenum target, GLenum pname, GLuint *params); +GL_APICALL void GL_APIENTRY glSamplerParameterIivEXT (GLuint sampler, GLenum pname, const GLint *param); +GL_APICALL void GL_APIENTRY glSamplerParameterIuivEXT (GLuint sampler, GLenum pname, const GLuint *param); +GL_APICALL void GL_APIENTRY glGetSamplerParameterIivEXT (GLuint sampler, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glGetSamplerParameterIuivEXT (GLuint sampler, GLenum pname, GLuint *params); +#endif +#endif /* GL_EXT_texture_border_clamp */ + +#ifndef GL_EXT_texture_buffer +#define GL_EXT_texture_buffer 1 +#define GL_TEXTURE_BUFFER_EXT 0x8C2A +#define GL_TEXTURE_BUFFER_BINDING_EXT 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE_EXT 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER_EXT 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_EXT 0x8C2D +#define GL_TEXTURE_BUFFER_OFFSET_ALIGNMENT_EXT 0x919F +#define GL_SAMPLER_BUFFER_EXT 0x8DC2 +#define GL_INT_SAMPLER_BUFFER_EXT 0x8DD0 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER_EXT 0x8DD8 +#define GL_IMAGE_BUFFER_EXT 0x9051 +#define GL_INT_IMAGE_BUFFER_EXT 0x905C +#define GL_UNSIGNED_INT_IMAGE_BUFFER_EXT 0x9067 +#define GL_TEXTURE_BUFFER_OFFSET_EXT 0x919D +#define GL_TEXTURE_BUFFER_SIZE_EXT 0x919E +typedef void (GL_APIENTRYP PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum internalformat, GLuint buffer); +typedef void (GL_APIENTRYP PFNGLTEXBUFFERRANGEEXTPROC) (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint buffer); +GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +#endif +#endif /* GL_EXT_texture_buffer */ + +#ifndef GL_EXT_texture_compression_astc_decode_mode +#define GL_EXT_texture_compression_astc_decode_mode 1 +#define GL_TEXTURE_ASTC_DECODE_PRECISION_EXT 0x8F69 +#endif /* GL_EXT_texture_compression_astc_decode_mode */ + +#ifndef GL_EXT_texture_compression_bptc +#define GL_EXT_texture_compression_bptc 1 +#define GL_COMPRESSED_RGBA_BPTC_UNORM_EXT 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM_EXT 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT_EXT 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT_EXT 0x8E8F +#endif /* GL_EXT_texture_compression_bptc */ -/* GL_EXT_texture_compression_dxt1 */ #ifndef GL_EXT_texture_compression_dxt1 #define GL_EXT_texture_compression_dxt1 1 -#endif +#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 +#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 +#endif /* GL_EXT_texture_compression_dxt1 */ + +#ifndef GL_EXT_texture_compression_rgtc +#define GL_EXT_texture_compression_rgtc 1 +#define GL_COMPRESSED_RED_RGTC1_EXT 0x8DBB +#define GL_COMPRESSED_SIGNED_RED_RGTC1_EXT 0x8DBC +#define GL_COMPRESSED_RED_GREEN_RGTC2_EXT 0x8DBD +#define GL_COMPRESSED_SIGNED_RED_GREEN_RGTC2_EXT 0x8DBE +#endif /* GL_EXT_texture_compression_rgtc */ + +#ifndef GL_EXT_texture_compression_s3tc +#define GL_EXT_texture_compression_s3tc 1 +#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 +#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 +#endif /* GL_EXT_texture_compression_s3tc */ + +#ifndef GL_EXT_texture_compression_s3tc_srgb +#define GL_EXT_texture_compression_s3tc_srgb 1 +#define GL_COMPRESSED_SRGB_S3TC_DXT1_EXT 0x8C4C +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_EXT 0x8C4D +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_EXT 0x8C4E +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F +#endif /* GL_EXT_texture_compression_s3tc_srgb */ + +#ifndef GL_EXT_texture_cube_map_array +#define GL_EXT_texture_cube_map_array 1 +#define GL_TEXTURE_CUBE_MAP_ARRAY_EXT 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_EXT 0x900A +#define GL_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_EXT 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900F +#define GL_IMAGE_CUBE_MAP_ARRAY_EXT 0x9054 +#define GL_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x905F +#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x906A +#endif /* GL_EXT_texture_cube_map_array */ -/* GL_EXT_texture_filter_anisotropic */ #ifndef GL_EXT_texture_filter_anisotropic #define GL_EXT_texture_filter_anisotropic 1 -#endif +#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF +#endif /* GL_EXT_texture_filter_anisotropic */ + +#ifndef GL_EXT_texture_filter_minmax +#define GL_EXT_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_EXT 0x9366 +#define GL_WEIGHTED_AVERAGE_EXT 0x9367 +#endif /* GL_EXT_texture_filter_minmax */ -/* GL_EXT_texture_format_BGRA8888 */ #ifndef GL_EXT_texture_format_BGRA8888 #define GL_EXT_texture_format_BGRA8888 1 -#endif +#endif /* GL_EXT_texture_format_BGRA8888 */ + +#ifndef GL_EXT_texture_format_sRGB_override +#define GL_EXT_texture_format_sRGB_override 1 +#define GL_TEXTURE_FORMAT_SRGB_OVERRIDE_EXT 0x8FBF +#endif /* GL_EXT_texture_format_sRGB_override */ + +#ifndef GL_EXT_texture_mirror_clamp_to_edge +#define GL_EXT_texture_mirror_clamp_to_edge 1 +#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 +#endif /* GL_EXT_texture_mirror_clamp_to_edge */ + +#ifndef GL_EXT_texture_norm16 +#define GL_EXT_texture_norm16 1 +#define GL_R16_EXT 0x822A +#define GL_RG16_EXT 0x822C +#define GL_RGBA16_EXT 0x805B +#define GL_RGB16_EXT 0x8054 +#define GL_RGB16_SNORM_EXT 0x8F9A +#endif /* GL_EXT_texture_norm16 */ + +#ifndef GL_EXT_texture_query_lod +#define GL_EXT_texture_query_lod 1 +#endif /* GL_EXT_texture_query_lod */ -/* GL_EXT_texture_rg */ #ifndef GL_EXT_texture_rg #define GL_EXT_texture_rg 1 -#endif +#define GL_RED_EXT 0x1903 +#define GL_RG_EXT 0x8227 +#define GL_R8_EXT 0x8229 +#define GL_RG8_EXT 0x822B +#endif /* GL_EXT_texture_rg */ + +#ifndef GL_EXT_texture_sRGB_R8 +#define GL_EXT_texture_sRGB_R8 1 +#define GL_SR8_EXT 0x8FBD +#endif /* GL_EXT_texture_sRGB_R8 */ + +#ifndef GL_EXT_texture_sRGB_RG8 +#define GL_EXT_texture_sRGB_RG8 1 +#define GL_SRG8_EXT 0x8FBE +#endif /* GL_EXT_texture_sRGB_RG8 */ + +#ifndef GL_EXT_texture_sRGB_decode +#define GL_EXT_texture_sRGB_decode 1 +#define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48 +#define GL_DECODE_EXT 0x8A49 +#define GL_SKIP_DECODE_EXT 0x8A4A +#endif /* GL_EXT_texture_sRGB_decode */ + +#ifndef GL_EXT_texture_shadow_lod +#define GL_EXT_texture_shadow_lod 1 +#endif /* GL_EXT_texture_shadow_lod */ -/* GL_EXT_texture_storage */ #ifndef GL_EXT_texture_storage #define GL_EXT_texture_storage 1 +#define GL_TEXTURE_IMMUTABLE_FORMAT_EXT 0x912F +#define GL_ALPHA8_EXT 0x803C +#define GL_LUMINANCE8_EXT 0x8040 +#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 +#define GL_RGBA32F_EXT 0x8814 +#define GL_RGB32F_EXT 0x8815 +#define GL_ALPHA32F_EXT 0x8816 +#define GL_LUMINANCE32F_EXT 0x8818 +#define GL_LUMINANCE_ALPHA32F_EXT 0x8819 +#define GL_ALPHA16F_EXT 0x881C +#define GL_LUMINANCE16F_EXT 0x881E +#define GL_LUMINANCE_ALPHA16F_EXT 0x881F +#define GL_R32F_EXT 0x822E +#define GL_RG32F_EXT 0x8230 +typedef void (GL_APIENTRYP PFNGLTEXSTORAGE1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGE2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGE3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGE1DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGE2DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGE3DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glTexStorage1DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); GL_APICALL void GL_APIENTRY glTexStorage2DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); @@ -1709,130 +2297,552 @@ GL_APICALL void GL_APIENTRY glTextureStorage1DEXT (GLuint texture, GLenum target GL_APICALL void GL_APIENTRY glTextureStorage2DEXT (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); GL_APICALL void GL_APIENTRY glTextureStorage3DEXT (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); #endif -typedef void (GL_APIENTRYP PFNGLTEXSTORAGE1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); -typedef void (GL_APIENTRYP PFNGLTEXSTORAGE2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); -typedef void (GL_APIENTRYP PFNGLTEXSTORAGE3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); -typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGE1DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); -typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGE2DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); -typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGE3DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); -#endif +#endif /* GL_EXT_texture_storage */ + +#ifndef GL_EXT_texture_storage_compression +#define GL_EXT_texture_storage_compression 1 +#define GL_NUM_SURFACE_COMPRESSION_FIXED_RATES_EXT 0x8F6E +#define GL_SURFACE_COMPRESSION_FIXED_RATE_1BPC_EXT 0x96C4 +#define GL_SURFACE_COMPRESSION_FIXED_RATE_2BPC_EXT 0x96C5 +#define GL_SURFACE_COMPRESSION_FIXED_RATE_3BPC_EXT 0x96C6 +#define GL_SURFACE_COMPRESSION_FIXED_RATE_4BPC_EXT 0x96C7 +#define GL_SURFACE_COMPRESSION_FIXED_RATE_5BPC_EXT 0x96C8 +#define GL_SURFACE_COMPRESSION_FIXED_RATE_6BPC_EXT 0x96C9 +#define GL_SURFACE_COMPRESSION_FIXED_RATE_7BPC_EXT 0x96CA +#define GL_SURFACE_COMPRESSION_FIXED_RATE_8BPC_EXT 0x96CB +#define GL_SURFACE_COMPRESSION_FIXED_RATE_9BPC_EXT 0x96CC +#define GL_SURFACE_COMPRESSION_FIXED_RATE_10BPC_EXT 0x96CD +#define GL_SURFACE_COMPRESSION_FIXED_RATE_11BPC_EXT 0x96CE +#define GL_SURFACE_COMPRESSION_FIXED_RATE_12BPC_EXT 0x96CF +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEATTRIBS2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, const GLint* attrib_list); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEATTRIBS3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexStorageAttribs2DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, const GLint* attrib_list); +GL_APICALL void GL_APIENTRY glTexStorageAttribs3DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, const GLint* attrib_list); +#endif +#endif /* GL_EXT_texture_storage_compression */ -/* GL_EXT_texture_type_2_10_10_10_REV */ #ifndef GL_EXT_texture_type_2_10_10_10_REV #define GL_EXT_texture_type_2_10_10_10_REV 1 -#endif +#define GL_UNSIGNED_INT_2_10_10_10_REV_EXT 0x8368 +#endif /* GL_EXT_texture_type_2_10_10_10_REV */ + +#ifndef GL_EXT_texture_view +#define GL_EXT_texture_view 1 +#define GL_TEXTURE_VIEW_MIN_LEVEL_EXT 0x82DB +#define GL_TEXTURE_VIEW_NUM_LEVELS_EXT 0x82DC +#define GL_TEXTURE_VIEW_MIN_LAYER_EXT 0x82DD +#define GL_TEXTURE_VIEW_NUM_LAYERS_EXT 0x82DE +typedef void (GL_APIENTRYP PFNGLTEXTUREVIEWEXTPROC) (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTextureViewEXT (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); +#endif +#endif /* GL_EXT_texture_view */ -/* GL_EXT_unpack_subimage */ #ifndef GL_EXT_unpack_subimage #define GL_EXT_unpack_subimage 1 +#define GL_UNPACK_ROW_LENGTH_EXT 0x0CF2 +#define GL_UNPACK_SKIP_ROWS_EXT 0x0CF3 +#define GL_UNPACK_SKIP_PIXELS_EXT 0x0CF4 +#endif /* GL_EXT_unpack_subimage */ + +#ifndef GL_EXT_win32_keyed_mutex +#define GL_EXT_win32_keyed_mutex 1 +typedef GLboolean (GL_APIENTRYP PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key, GLuint timeout); +typedef GLboolean (GL_APIENTRYP PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL GLboolean GL_APIENTRY glAcquireKeyedMutexWin32EXT (GLuint memory, GLuint64 key, GLuint timeout); +GL_APICALL GLboolean GL_APIENTRY glReleaseKeyedMutexWin32EXT (GLuint memory, GLuint64 key); #endif +#endif /* GL_EXT_win32_keyed_mutex */ -/*------------------------------------------------------------------------* - * DMP extension functions - *------------------------------------------------------------------------*/ - -/* GL_DMP_shader_binary */ -#ifndef GL_DMP_shader_binary -#define GL_DMP_shader_binary 1 +#ifndef GL_EXT_window_rectangles +#define GL_EXT_window_rectangles 1 +#define GL_INCLUSIVE_EXT 0x8F10 +#define GL_EXCLUSIVE_EXT 0x8F11 +#define GL_WINDOW_RECTANGLE_EXT 0x8F12 +#define GL_WINDOW_RECTANGLE_MODE_EXT 0x8F13 +#define GL_MAX_WINDOW_RECTANGLES_EXT 0x8F14 +#define GL_NUM_WINDOW_RECTANGLES_EXT 0x8F15 +typedef void (GL_APIENTRYP PFNGLWINDOWRECTANGLESEXTPROC) (GLenum mode, GLsizei count, const GLint *box); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glWindowRectanglesEXT (GLenum mode, GLsizei count, const GLint *box); #endif +#endif /* GL_EXT_window_rectangles */ -/*------------------------------------------------------------------------* - * FJ extension functions - *------------------------------------------------------------------------*/ - -/* GL_FJ_shader_binary_GCCSO */ #ifndef GL_FJ_shader_binary_GCCSO #define GL_FJ_shader_binary_GCCSO 1 +#define GL_GCCSO_SHADER_BINARY_FJ 0x9260 +#endif /* GL_FJ_shader_binary_GCCSO */ + +#ifndef GL_IMG_bindless_texture +#define GL_IMG_bindless_texture 1 +typedef GLuint64 (GL_APIENTRYP PFNGLGETTEXTUREHANDLEIMGPROC) (GLuint texture); +typedef GLuint64 (GL_APIENTRYP PFNGLGETTEXTURESAMPLERHANDLEIMGPROC) (GLuint texture, GLuint sampler); +typedef void (GL_APIENTRYP PFNGLUNIFORMHANDLEUI64IMGPROC) (GLint location, GLuint64 value); +typedef void (GL_APIENTRYP PFNGLUNIFORMHANDLEUI64VIMGPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64IMGPROC) (GLuint program, GLint location, GLuint64 value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64VIMGPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL GLuint64 GL_APIENTRY glGetTextureHandleIMG (GLuint texture); +GL_APICALL GLuint64 GL_APIENTRY glGetTextureSamplerHandleIMG (GLuint texture, GLuint sampler); +GL_APICALL void GL_APIENTRY glUniformHandleui64IMG (GLint location, GLuint64 value); +GL_APICALL void GL_APIENTRY glUniformHandleui64vIMG (GLint location, GLsizei count, const GLuint64 *value); +GL_APICALL void GL_APIENTRY glProgramUniformHandleui64IMG (GLuint program, GLint location, GLuint64 value); +GL_APICALL void GL_APIENTRY glProgramUniformHandleui64vIMG (GLuint program, GLint location, GLsizei count, const GLuint64 *values); #endif +#endif /* GL_IMG_bindless_texture */ -/*------------------------------------------------------------------------* - * IMG extension functions - *------------------------------------------------------------------------*/ - -/* GL_IMG_program_binary */ -#ifndef GL_IMG_program_binary -#define GL_IMG_program_binary 1 +#ifndef GL_IMG_framebuffer_downsample +#define GL_IMG_framebuffer_downsample 1 +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_AND_DOWNSAMPLE_IMG 0x913C +#define GL_NUM_DOWNSAMPLE_SCALES_IMG 0x913D +#define GL_DOWNSAMPLE_SCALES_IMG 0x913E +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_SCALE_IMG 0x913F +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DDOWNSAMPLEIMGPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint xscale, GLint yscale); +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYERDOWNSAMPLEIMGPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer, GLint xscale, GLint yscale); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferTexture2DDownsampleIMG (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint xscale, GLint yscale); +GL_APICALL void GL_APIENTRY glFramebufferTextureLayerDownsampleIMG (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer, GLint xscale, GLint yscale); #endif +#endif /* GL_IMG_framebuffer_downsample */ -/* GL_IMG_read_format */ -#ifndef GL_IMG_read_format -#define GL_IMG_read_format 1 -#endif - -/* GL_IMG_shader_binary */ -#ifndef GL_IMG_shader_binary -#define GL_IMG_shader_binary 1 -#endif - -/* GL_IMG_texture_compression_pvrtc */ -#ifndef GL_IMG_texture_compression_pvrtc -#define GL_IMG_texture_compression_pvrtc 1 -#endif - -/* GL_IMG_texture_compression_pvrtc2 */ -#ifndef GL_IMG_texture_compression_pvrtc2 -#define GL_IMG_texture_compression_pvrtc2 1 -#endif - -/* GL_IMG_multisampled_render_to_texture */ #ifndef GL_IMG_multisampled_render_to_texture #define GL_IMG_multisampled_render_to_texture 1 +#define GL_RENDERBUFFER_SAMPLES_IMG 0x9133 +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_IMG 0x9134 +#define GL_MAX_SAMPLES_IMG 0x9135 +#define GL_TEXTURE_SAMPLES_IMG 0x9136 +typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEIMGPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DMULTISAMPLEIMGPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLsizei samples); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleIMG (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); GL_APICALL void GL_APIENTRY glFramebufferTexture2DMultisampleIMG (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLsizei samples); #endif -typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEIMGPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); -typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DMULTISAMPLEIMGPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLsizei samples); +#endif /* GL_IMG_multisampled_render_to_texture */ + +#ifndef GL_IMG_program_binary +#define GL_IMG_program_binary 1 +#define GL_SGX_PROGRAM_BINARY_IMG 0x9130 +#endif /* GL_IMG_program_binary */ + +#ifndef GL_IMG_read_format +#define GL_IMG_read_format 1 +#define GL_BGRA_IMG 0x80E1 +#define GL_UNSIGNED_SHORT_4_4_4_4_REV_IMG 0x8365 +#endif /* GL_IMG_read_format */ + +#ifndef GL_IMG_shader_binary +#define GL_IMG_shader_binary 1 +#define GL_SGX_BINARY_IMG 0x8C0A +#endif /* GL_IMG_shader_binary */ + +#ifndef GL_IMG_texture_compression_pvrtc +#define GL_IMG_texture_compression_pvrtc 1 +#define GL_COMPRESSED_RGB_PVRTC_4BPPV1_IMG 0x8C00 +#define GL_COMPRESSED_RGB_PVRTC_2BPPV1_IMG 0x8C01 +#define GL_COMPRESSED_RGBA_PVRTC_4BPPV1_IMG 0x8C02 +#define GL_COMPRESSED_RGBA_PVRTC_2BPPV1_IMG 0x8C03 +#endif /* GL_IMG_texture_compression_pvrtc */ + +#ifndef GL_IMG_texture_compression_pvrtc2 +#define GL_IMG_texture_compression_pvrtc2 1 +#define GL_COMPRESSED_RGBA_PVRTC_2BPPV2_IMG 0x9137 +#define GL_COMPRESSED_RGBA_PVRTC_4BPPV2_IMG 0x9138 +#endif /* GL_IMG_texture_compression_pvrtc2 */ + +#ifndef GL_IMG_texture_filter_cubic +#define GL_IMG_texture_filter_cubic 1 +#define GL_CUBIC_IMG 0x9139 +#define GL_CUBIC_MIPMAP_NEAREST_IMG 0x913A +#define GL_CUBIC_MIPMAP_LINEAR_IMG 0x913B +#endif /* GL_IMG_texture_filter_cubic */ + +#ifndef GL_INTEL_blackhole_render +#define GL_INTEL_blackhole_render 1 +#define GL_BLACKHOLE_RENDER_INTEL 0x83FC +#endif /* GL_INTEL_blackhole_render */ + +#ifndef GL_INTEL_conservative_rasterization +#define GL_INTEL_conservative_rasterization 1 +#define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE +#endif /* GL_INTEL_conservative_rasterization */ + +#ifndef GL_INTEL_framebuffer_CMAA +#define GL_INTEL_framebuffer_CMAA 1 +typedef void (GL_APIENTRYP PFNGLAPPLYFRAMEBUFFERATTACHMENTCMAAINTELPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glApplyFramebufferAttachmentCMAAINTEL (void); #endif +#endif /* GL_INTEL_framebuffer_CMAA */ -/*------------------------------------------------------------------------* - * NV extension functions - *------------------------------------------------------------------------*/ +#ifndef GL_INTEL_performance_query +#define GL_INTEL_performance_query 1 +#define GL_PERFQUERY_SINGLE_CONTEXT_INTEL 0x00000000 +#define GL_PERFQUERY_GLOBAL_CONTEXT_INTEL 0x00000001 +#define GL_PERFQUERY_WAIT_INTEL 0x83FB +#define GL_PERFQUERY_FLUSH_INTEL 0x83FA +#define GL_PERFQUERY_DONOT_FLUSH_INTEL 0x83F9 +#define GL_PERFQUERY_COUNTER_EVENT_INTEL 0x94F0 +#define GL_PERFQUERY_COUNTER_DURATION_NORM_INTEL 0x94F1 +#define GL_PERFQUERY_COUNTER_DURATION_RAW_INTEL 0x94F2 +#define GL_PERFQUERY_COUNTER_THROUGHPUT_INTEL 0x94F3 +#define GL_PERFQUERY_COUNTER_RAW_INTEL 0x94F4 +#define GL_PERFQUERY_COUNTER_TIMESTAMP_INTEL 0x94F5 +#define GL_PERFQUERY_COUNTER_DATA_UINT32_INTEL 0x94F8 +#define GL_PERFQUERY_COUNTER_DATA_UINT64_INTEL 0x94F9 +#define GL_PERFQUERY_COUNTER_DATA_FLOAT_INTEL 0x94FA +#define GL_PERFQUERY_COUNTER_DATA_DOUBLE_INTEL 0x94FB +#define GL_PERFQUERY_COUNTER_DATA_BOOL32_INTEL 0x94FC +#define GL_PERFQUERY_QUERY_NAME_LENGTH_MAX_INTEL 0x94FD +#define GL_PERFQUERY_COUNTER_NAME_LENGTH_MAX_INTEL 0x94FE +#define GL_PERFQUERY_COUNTER_DESC_LENGTH_MAX_INTEL 0x94FF +#define GL_PERFQUERY_GPA_EXTENDED_COUNTERS_INTEL 0x9500 +typedef void (GL_APIENTRYP PFNGLBEGINPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (GL_APIENTRYP PFNGLCREATEPERFQUERYINTELPROC) (GLuint queryId, GLuint *queryHandle); +typedef void (GL_APIENTRYP PFNGLDELETEPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (GL_APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (GL_APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); +typedef void (GL_APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); +typedef void (GL_APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); +typedef void (GL_APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); +typedef void (GL_APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); +typedef void (GL_APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBeginPerfQueryINTEL (GLuint queryHandle); +GL_APICALL void GL_APIENTRY glCreatePerfQueryINTEL (GLuint queryId, GLuint *queryHandle); +GL_APICALL void GL_APIENTRY glDeletePerfQueryINTEL (GLuint queryHandle); +GL_APICALL void GL_APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); +GL_APICALL void GL_APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); +GL_APICALL void GL_APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); +GL_APICALL void GL_APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); +GL_APICALL void GL_APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); +GL_APICALL void GL_APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); +GL_APICALL void GL_APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); +#endif +#endif /* GL_INTEL_performance_query */ + +#ifndef GL_MESA_bgra +#define GL_MESA_bgra 1 +#define GL_BGR_EXT 0x80E0 +#endif /* GL_MESA_bgra */ + +#ifndef GL_MESA_framebuffer_flip_x +#define GL_MESA_framebuffer_flip_x 1 +#define GL_FRAMEBUFFER_FLIP_X_MESA 0x8BBC +#endif /* GL_MESA_framebuffer_flip_x */ + +#ifndef GL_MESA_framebuffer_flip_y +#define GL_MESA_framebuffer_flip_y 1 +#define GL_FRAMEBUFFER_FLIP_Y_MESA 0x8BBB +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERPARAMETERIMESAPROC) (GLenum target, GLenum pname, GLint param); +typedef void (GL_APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVMESAPROC) (GLenum target, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferParameteriMESA (GLenum target, GLenum pname, GLint param); +GL_APICALL void GL_APIENTRY glGetFramebufferParameterivMESA (GLenum target, GLenum pname, GLint *params); +#endif +#endif /* GL_MESA_framebuffer_flip_y */ + +#ifndef GL_MESA_framebuffer_swap_xy +#define GL_MESA_framebuffer_swap_xy 1 +#define GL_FRAMEBUFFER_SWAP_XY_MESA 0x8BBD +#endif /* GL_MESA_framebuffer_swap_xy */ + +#ifndef GL_MESA_program_binary_formats +#define GL_MESA_program_binary_formats 1 +#define GL_PROGRAM_BINARY_FORMAT_MESA 0x875F +#endif /* GL_MESA_program_binary_formats */ + +#ifndef GL_MESA_shader_integer_functions +#define GL_MESA_shader_integer_functions 1 +#endif /* GL_MESA_shader_integer_functions */ + +#ifndef GL_NVX_blend_equation_advanced_multi_draw_buffers +#define GL_NVX_blend_equation_advanced_multi_draw_buffers 1 +#endif /* GL_NVX_blend_equation_advanced_multi_draw_buffers */ + +#ifndef GL_NV_bindless_texture +#define GL_NV_bindless_texture 1 +typedef GLuint64 (GL_APIENTRYP PFNGLGETTEXTUREHANDLENVPROC) (GLuint texture); +typedef GLuint64 (GL_APIENTRYP PFNGLGETTEXTURESAMPLERHANDLENVPROC) (GLuint texture, GLuint sampler); +typedef void (GL_APIENTRYP PFNGLMAKETEXTUREHANDLERESIDENTNVPROC) (GLuint64 handle); +typedef void (GL_APIENTRYP PFNGLMAKETEXTUREHANDLENONRESIDENTNVPROC) (GLuint64 handle); +typedef GLuint64 (GL_APIENTRYP PFNGLGETIMAGEHANDLENVPROC) (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +typedef void (GL_APIENTRYP PFNGLMAKEIMAGEHANDLERESIDENTNVPROC) (GLuint64 handle, GLenum access); +typedef void (GL_APIENTRYP PFNGLMAKEIMAGEHANDLENONRESIDENTNVPROC) (GLuint64 handle); +typedef void (GL_APIENTRYP PFNGLUNIFORMHANDLEUI64NVPROC) (GLint location, GLuint64 value); +typedef void (GL_APIENTRYP PFNGLUNIFORMHANDLEUI64VNVPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64NVPROC) (GLuint program, GLint location, GLuint64 value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +typedef GLboolean (GL_APIENTRYP PFNGLISTEXTUREHANDLERESIDENTNVPROC) (GLuint64 handle); +typedef GLboolean (GL_APIENTRYP PFNGLISIMAGEHANDLERESIDENTNVPROC) (GLuint64 handle); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL GLuint64 GL_APIENTRY glGetTextureHandleNV (GLuint texture); +GL_APICALL GLuint64 GL_APIENTRY glGetTextureSamplerHandleNV (GLuint texture, GLuint sampler); +GL_APICALL void GL_APIENTRY glMakeTextureHandleResidentNV (GLuint64 handle); +GL_APICALL void GL_APIENTRY glMakeTextureHandleNonResidentNV (GLuint64 handle); +GL_APICALL GLuint64 GL_APIENTRY glGetImageHandleNV (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +GL_APICALL void GL_APIENTRY glMakeImageHandleResidentNV (GLuint64 handle, GLenum access); +GL_APICALL void GL_APIENTRY glMakeImageHandleNonResidentNV (GLuint64 handle); +GL_APICALL void GL_APIENTRY glUniformHandleui64NV (GLint location, GLuint64 value); +GL_APICALL void GL_APIENTRY glUniformHandleui64vNV (GLint location, GLsizei count, const GLuint64 *value); +GL_APICALL void GL_APIENTRY glProgramUniformHandleui64NV (GLuint program, GLint location, GLuint64 value); +GL_APICALL void GL_APIENTRY glProgramUniformHandleui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +GL_APICALL GLboolean GL_APIENTRY glIsTextureHandleResidentNV (GLuint64 handle); +GL_APICALL GLboolean GL_APIENTRY glIsImageHandleResidentNV (GLuint64 handle); +#endif +#endif /* GL_NV_bindless_texture */ + +#ifndef GL_NV_blend_equation_advanced +#define GL_NV_blend_equation_advanced 1 +#define GL_BLEND_OVERLAP_NV 0x9281 +#define GL_BLEND_PREMULTIPLIED_SRC_NV 0x9280 +#define GL_BLUE_NV 0x1905 +#define GL_COLORBURN_NV 0x929A +#define GL_COLORDODGE_NV 0x9299 +#define GL_CONJOINT_NV 0x9284 +#define GL_CONTRAST_NV 0x92A1 +#define GL_DARKEN_NV 0x9297 +#define GL_DIFFERENCE_NV 0x929E +#define GL_DISJOINT_NV 0x9283 +#define GL_DST_ATOP_NV 0x928F +#define GL_DST_IN_NV 0x928B +#define GL_DST_NV 0x9287 +#define GL_DST_OUT_NV 0x928D +#define GL_DST_OVER_NV 0x9289 +#define GL_EXCLUSION_NV 0x92A0 +#define GL_GREEN_NV 0x1904 +#define GL_HARDLIGHT_NV 0x929B +#define GL_HARDMIX_NV 0x92A9 +#define GL_HSL_COLOR_NV 0x92AF +#define GL_HSL_HUE_NV 0x92AD +#define GL_HSL_LUMINOSITY_NV 0x92B0 +#define GL_HSL_SATURATION_NV 0x92AE +#define GL_INVERT_OVG_NV 0x92B4 +#define GL_INVERT_RGB_NV 0x92A3 +#define GL_LIGHTEN_NV 0x9298 +#define GL_LINEARBURN_NV 0x92A5 +#define GL_LINEARDODGE_NV 0x92A4 +#define GL_LINEARLIGHT_NV 0x92A7 +#define GL_MINUS_CLAMPED_NV 0x92B3 +#define GL_MINUS_NV 0x929F +#define GL_MULTIPLY_NV 0x9294 +#define GL_OVERLAY_NV 0x9296 +#define GL_PINLIGHT_NV 0x92A8 +#define GL_PLUS_CLAMPED_ALPHA_NV 0x92B2 +#define GL_PLUS_CLAMPED_NV 0x92B1 +#define GL_PLUS_DARKER_NV 0x9292 +#define GL_PLUS_NV 0x9291 +#define GL_RED_NV 0x1903 +#define GL_SCREEN_NV 0x9295 +#define GL_SOFTLIGHT_NV 0x929C +#define GL_SRC_ATOP_NV 0x928E +#define GL_SRC_IN_NV 0x928A +#define GL_SRC_NV 0x9286 +#define GL_SRC_OUT_NV 0x928C +#define GL_SRC_OVER_NV 0x9288 +#define GL_UNCORRELATED_NV 0x9282 +#define GL_VIVIDLIGHT_NV 0x92A6 +#define GL_XOR_NV 0x1506 +typedef void (GL_APIENTRYP PFNGLBLENDPARAMETERINVPROC) (GLenum pname, GLint value); +typedef void (GL_APIENTRYP PFNGLBLENDBARRIERNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBlendParameteriNV (GLenum pname, GLint value); +GL_APICALL void GL_APIENTRY glBlendBarrierNV (void); +#endif +#endif /* GL_NV_blend_equation_advanced */ + +#ifndef GL_NV_blend_equation_advanced_coherent +#define GL_NV_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 +#endif /* GL_NV_blend_equation_advanced_coherent */ + +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 +#define GL_FACTOR_MIN_AMD 0x901C +#define GL_FACTOR_MAX_AMD 0x901D +#endif /* GL_NV_blend_minmax_factor */ + +#ifndef GL_NV_clip_space_w_scaling +#define GL_NV_clip_space_w_scaling 1 +#define GL_VIEWPORT_POSITION_W_SCALE_NV 0x937C +#define GL_VIEWPORT_POSITION_W_SCALE_X_COEFF_NV 0x937D +#define GL_VIEWPORT_POSITION_W_SCALE_Y_COEFF_NV 0x937E +typedef void (GL_APIENTRYP PFNGLVIEWPORTPOSITIONWSCALENVPROC) (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glViewportPositionWScaleNV (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#endif +#endif /* GL_NV_clip_space_w_scaling */ + +#ifndef GL_NV_compute_shader_derivatives +#define GL_NV_compute_shader_derivatives 1 +#endif /* GL_NV_compute_shader_derivatives */ + +#ifndef GL_NV_conditional_render +#define GL_NV_conditional_render 1 +#define GL_QUERY_WAIT_NV 0x8E13 +#define GL_QUERY_NO_WAIT_NV 0x8E14 +#define GL_QUERY_BY_REGION_WAIT_NV 0x8E15 +#define GL_QUERY_BY_REGION_NO_WAIT_NV 0x8E16 +typedef void (GL_APIENTRYP PFNGLBEGINCONDITIONALRENDERNVPROC) (GLuint id, GLenum mode); +typedef void (GL_APIENTRYP PFNGLENDCONDITIONALRENDERNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBeginConditionalRenderNV (GLuint id, GLenum mode); +GL_APICALL void GL_APIENTRY glEndConditionalRenderNV (void); +#endif +#endif /* GL_NV_conditional_render */ + +#ifndef GL_NV_conservative_raster +#define GL_NV_conservative_raster 1 +#define GL_CONSERVATIVE_RASTERIZATION_NV 0x9346 +#define GL_SUBPIXEL_PRECISION_BIAS_X_BITS_NV 0x9347 +#define GL_SUBPIXEL_PRECISION_BIAS_Y_BITS_NV 0x9348 +#define GL_MAX_SUBPIXEL_PRECISION_BIAS_BITS_NV 0x9349 +typedef void (GL_APIENTRYP PFNGLSUBPIXELPRECISIONBIASNVPROC) (GLuint xbits, GLuint ybits); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybits); +#endif +#endif /* GL_NV_conservative_raster */ + +#ifndef GL_NV_conservative_raster_pre_snap +#define GL_NV_conservative_raster_pre_snap 1 +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_NV 0x9550 +#endif /* GL_NV_conservative_raster_pre_snap */ + +#ifndef GL_NV_conservative_raster_pre_snap_triangles +#define GL_NV_conservative_raster_pre_snap_triangles 1 +#define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D +#define GL_CONSERVATIVE_RASTER_MODE_POST_SNAP_NV 0x954E +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_TRIANGLES_NV 0x954F +typedef void (GL_APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERINVPROC) (GLenum pname, GLint param); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glConservativeRasterParameteriNV (GLenum pname, GLint param); +#endif +#endif /* GL_NV_conservative_raster_pre_snap_triangles */ + +#ifndef GL_NV_copy_buffer +#define GL_NV_copy_buffer 1 +#define GL_COPY_READ_BUFFER_NV 0x8F36 +#define GL_COPY_WRITE_BUFFER_NV 0x8F37 +typedef void (GL_APIENTRYP PFNGLCOPYBUFFERSUBDATANVPROC) (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glCopyBufferSubDataNV (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +#endif +#endif /* GL_NV_copy_buffer */ -/* GL_NV_coverage_sample */ #ifndef GL_NV_coverage_sample #define GL_NV_coverage_sample 1 +#define GL_COVERAGE_COMPONENT_NV 0x8ED0 +#define GL_COVERAGE_COMPONENT4_NV 0x8ED1 +#define GL_COVERAGE_ATTACHMENT_NV 0x8ED2 +#define GL_COVERAGE_BUFFERS_NV 0x8ED3 +#define GL_COVERAGE_SAMPLES_NV 0x8ED4 +#define GL_COVERAGE_ALL_FRAGMENTS_NV 0x8ED5 +#define GL_COVERAGE_EDGE_FRAGMENTS_NV 0x8ED6 +#define GL_COVERAGE_AUTOMATIC_NV 0x8ED7 +#define GL_COVERAGE_BUFFER_BIT_NV 0x00008000 +typedef void (GL_APIENTRYP PFNGLCOVERAGEMASKNVPROC) (GLboolean mask); +typedef void (GL_APIENTRYP PFNGLCOVERAGEOPERATIONNVPROC) (GLenum operation); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glCoverageMaskNV (GLboolean mask); GL_APICALL void GL_APIENTRY glCoverageOperationNV (GLenum operation); #endif -typedef void (GL_APIENTRYP PFNGLCOVERAGEMASKNVPROC) (GLboolean mask); -typedef void (GL_APIENTRYP PFNGLCOVERAGEOPERATIONNVPROC) (GLenum operation); -#endif +#endif /* GL_NV_coverage_sample */ -/* GL_NV_depth_nonlinear */ #ifndef GL_NV_depth_nonlinear #define GL_NV_depth_nonlinear 1 -#endif +#define GL_DEPTH_COMPONENT16_NONLINEAR_NV 0x8E2C +#endif /* GL_NV_depth_nonlinear */ -/* GL_NV_draw_buffers */ #ifndef GL_NV_draw_buffers #define GL_NV_draw_buffers 1 +#define GL_MAX_DRAW_BUFFERS_NV 0x8824 +#define GL_DRAW_BUFFER0_NV 0x8825 +#define GL_DRAW_BUFFER1_NV 0x8826 +#define GL_DRAW_BUFFER2_NV 0x8827 +#define GL_DRAW_BUFFER3_NV 0x8828 +#define GL_DRAW_BUFFER4_NV 0x8829 +#define GL_DRAW_BUFFER5_NV 0x882A +#define GL_DRAW_BUFFER6_NV 0x882B +#define GL_DRAW_BUFFER7_NV 0x882C +#define GL_DRAW_BUFFER8_NV 0x882D +#define GL_DRAW_BUFFER9_NV 0x882E +#define GL_DRAW_BUFFER10_NV 0x882F +#define GL_DRAW_BUFFER11_NV 0x8830 +#define GL_DRAW_BUFFER12_NV 0x8831 +#define GL_DRAW_BUFFER13_NV 0x8832 +#define GL_DRAW_BUFFER14_NV 0x8833 +#define GL_DRAW_BUFFER15_NV 0x8834 +#define GL_COLOR_ATTACHMENT0_NV 0x8CE0 +#define GL_COLOR_ATTACHMENT1_NV 0x8CE1 +#define GL_COLOR_ATTACHMENT2_NV 0x8CE2 +#define GL_COLOR_ATTACHMENT3_NV 0x8CE3 +#define GL_COLOR_ATTACHMENT4_NV 0x8CE4 +#define GL_COLOR_ATTACHMENT5_NV 0x8CE5 +#define GL_COLOR_ATTACHMENT6_NV 0x8CE6 +#define GL_COLOR_ATTACHMENT7_NV 0x8CE7 +#define GL_COLOR_ATTACHMENT8_NV 0x8CE8 +#define GL_COLOR_ATTACHMENT9_NV 0x8CE9 +#define GL_COLOR_ATTACHMENT10_NV 0x8CEA +#define GL_COLOR_ATTACHMENT11_NV 0x8CEB +#define GL_COLOR_ATTACHMENT12_NV 0x8CEC +#define GL_COLOR_ATTACHMENT13_NV 0x8CED +#define GL_COLOR_ATTACHMENT14_NV 0x8CEE +#define GL_COLOR_ATTACHMENT15_NV 0x8CEF +typedef void (GL_APIENTRYP PFNGLDRAWBUFFERSNVPROC) (GLsizei n, const GLenum *bufs); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDrawBuffersNV (GLsizei n, const GLenum *bufs); #endif -typedef void (GL_APIENTRYP PFNGLDRAWBUFFERSNVPROC) (GLsizei n, const GLenum *bufs); -#endif +#endif /* GL_NV_draw_buffers */ -/* GL_NV_draw_instanced */ #ifndef GL_NV_draw_instanced #define GL_NV_draw_instanced 1 +typedef void (GL_APIENTRYP PFNGLDRAWARRAYSINSTANCEDNVPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDNVPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDrawArraysInstancedNV (GLenum mode, GLint first, GLsizei count, GLsizei primcount); -GL_APICALL void GL_APIENTRY glDrawElementsInstancedNV (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); -#endif -typedef void (GL_APIENTRYP PFNGLDRAWARRAYSINSTANCEDNVPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); -typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDNVPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +GL_APICALL void GL_APIENTRY glDrawElementsInstancedNV (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #endif +#endif /* GL_NV_draw_instanced */ + +#ifndef GL_NV_draw_vulkan_image +#define GL_NV_draw_vulkan_image 1 +typedef void (GL_APIENTRY *GLVULKANPROCNV)(void); +typedef void (GL_APIENTRYP PFNGLDRAWVKIMAGENVPROC) (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +typedef GLVULKANPROCNV (GL_APIENTRYP PFNGLGETVKPROCADDRNVPROC) (const GLchar *name); +typedef void (GL_APIENTRYP PFNGLWAITVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (GL_APIENTRYP PFNGLSIGNALVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (GL_APIENTRYP PFNGLSIGNALVKFENCENVPROC) (GLuint64 vkFence); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glDrawVkImageNV (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +GL_APICALL GLVULKANPROCNV GL_APIENTRY glGetVkProcAddrNV (const GLchar *name); +GL_APICALL void GL_APIENTRY glWaitVkSemaphoreNV (GLuint64 vkSemaphore); +GL_APICALL void GL_APIENTRY glSignalVkSemaphoreNV (GLuint64 vkSemaphore); +GL_APICALL void GL_APIENTRY glSignalVkFenceNV (GLuint64 vkFence); +#endif +#endif /* GL_NV_draw_vulkan_image */ + +#ifndef GL_NV_explicit_attrib_location +#define GL_NV_explicit_attrib_location 1 +#endif /* GL_NV_explicit_attrib_location */ -/* GL_NV_fbo_color_attachments */ #ifndef GL_NV_fbo_color_attachments #define GL_NV_fbo_color_attachments 1 -#endif +#define GL_MAX_COLOR_ATTACHMENTS_NV 0x8CDF +#endif /* GL_NV_fbo_color_attachments */ -/* GL_NV_fence */ #ifndef GL_NV_fence #define GL_NV_fence 1 +#define GL_ALL_COMPLETED_NV 0x84F2 +#define GL_FENCE_STATUS_NV 0x84F3 +#define GL_FENCE_CONDITION_NV 0x84F4 +typedef void (GL_APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); +typedef void (GL_APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); +typedef GLboolean (GL_APIENTRYP PFNGLISFENCENVPROC) (GLuint fence); +typedef GLboolean (GL_APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence); +typedef void (GL_APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence); +typedef void (GL_APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDeleteFencesNV (GLsizei n, const GLuint *fences); GL_APICALL void GL_APIENTRY glGenFencesNV (GLsizei n, GLuint *fences); @@ -1842,142 +2852,1008 @@ GL_APICALL void GL_APIENTRY glGetFenceivNV (GLuint fence, GLenum pname, GLint *p GL_APICALL void GL_APIENTRY glFinishFenceNV (GLuint fence); GL_APICALL void GL_APIENTRY glSetFenceNV (GLuint fence, GLenum condition); #endif -typedef void (GL_APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); -typedef void (GL_APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); -typedef GLboolean (GL_APIENTRYP PFNGLISFENCENVPROC) (GLuint fence); -typedef GLboolean (GL_APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence); -typedef void (GL_APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); -typedef void (GL_APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence); -typedef void (GL_APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); -#endif +#endif /* GL_NV_fence */ + +#ifndef GL_NV_fill_rectangle +#define GL_NV_fill_rectangle 1 +#define GL_FILL_RECTANGLE_NV 0x933C +#endif /* GL_NV_fill_rectangle */ + +#ifndef GL_NV_fragment_coverage_to_color +#define GL_NV_fragment_coverage_to_color 1 +#define GL_FRAGMENT_COVERAGE_TO_COLOR_NV 0x92DD +#define GL_FRAGMENT_COVERAGE_COLOR_NV 0x92DE +typedef void (GL_APIENTRYP PFNGLFRAGMENTCOVERAGECOLORNVPROC) (GLuint color); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFragmentCoverageColorNV (GLuint color); +#endif +#endif /* GL_NV_fragment_coverage_to_color */ + +#ifndef GL_NV_fragment_shader_barycentric +#define GL_NV_fragment_shader_barycentric 1 +#endif /* GL_NV_fragment_shader_barycentric */ + +#ifndef GL_NV_fragment_shader_interlock +#define GL_NV_fragment_shader_interlock 1 +#endif /* GL_NV_fragment_shader_interlock */ -/* GL_NV_framebuffer_blit */ #ifndef GL_NV_framebuffer_blit #define GL_NV_framebuffer_blit 1 +#define GL_READ_FRAMEBUFFER_NV 0x8CA8 +#define GL_DRAW_FRAMEBUFFER_NV 0x8CA9 +#define GL_DRAW_FRAMEBUFFER_BINDING_NV 0x8CA6 +#define GL_READ_FRAMEBUFFER_BINDING_NV 0x8CAA +typedef void (GL_APIENTRYP PFNGLBLITFRAMEBUFFERNVPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glBlitFramebufferNV (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); #endif -typedef void (GL_APIENTRYP PFNGLBLITFRAMEBUFFERNVPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); -#endif +#endif /* GL_NV_framebuffer_blit */ + +#ifndef GL_NV_framebuffer_mixed_samples +#define GL_NV_framebuffer_mixed_samples 1 +#define GL_COVERAGE_MODULATION_TABLE_NV 0x9331 +#define GL_COLOR_SAMPLES_NV 0x8E20 +#define GL_DEPTH_SAMPLES_NV 0x932D +#define GL_STENCIL_SAMPLES_NV 0x932E +#define GL_MIXED_DEPTH_SAMPLES_SUPPORTED_NV 0x932F +#define GL_MIXED_STENCIL_SAMPLES_SUPPORTED_NV 0x9330 +#define GL_COVERAGE_MODULATION_NV 0x9332 +#define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333 +typedef void (GL_APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufSize, GLfloat *v); +typedef void (GL_APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v); +GL_APICALL void GL_APIENTRY glGetCoverageModulationTableNV (GLsizei bufSize, GLfloat *v); +GL_APICALL void GL_APIENTRY glCoverageModulationNV (GLenum components); +#endif +#endif /* GL_NV_framebuffer_mixed_samples */ -/* GL_NV_framebuffer_multisample */ #ifndef GL_NV_framebuffer_multisample #define GL_NV_framebuffer_multisample 1 +#define GL_RENDERBUFFER_SAMPLES_NV 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_NV 0x8D56 +#define GL_MAX_SAMPLES_NV 0x8D57 +typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLENVPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); #ifdef GL_GLEXT_PROTOTYPES -GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleNV ( GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); -#endif -typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLENVPROC) ( GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleNV (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); #endif +#endif /* GL_NV_framebuffer_multisample */ -/* GL_NV_generate_mipmap_sRGB */ #ifndef GL_NV_generate_mipmap_sRGB #define GL_NV_generate_mipmap_sRGB 1 -#endif +#endif /* GL_NV_generate_mipmap_sRGB */ + +#ifndef GL_NV_geometry_shader_passthrough +#define GL_NV_geometry_shader_passthrough 1 +#endif /* GL_NV_geometry_shader_passthrough */ + +#ifndef GL_NV_gpu_shader5 +#define GL_NV_gpu_shader5 1 +typedef khronos_int64_t GLint64EXT; +typedef khronos_uint64_t GLuint64EXT; +#define GL_INT64_NV 0x140E +#define GL_UNSIGNED_INT64_NV 0x140F +#define GL_INT8_NV 0x8FE0 +#define GL_INT8_VEC2_NV 0x8FE1 +#define GL_INT8_VEC3_NV 0x8FE2 +#define GL_INT8_VEC4_NV 0x8FE3 +#define GL_INT16_NV 0x8FE4 +#define GL_INT16_VEC2_NV 0x8FE5 +#define GL_INT16_VEC3_NV 0x8FE6 +#define GL_INT16_VEC4_NV 0x8FE7 +#define GL_INT64_VEC2_NV 0x8FE9 +#define GL_INT64_VEC3_NV 0x8FEA +#define GL_INT64_VEC4_NV 0x8FEB +#define GL_UNSIGNED_INT8_NV 0x8FEC +#define GL_UNSIGNED_INT8_VEC2_NV 0x8FED +#define GL_UNSIGNED_INT8_VEC3_NV 0x8FEE +#define GL_UNSIGNED_INT8_VEC4_NV 0x8FEF +#define GL_UNSIGNED_INT16_NV 0x8FF0 +#define GL_UNSIGNED_INT16_VEC2_NV 0x8FF1 +#define GL_UNSIGNED_INT16_VEC3_NV 0x8FF2 +#define GL_UNSIGNED_INT16_VEC4_NV 0x8FF3 +#define GL_UNSIGNED_INT64_VEC2_NV 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_NV 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_NV 0x8FF7 +#define GL_FLOAT16_NV 0x8FF8 +#define GL_FLOAT16_VEC2_NV 0x8FF9 +#define GL_FLOAT16_VEC3_NV 0x8FFA +#define GL_FLOAT16_VEC4_NV 0x8FFB +#define GL_PATCHES 0x000E +typedef void (GL_APIENTRYP PFNGLUNIFORM1I64NVPROC) (GLint location, GLint64EXT x); +typedef void (GL_APIENTRYP PFNGLUNIFORM2I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y); +typedef void (GL_APIENTRYP PFNGLUNIFORM3I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (GL_APIENTRYP PFNGLUNIFORM4I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (GL_APIENTRYP PFNGLUNIFORM1I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM2I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM3I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM4I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM1UI64NVPROC) (GLint location, GLuint64EXT x); +typedef void (GL_APIENTRYP PFNGLUNIFORM2UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (GL_APIENTRYP PFNGLUNIFORM3UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (GL_APIENTRYP PFNGLUNIFORM4UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (GL_APIENTRYP PFNGLUNIFORM1UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM2UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM3UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (GL_APIENTRYP PFNGLUNIFORM4UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (GL_APIENTRYP PFNGLGETUNIFORMI64VNVPROC) (GLuint program, GLint location, GLint64EXT *params); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1I64NVPROC) (GLuint program, GLint location, GLint64EXT x); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM1UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM2UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM3UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (GL_APIENTRYP PFNGLPROGRAMUNIFORM4UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glUniform1i64NV (GLint location, GLint64EXT x); +GL_APICALL void GL_APIENTRY glUniform2i64NV (GLint location, GLint64EXT x, GLint64EXT y); +GL_APICALL void GL_APIENTRY glUniform3i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GL_APICALL void GL_APIENTRY glUniform4i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GL_APICALL void GL_APIENTRY glUniform1i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GL_APICALL void GL_APIENTRY glUniform2i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GL_APICALL void GL_APIENTRY glUniform3i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GL_APICALL void GL_APIENTRY glUniform4i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GL_APICALL void GL_APIENTRY glUniform1ui64NV (GLint location, GLuint64EXT x); +GL_APICALL void GL_APIENTRY glUniform2ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y); +GL_APICALL void GL_APIENTRY glUniform3ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GL_APICALL void GL_APIENTRY glUniform4ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GL_APICALL void GL_APIENTRY glUniform1ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GL_APICALL void GL_APIENTRY glUniform2ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GL_APICALL void GL_APIENTRY glUniform3ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GL_APICALL void GL_APIENTRY glUniform4ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GL_APICALL void GL_APIENTRY glGetUniformi64vNV (GLuint program, GLint location, GLint64EXT *params); +GL_APICALL void GL_APIENTRY glProgramUniform1i64NV (GLuint program, GLint location, GLint64EXT x); +GL_APICALL void GL_APIENTRY glProgramUniform2i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +GL_APICALL void GL_APIENTRY glProgramUniform3i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GL_APICALL void GL_APIENTRY glProgramUniform4i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GL_APICALL void GL_APIENTRY glProgramUniform1i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GL_APICALL void GL_APIENTRY glProgramUniform2i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GL_APICALL void GL_APIENTRY glProgramUniform3i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GL_APICALL void GL_APIENTRY glProgramUniform4i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GL_APICALL void GL_APIENTRY glProgramUniform1ui64NV (GLuint program, GLint location, GLuint64EXT x); +GL_APICALL void GL_APIENTRY glProgramUniform2ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +GL_APICALL void GL_APIENTRY glProgramUniform3ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GL_APICALL void GL_APIENTRY glProgramUniform4ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GL_APICALL void GL_APIENTRY glProgramUniform1ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GL_APICALL void GL_APIENTRY glProgramUniform2ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GL_APICALL void GL_APIENTRY glProgramUniform3ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GL_APICALL void GL_APIENTRY glProgramUniform4ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif +#endif /* GL_NV_gpu_shader5 */ + +#ifndef GL_NV_image_formats +#define GL_NV_image_formats 1 +#endif /* GL_NV_image_formats */ -/* GL_NV_instanced_arrays */ #ifndef GL_NV_instanced_arrays #define GL_NV_instanced_arrays 1 +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_NV 0x88FE +typedef void (GL_APIENTRYP PFNGLVERTEXATTRIBDIVISORNVPROC) (GLuint index, GLuint divisor); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glVertexAttribDivisorNV (GLuint index, GLuint divisor); #endif -typedef void (GL_APIENTRYP PFNGLVERTEXATTRIBDIVISORNVPROC) (GLuint index, GLuint divisor); -#endif +#endif /* GL_NV_instanced_arrays */ + +#ifndef GL_NV_internalformat_sample_query +#define GL_NV_internalformat_sample_query 1 +#define GL_TEXTURE_2D_MULTISAMPLE 0x9100 +#define GL_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9102 +#define GL_MULTISAMPLES_NV 0x9371 +#define GL_SUPERSAMPLE_SCALE_X_NV 0x9372 +#define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373 +#define GL_CONFORMANT_NV 0x9374 +typedef void (GL_APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params); +#endif +#endif /* GL_NV_internalformat_sample_query */ + +#ifndef GL_NV_memory_attachment +#define GL_NV_memory_attachment 1 +#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4 +#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5 +#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6 +#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7 +#define GL_MEMORY_ATTACHABLE_NV 0x95A8 +#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9 +#define GL_DETACHED_TEXTURES_NV 0x95AA +#define GL_DETACHED_BUFFERS_NV 0x95AB +#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC +#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD +typedef void (GL_APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +typedef void (GL_APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname); +typedef void (GL_APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +GL_APICALL void GL_APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname); +GL_APICALL void GL_APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_NV_memory_attachment */ + +#ifndef GL_NV_memory_object_sparse +#define GL_NV_memory_object_sparse 1 +typedef void (GL_APIENTRYP PFNGLBUFFERPAGECOMMITMENTMEMNVPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +typedef void (GL_APIENTRYP PFNGLTEXPAGECOMMITMENTMEMNVPROC) (GLenum target, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTMEMNVPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +typedef void (GL_APIENTRYP PFNGLTEXTUREPAGECOMMITMENTMEMNVPROC) (GLuint texture, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBufferPageCommitmentMemNV (GLenum target, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +GL_APICALL void GL_APIENTRY glTexPageCommitmentMemNV (GLenum target, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +GL_APICALL void GL_APIENTRY glNamedBufferPageCommitmentMemNV (GLuint buffer, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +GL_APICALL void GL_APIENTRY glTexturePageCommitmentMemNV (GLuint texture, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +#endif +#endif /* GL_NV_memory_object_sparse */ + +#ifndef GL_NV_mesh_shader +#define GL_NV_mesh_shader 1 +#define GL_MESH_SHADER_NV 0x9559 +#define GL_TASK_SHADER_NV 0x955A +#define GL_MAX_MESH_UNIFORM_BLOCKS_NV 0x8E60 +#define GL_MAX_MESH_TEXTURE_IMAGE_UNITS_NV 0x8E61 +#define GL_MAX_MESH_IMAGE_UNIFORMS_NV 0x8E62 +#define GL_MAX_MESH_UNIFORM_COMPONENTS_NV 0x8E63 +#define GL_MAX_MESH_ATOMIC_COUNTER_BUFFERS_NV 0x8E64 +#define GL_MAX_MESH_ATOMIC_COUNTERS_NV 0x8E65 +#define GL_MAX_MESH_SHADER_STORAGE_BLOCKS_NV 0x8E66 +#define GL_MAX_COMBINED_MESH_UNIFORM_COMPONENTS_NV 0x8E67 +#define GL_MAX_TASK_UNIFORM_BLOCKS_NV 0x8E68 +#define GL_MAX_TASK_TEXTURE_IMAGE_UNITS_NV 0x8E69 +#define GL_MAX_TASK_IMAGE_UNIFORMS_NV 0x8E6A +#define GL_MAX_TASK_UNIFORM_COMPONENTS_NV 0x8E6B +#define GL_MAX_TASK_ATOMIC_COUNTER_BUFFERS_NV 0x8E6C +#define GL_MAX_TASK_ATOMIC_COUNTERS_NV 0x8E6D +#define GL_MAX_TASK_SHADER_STORAGE_BLOCKS_NV 0x8E6E +#define GL_MAX_COMBINED_TASK_UNIFORM_COMPONENTS_NV 0x8E6F +#define GL_MAX_MESH_WORK_GROUP_INVOCATIONS_NV 0x95A2 +#define GL_MAX_TASK_WORK_GROUP_INVOCATIONS_NV 0x95A3 +#define GL_MAX_MESH_TOTAL_MEMORY_SIZE_NV 0x9536 +#define GL_MAX_TASK_TOTAL_MEMORY_SIZE_NV 0x9537 +#define GL_MAX_MESH_OUTPUT_VERTICES_NV 0x9538 +#define GL_MAX_MESH_OUTPUT_PRIMITIVES_NV 0x9539 +#define GL_MAX_TASK_OUTPUT_COUNT_NV 0x953A +#define GL_MAX_DRAW_MESH_TASKS_COUNT_NV 0x953D +#define GL_MAX_MESH_VIEWS_NV 0x9557 +#define GL_MESH_OUTPUT_PER_VERTEX_GRANULARITY_NV 0x92DF +#define GL_MESH_OUTPUT_PER_PRIMITIVE_GRANULARITY_NV 0x9543 +#define GL_MAX_MESH_WORK_GROUP_SIZE_NV 0x953B +#define GL_MAX_TASK_WORK_GROUP_SIZE_NV 0x953C +#define GL_MESH_WORK_GROUP_SIZE_NV 0x953E +#define GL_TASK_WORK_GROUP_SIZE_NV 0x953F +#define GL_MESH_VERTICES_OUT_NV 0x9579 +#define GL_MESH_PRIMITIVES_OUT_NV 0x957A +#define GL_MESH_OUTPUT_TYPE_NV 0x957B +#define GL_UNIFORM_BLOCK_REFERENCED_BY_MESH_SHADER_NV 0x959C +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TASK_SHADER_NV 0x959D +#define GL_REFERENCED_BY_MESH_SHADER_NV 0x95A0 +#define GL_REFERENCED_BY_TASK_SHADER_NV 0x95A1 +#define GL_MESH_SHADER_BIT_NV 0x00000040 +#define GL_TASK_SHADER_BIT_NV 0x00000080 +#define GL_MESH_SUBROUTINE_NV 0x957C +#define GL_TASK_SUBROUTINE_NV 0x957D +#define GL_MESH_SUBROUTINE_UNIFORM_NV 0x957E +#define GL_TASK_SUBROUTINE_UNIFORM_NV 0x957F +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_MESH_SHADER_NV 0x959E +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TASK_SHADER_NV 0x959F +typedef void (GL_APIENTRYP PFNGLDRAWMESHTASKSNVPROC) (GLuint first, GLuint count); +typedef void (GL_APIENTRYP PFNGLDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect); +typedef void (GL_APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect, GLsizei drawcount, GLsizei stride); +typedef void (GL_APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTCOUNTNVPROC) (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glDrawMeshTasksNV (GLuint first, GLuint count); +GL_APICALL void GL_APIENTRY glDrawMeshTasksIndirectNV (GLintptr indirect); +GL_APICALL void GL_APIENTRY glMultiDrawMeshTasksIndirectNV (GLintptr indirect, GLsizei drawcount, GLsizei stride); +GL_APICALL void GL_APIENTRY glMultiDrawMeshTasksIndirectCountNV (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#endif +#endif /* GL_NV_mesh_shader */ + +#ifndef GL_NV_non_square_matrices +#define GL_NV_non_square_matrices 1 +#define GL_FLOAT_MAT2x3_NV 0x8B65 +#define GL_FLOAT_MAT2x4_NV 0x8B66 +#define GL_FLOAT_MAT3x2_NV 0x8B67 +#define GL_FLOAT_MAT3x4_NV 0x8B68 +#define GL_FLOAT_MAT4x2_NV 0x8B69 +#define GL_FLOAT_MAT4x3_NV 0x8B6A +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX2X3FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX3X2FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX2X4FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX4X2FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX3X4FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLUNIFORMMATRIX4X3FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glUniformMatrix2x3fvNV (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniformMatrix3x2fvNV (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniformMatrix2x4fvNV (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniformMatrix4x2fvNV (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniformMatrix3x4fvNV (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GL_APICALL void GL_APIENTRY glUniformMatrix4x3fvNV (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#endif +#endif /* GL_NV_non_square_matrices */ + +#ifndef GL_NV_path_rendering +#define GL_NV_path_rendering 1 +typedef double GLdouble; +#define GL_PATH_FORMAT_SVG_NV 0x9070 +#define GL_PATH_FORMAT_PS_NV 0x9071 +#define GL_STANDARD_FONT_NAME_NV 0x9072 +#define GL_SYSTEM_FONT_NAME_NV 0x9073 +#define GL_FILE_NAME_NV 0x9074 +#define GL_PATH_STROKE_WIDTH_NV 0x9075 +#define GL_PATH_END_CAPS_NV 0x9076 +#define GL_PATH_INITIAL_END_CAP_NV 0x9077 +#define GL_PATH_TERMINAL_END_CAP_NV 0x9078 +#define GL_PATH_JOIN_STYLE_NV 0x9079 +#define GL_PATH_MITER_LIMIT_NV 0x907A +#define GL_PATH_DASH_CAPS_NV 0x907B +#define GL_PATH_INITIAL_DASH_CAP_NV 0x907C +#define GL_PATH_TERMINAL_DASH_CAP_NV 0x907D +#define GL_PATH_DASH_OFFSET_NV 0x907E +#define GL_PATH_CLIENT_LENGTH_NV 0x907F +#define GL_PATH_FILL_MODE_NV 0x9080 +#define GL_PATH_FILL_MASK_NV 0x9081 +#define GL_PATH_FILL_COVER_MODE_NV 0x9082 +#define GL_PATH_STROKE_COVER_MODE_NV 0x9083 +#define GL_PATH_STROKE_MASK_NV 0x9084 +#define GL_COUNT_UP_NV 0x9088 +#define GL_COUNT_DOWN_NV 0x9089 +#define GL_PATH_OBJECT_BOUNDING_BOX_NV 0x908A +#define GL_CONVEX_HULL_NV 0x908B +#define GL_BOUNDING_BOX_NV 0x908D +#define GL_TRANSLATE_X_NV 0x908E +#define GL_TRANSLATE_Y_NV 0x908F +#define GL_TRANSLATE_2D_NV 0x9090 +#define GL_TRANSLATE_3D_NV 0x9091 +#define GL_AFFINE_2D_NV 0x9092 +#define GL_AFFINE_3D_NV 0x9094 +#define GL_TRANSPOSE_AFFINE_2D_NV 0x9096 +#define GL_TRANSPOSE_AFFINE_3D_NV 0x9098 +#define GL_UTF8_NV 0x909A +#define GL_UTF16_NV 0x909B +#define GL_BOUNDING_BOX_OF_BOUNDING_BOXES_NV 0x909C +#define GL_PATH_COMMAND_COUNT_NV 0x909D +#define GL_PATH_COORD_COUNT_NV 0x909E +#define GL_PATH_DASH_ARRAY_COUNT_NV 0x909F +#define GL_PATH_COMPUTED_LENGTH_NV 0x90A0 +#define GL_PATH_FILL_BOUNDING_BOX_NV 0x90A1 +#define GL_PATH_STROKE_BOUNDING_BOX_NV 0x90A2 +#define GL_SQUARE_NV 0x90A3 +#define GL_ROUND_NV 0x90A4 +#define GL_TRIANGULAR_NV 0x90A5 +#define GL_BEVEL_NV 0x90A6 +#define GL_MITER_REVERT_NV 0x90A7 +#define GL_MITER_TRUNCATE_NV 0x90A8 +#define GL_SKIP_MISSING_GLYPH_NV 0x90A9 +#define GL_USE_MISSING_GLYPH_NV 0x90AA +#define GL_PATH_ERROR_POSITION_NV 0x90AB +#define GL_ACCUM_ADJACENT_PAIRS_NV 0x90AD +#define GL_ADJACENT_PAIRS_NV 0x90AE +#define GL_FIRST_TO_REST_NV 0x90AF +#define GL_PATH_GEN_MODE_NV 0x90B0 +#define GL_PATH_GEN_COEFF_NV 0x90B1 +#define GL_PATH_GEN_COMPONENTS_NV 0x90B3 +#define GL_PATH_STENCIL_FUNC_NV 0x90B7 +#define GL_PATH_STENCIL_REF_NV 0x90B8 +#define GL_PATH_STENCIL_VALUE_MASK_NV 0x90B9 +#define GL_PATH_STENCIL_DEPTH_OFFSET_FACTOR_NV 0x90BD +#define GL_PATH_STENCIL_DEPTH_OFFSET_UNITS_NV 0x90BE +#define GL_PATH_COVER_DEPTH_FUNC_NV 0x90BF +#define GL_PATH_DASH_OFFSET_RESET_NV 0x90B4 +#define GL_MOVE_TO_RESETS_NV 0x90B5 +#define GL_MOVE_TO_CONTINUES_NV 0x90B6 +#define GL_CLOSE_PATH_NV 0x00 +#define GL_MOVE_TO_NV 0x02 +#define GL_RELATIVE_MOVE_TO_NV 0x03 +#define GL_LINE_TO_NV 0x04 +#define GL_RELATIVE_LINE_TO_NV 0x05 +#define GL_HORIZONTAL_LINE_TO_NV 0x06 +#define GL_RELATIVE_HORIZONTAL_LINE_TO_NV 0x07 +#define GL_VERTICAL_LINE_TO_NV 0x08 +#define GL_RELATIVE_VERTICAL_LINE_TO_NV 0x09 +#define GL_QUADRATIC_CURVE_TO_NV 0x0A +#define GL_RELATIVE_QUADRATIC_CURVE_TO_NV 0x0B +#define GL_CUBIC_CURVE_TO_NV 0x0C +#define GL_RELATIVE_CUBIC_CURVE_TO_NV 0x0D +#define GL_SMOOTH_QUADRATIC_CURVE_TO_NV 0x0E +#define GL_RELATIVE_SMOOTH_QUADRATIC_CURVE_TO_NV 0x0F +#define GL_SMOOTH_CUBIC_CURVE_TO_NV 0x10 +#define GL_RELATIVE_SMOOTH_CUBIC_CURVE_TO_NV 0x11 +#define GL_SMALL_CCW_ARC_TO_NV 0x12 +#define GL_RELATIVE_SMALL_CCW_ARC_TO_NV 0x13 +#define GL_SMALL_CW_ARC_TO_NV 0x14 +#define GL_RELATIVE_SMALL_CW_ARC_TO_NV 0x15 +#define GL_LARGE_CCW_ARC_TO_NV 0x16 +#define GL_RELATIVE_LARGE_CCW_ARC_TO_NV 0x17 +#define GL_LARGE_CW_ARC_TO_NV 0x18 +#define GL_RELATIVE_LARGE_CW_ARC_TO_NV 0x19 +#define GL_RESTART_PATH_NV 0xF0 +#define GL_DUP_FIRST_CUBIC_CURVE_TO_NV 0xF2 +#define GL_DUP_LAST_CUBIC_CURVE_TO_NV 0xF4 +#define GL_RECT_NV 0xF6 +#define GL_CIRCULAR_CCW_ARC_TO_NV 0xF8 +#define GL_CIRCULAR_CW_ARC_TO_NV 0xFA +#define GL_CIRCULAR_TANGENT_ARC_TO_NV 0xFC +#define GL_ARC_TO_NV 0xFE +#define GL_RELATIVE_ARC_TO_NV 0xFF +#define GL_BOLD_BIT_NV 0x01 +#define GL_ITALIC_BIT_NV 0x02 +#define GL_GLYPH_WIDTH_BIT_NV 0x01 +#define GL_GLYPH_HEIGHT_BIT_NV 0x02 +#define GL_GLYPH_HORIZONTAL_BEARING_X_BIT_NV 0x04 +#define GL_GLYPH_HORIZONTAL_BEARING_Y_BIT_NV 0x08 +#define GL_GLYPH_HORIZONTAL_BEARING_ADVANCE_BIT_NV 0x10 +#define GL_GLYPH_VERTICAL_BEARING_X_BIT_NV 0x20 +#define GL_GLYPH_VERTICAL_BEARING_Y_BIT_NV 0x40 +#define GL_GLYPH_VERTICAL_BEARING_ADVANCE_BIT_NV 0x80 +#define GL_GLYPH_HAS_KERNING_BIT_NV 0x100 +#define GL_FONT_X_MIN_BOUNDS_BIT_NV 0x00010000 +#define GL_FONT_Y_MIN_BOUNDS_BIT_NV 0x00020000 +#define GL_FONT_X_MAX_BOUNDS_BIT_NV 0x00040000 +#define GL_FONT_Y_MAX_BOUNDS_BIT_NV 0x00080000 +#define GL_FONT_UNITS_PER_EM_BIT_NV 0x00100000 +#define GL_FONT_ASCENDER_BIT_NV 0x00200000 +#define GL_FONT_DESCENDER_BIT_NV 0x00400000 +#define GL_FONT_HEIGHT_BIT_NV 0x00800000 +#define GL_FONT_MAX_ADVANCE_WIDTH_BIT_NV 0x01000000 +#define GL_FONT_MAX_ADVANCE_HEIGHT_BIT_NV 0x02000000 +#define GL_FONT_UNDERLINE_POSITION_BIT_NV 0x04000000 +#define GL_FONT_UNDERLINE_THICKNESS_BIT_NV 0x08000000 +#define GL_FONT_HAS_KERNING_BIT_NV 0x10000000 +#define GL_ROUNDED_RECT_NV 0xE8 +#define GL_RELATIVE_ROUNDED_RECT_NV 0xE9 +#define GL_ROUNDED_RECT2_NV 0xEA +#define GL_RELATIVE_ROUNDED_RECT2_NV 0xEB +#define GL_ROUNDED_RECT4_NV 0xEC +#define GL_RELATIVE_ROUNDED_RECT4_NV 0xED +#define GL_ROUNDED_RECT8_NV 0xEE +#define GL_RELATIVE_ROUNDED_RECT8_NV 0xEF +#define GL_RELATIVE_RECT_NV 0xF7 +#define GL_FONT_GLYPHS_AVAILABLE_NV 0x9368 +#define GL_FONT_TARGET_UNAVAILABLE_NV 0x9369 +#define GL_FONT_UNAVAILABLE_NV 0x936A +#define GL_FONT_UNINTELLIGIBLE_NV 0x936B +#define GL_CONIC_CURVE_TO_NV 0x1A +#define GL_RELATIVE_CONIC_CURVE_TO_NV 0x1B +#define GL_FONT_NUM_GLYPH_INDICES_BIT_NV 0x20000000 +#define GL_STANDARD_FONT_FORMAT_NV 0x936C +#define GL_PATH_PROJECTION_NV 0x1701 +#define GL_PATH_MODELVIEW_NV 0x1700 +#define GL_PATH_MODELVIEW_STACK_DEPTH_NV 0x0BA3 +#define GL_PATH_MODELVIEW_MATRIX_NV 0x0BA6 +#define GL_PATH_MAX_MODELVIEW_STACK_DEPTH_NV 0x0D36 +#define GL_PATH_TRANSPOSE_MODELVIEW_MATRIX_NV 0x84E3 +#define GL_PATH_PROJECTION_STACK_DEPTH_NV 0x0BA4 +#define GL_PATH_PROJECTION_MATRIX_NV 0x0BA7 +#define GL_PATH_MAX_PROJECTION_STACK_DEPTH_NV 0x0D38 +#define GL_PATH_TRANSPOSE_PROJECTION_MATRIX_NV 0x84E4 +#define GL_FRAGMENT_INPUT_NV 0x936D +typedef GLuint (GL_APIENTRYP PFNGLGENPATHSNVPROC) (GLsizei range); +typedef void (GL_APIENTRYP PFNGLDELETEPATHSNVPROC) (GLuint path, GLsizei range); +typedef GLboolean (GL_APIENTRYP PFNGLISPATHNVPROC) (GLuint path); +typedef void (GL_APIENTRYP PFNGLPATHCOMMANDSNVPROC) (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (GL_APIENTRYP PFNGLPATHCOORDSNVPROC) (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (GL_APIENTRYP PFNGLPATHSUBCOMMANDSNVPROC) (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (GL_APIENTRYP PFNGLPATHSUBCOORDSNVPROC) (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (GL_APIENTRYP PFNGLPATHSTRINGNVPROC) (GLuint path, GLenum format, GLsizei length, const void *pathString); +typedef void (GL_APIENTRYP PFNGLPATHGLYPHSNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (GL_APIENTRYP PFNGLPATHGLYPHRANGENVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (GL_APIENTRYP PFNGLWEIGHTPATHSNVPROC) (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); +typedef void (GL_APIENTRYP PFNGLCOPYPATHNVPROC) (GLuint resultPath, GLuint srcPath); +typedef void (GL_APIENTRYP PFNGLINTERPOLATEPATHSNVPROC) (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); +typedef void (GL_APIENTRYP PFNGLTRANSFORMPATHNVPROC) (GLuint resultPath, GLuint srcPath, GLenum transformType, const GLfloat *transformValues); +typedef void (GL_APIENTRYP PFNGLPATHPARAMETERIVNVPROC) (GLuint path, GLenum pname, const GLint *value); +typedef void (GL_APIENTRYP PFNGLPATHPARAMETERINVPROC) (GLuint path, GLenum pname, GLint value); +typedef void (GL_APIENTRYP PFNGLPATHPARAMETERFVNVPROC) (GLuint path, GLenum pname, const GLfloat *value); +typedef void (GL_APIENTRYP PFNGLPATHPARAMETERFNVPROC) (GLuint path, GLenum pname, GLfloat value); +typedef void (GL_APIENTRYP PFNGLPATHDASHARRAYNVPROC) (GLuint path, GLsizei dashCount, const GLfloat *dashArray); +typedef void (GL_APIENTRYP PFNGLPATHSTENCILFUNCNVPROC) (GLenum func, GLint ref, GLuint mask); +typedef void (GL_APIENTRYP PFNGLPATHSTENCILDEPTHOFFSETNVPROC) (GLfloat factor, GLfloat units); +typedef void (GL_APIENTRYP PFNGLSTENCILFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask); +typedef void (GL_APIENTRYP PFNGLSTENCILSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask); +typedef void (GL_APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (GL_APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (GL_APIENTRYP PFNGLPATHCOVERDEPTHFUNCNVPROC) (GLenum func); +typedef void (GL_APIENTRYP PFNGLCOVERFILLPATHNVPROC) (GLuint path, GLenum coverMode); +typedef void (GL_APIENTRYP PFNGLCOVERSTROKEPATHNVPROC) (GLuint path, GLenum coverMode); +typedef void (GL_APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (GL_APIENTRYP PFNGLCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (GL_APIENTRYP PFNGLGETPATHPARAMETERIVNVPROC) (GLuint path, GLenum pname, GLint *value); +typedef void (GL_APIENTRYP PFNGLGETPATHPARAMETERFVNVPROC) (GLuint path, GLenum pname, GLfloat *value); +typedef void (GL_APIENTRYP PFNGLGETPATHCOMMANDSNVPROC) (GLuint path, GLubyte *commands); +typedef void (GL_APIENTRYP PFNGLGETPATHCOORDSNVPROC) (GLuint path, GLfloat *coords); +typedef void (GL_APIENTRYP PFNGLGETPATHDASHARRAYNVPROC) (GLuint path, GLfloat *dashArray); +typedef void (GL_APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +typedef void (GL_APIENTRYP PFNGLGETPATHMETRICRANGENVPROC) (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); +typedef void (GL_APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); +typedef GLboolean (GL_APIENTRYP PFNGLISPOINTINFILLPATHNVPROC) (GLuint path, GLuint mask, GLfloat x, GLfloat y); +typedef GLboolean (GL_APIENTRYP PFNGLISPOINTINSTROKEPATHNVPROC) (GLuint path, GLfloat x, GLfloat y); +typedef GLfloat (GL_APIENTRYP PFNGLGETPATHLENGTHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments); +typedef GLboolean (GL_APIENTRYP PFNGLPOINTALONGPATHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +typedef void (GL_APIENTRYP PFNGLMATRIXLOAD3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOAD3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULT3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULT3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +typedef void (GL_APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +typedef void (GL_APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (GL_APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef GLenum (GL_APIENTRYP PFNGLPATHGLYPHINDEXRANGENVPROC) (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint *baseAndCount); +typedef GLenum (GL_APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef GLenum (GL_APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (GL_APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +typedef void (GL_APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params); +typedef void (GL_APIENTRYP PFNGLMATRIXFRUSTUMEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADIDENTITYEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXORTHOEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (GL_APIENTRYP PFNGLMATRIXPOPEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXPUSHEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXROTATEFEXTPROC) (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXROTATEDEXTPROC) (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +typedef void (GL_APIENTRYP PFNGLMATRIXSCALEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXSCALEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (GL_APIENTRYP PFNGLMATRIXTRANSLATEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXTRANSLATEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL GLuint GL_APIENTRY glGenPathsNV (GLsizei range); +GL_APICALL void GL_APIENTRY glDeletePathsNV (GLuint path, GLsizei range); +GL_APICALL GLboolean GL_APIENTRY glIsPathNV (GLuint path); +GL_APICALL void GL_APIENTRY glPathCommandsNV (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GL_APICALL void GL_APIENTRY glPathCoordsNV (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +GL_APICALL void GL_APIENTRY glPathSubCommandsNV (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GL_APICALL void GL_APIENTRY glPathSubCoordsNV (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +GL_APICALL void GL_APIENTRY glPathStringNV (GLuint path, GLenum format, GLsizei length, const void *pathString); +GL_APICALL void GL_APIENTRY glPathGlyphsNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GL_APICALL void GL_APIENTRY glPathGlyphRangeNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GL_APICALL void GL_APIENTRY glWeightPathsNV (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); +GL_APICALL void GL_APIENTRY glCopyPathNV (GLuint resultPath, GLuint srcPath); +GL_APICALL void GL_APIENTRY glInterpolatePathsNV (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); +GL_APICALL void GL_APIENTRY glTransformPathNV (GLuint resultPath, GLuint srcPath, GLenum transformType, const GLfloat *transformValues); +GL_APICALL void GL_APIENTRY glPathParameterivNV (GLuint path, GLenum pname, const GLint *value); +GL_APICALL void GL_APIENTRY glPathParameteriNV (GLuint path, GLenum pname, GLint value); +GL_APICALL void GL_APIENTRY glPathParameterfvNV (GLuint path, GLenum pname, const GLfloat *value); +GL_APICALL void GL_APIENTRY glPathParameterfNV (GLuint path, GLenum pname, GLfloat value); +GL_APICALL void GL_APIENTRY glPathDashArrayNV (GLuint path, GLsizei dashCount, const GLfloat *dashArray); +GL_APICALL void GL_APIENTRY glPathStencilFuncNV (GLenum func, GLint ref, GLuint mask); +GL_APICALL void GL_APIENTRY glPathStencilDepthOffsetNV (GLfloat factor, GLfloat units); +GL_APICALL void GL_APIENTRY glStencilFillPathNV (GLuint path, GLenum fillMode, GLuint mask); +GL_APICALL void GL_APIENTRY glStencilStrokePathNV (GLuint path, GLint reference, GLuint mask); +GL_APICALL void GL_APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GL_APICALL void GL_APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GL_APICALL void GL_APIENTRY glPathCoverDepthFuncNV (GLenum func); +GL_APICALL void GL_APIENTRY glCoverFillPathNV (GLuint path, GLenum coverMode); +GL_APICALL void GL_APIENTRY glCoverStrokePathNV (GLuint path, GLenum coverMode); +GL_APICALL void GL_APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GL_APICALL void GL_APIENTRY glCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GL_APICALL void GL_APIENTRY glGetPathParameterivNV (GLuint path, GLenum pname, GLint *value); +GL_APICALL void GL_APIENTRY glGetPathParameterfvNV (GLuint path, GLenum pname, GLfloat *value); +GL_APICALL void GL_APIENTRY glGetPathCommandsNV (GLuint path, GLubyte *commands); +GL_APICALL void GL_APIENTRY glGetPathCoordsNV (GLuint path, GLfloat *coords); +GL_APICALL void GL_APIENTRY glGetPathDashArrayNV (GLuint path, GLfloat *dashArray); +GL_APICALL void GL_APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +GL_APICALL void GL_APIENTRY glGetPathMetricRangeNV (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); +GL_APICALL void GL_APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); +GL_APICALL GLboolean GL_APIENTRY glIsPointInFillPathNV (GLuint path, GLuint mask, GLfloat x, GLfloat y); +GL_APICALL GLboolean GL_APIENTRY glIsPointInStrokePathNV (GLuint path, GLfloat x, GLfloat y); +GL_APICALL GLfloat GL_APIENTRY glGetPathLengthNV (GLuint path, GLsizei startSegment, GLsizei numSegments); +GL_APICALL GLboolean GL_APIENTRY glPointAlongPathNV (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +GL_APICALL void GL_APIENTRY glMatrixLoad3x2fNV (GLenum matrixMode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixLoad3x3fNV (GLenum matrixMode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixLoadTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMult3x2fNV (GLenum matrixMode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMult3x3fNV (GLenum matrixMode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMultTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glStencilThenCoverFillPathNV (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +GL_APICALL void GL_APIENTRY glStencilThenCoverStrokePathNV (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +GL_APICALL void GL_APIENTRY glStencilThenCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GL_APICALL void GL_APIENTRY glStencilThenCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GL_APICALL GLenum GL_APIENTRY glPathGlyphIndexRangeNV (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint *baseAndCount); +GL_APICALL GLenum GL_APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GL_APICALL GLenum GL_APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GL_APICALL void GL_APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +GL_APICALL void GL_APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params); +GL_APICALL void GL_APIENTRY glMatrixFrustumEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GL_APICALL void GL_APIENTRY glMatrixLoadIdentityEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixLoadTransposefEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixLoadTransposedEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixLoaddEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixMultTransposefEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMultTransposedEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixMultfEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMultdEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixOrthoEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GL_APICALL void GL_APIENTRY glMatrixPopEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixPushEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixRotatefEXT (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixRotatedEXT (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +GL_APICALL void GL_APIENTRY glMatrixScalefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixScaledEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GL_APICALL void GL_APIENTRY glMatrixTranslatefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixTranslatedEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +#endif +#endif /* GL_NV_path_rendering */ + +#ifndef GL_NV_path_rendering_shared_edge +#define GL_NV_path_rendering_shared_edge 1 +#define GL_SHARED_EDGE_NV 0xC0 +#endif /* GL_NV_path_rendering_shared_edge */ + +#ifndef GL_NV_pixel_buffer_object +#define GL_NV_pixel_buffer_object 1 +#define GL_PIXEL_PACK_BUFFER_NV 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_NV 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_NV 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_NV 0x88EF +#endif /* GL_NV_pixel_buffer_object */ + +#ifndef GL_NV_polygon_mode +#define GL_NV_polygon_mode 1 +#define GL_POLYGON_MODE_NV 0x0B40 +#define GL_POLYGON_OFFSET_POINT_NV 0x2A01 +#define GL_POLYGON_OFFSET_LINE_NV 0x2A02 +#define GL_POINT_NV 0x1B00 +#define GL_LINE_NV 0x1B01 +#define GL_FILL_NV 0x1B02 +typedef void (GL_APIENTRYP PFNGLPOLYGONMODENVPROC) (GLenum face, GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glPolygonModeNV (GLenum face, GLenum mode); +#endif +#endif /* GL_NV_polygon_mode */ + +#ifndef GL_NV_primitive_shading_rate +#define GL_NV_primitive_shading_rate 1 +#define GL_SHADING_RATE_IMAGE_PER_PRIMITIVE_NV 0x95B1 +#define GL_SHADING_RATE_IMAGE_PALETTE_COUNT_NV 0x95B2 +#endif /* GL_NV_primitive_shading_rate */ -/* GL_NV_read_buffer */ #ifndef GL_NV_read_buffer #define GL_NV_read_buffer 1 +#define GL_READ_BUFFER_NV 0x0C02 +typedef void (GL_APIENTRYP PFNGLREADBUFFERNVPROC) (GLenum mode); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glReadBufferNV (GLenum mode); #endif -typedef void (GL_APIENTRYP PFNGLREADBUFFERNVPROC) (GLenum mode); -#endif +#endif /* GL_NV_read_buffer */ -/* GL_NV_read_buffer_front */ #ifndef GL_NV_read_buffer_front #define GL_NV_read_buffer_front 1 -#endif +#endif /* GL_NV_read_buffer_front */ -/* GL_NV_read_depth */ #ifndef GL_NV_read_depth #define GL_NV_read_depth 1 -#endif +#endif /* GL_NV_read_depth */ -/* GL_NV_read_depth_stencil */ #ifndef GL_NV_read_depth_stencil #define GL_NV_read_depth_stencil 1 -#endif +#endif /* GL_NV_read_depth_stencil */ -/* GL_NV_read_stencil */ #ifndef GL_NV_read_stencil #define GL_NV_read_stencil 1 -#endif +#endif /* GL_NV_read_stencil */ -/* GL_NV_shadow_samplers_array */ -#ifndef GL_NV_shadow_samplers_array -#define GL_NV_shadow_samplers_array 1 -#endif +#ifndef GL_NV_representative_fragment_test +#define GL_NV_representative_fragment_test 1 +#define GL_REPRESENTATIVE_FRAGMENT_TEST_NV 0x937F +#endif /* GL_NV_representative_fragment_test */ -/* GL_NV_shadow_samplers_cube */ -#ifndef GL_NV_shadow_samplers_cube -#define GL_NV_shadow_samplers_cube 1 -#endif - -/* GL_NV_sRGB_formats */ #ifndef GL_NV_sRGB_formats #define GL_NV_sRGB_formats 1 -#endif +#define GL_SLUMINANCE_NV 0x8C46 +#define GL_SLUMINANCE_ALPHA_NV 0x8C44 +#define GL_SRGB8_NV 0x8C41 +#define GL_SLUMINANCE8_NV 0x8C47 +#define GL_SLUMINANCE8_ALPHA8_NV 0x8C45 +#define GL_COMPRESSED_SRGB_S3TC_DXT1_NV 0x8C4C +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_NV 0x8C4D +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_NV 0x8C4E +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_NV 0x8C4F +#define GL_ETC1_SRGB8_NV 0x88EE +#endif /* GL_NV_sRGB_formats */ + +#ifndef GL_NV_sample_locations +#define GL_NV_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_NV 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_NV 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_NV 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_NV 0x9340 +#define GL_SAMPLE_LOCATION_NV 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_NV 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_NV 0x9343 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLRESOLVEDEPTHVALUESNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferSampleLocationsfvNV (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GL_APICALL void GL_APIENTRY glNamedFramebufferSampleLocationsfvNV (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GL_APICALL void GL_APIENTRY glResolveDepthValuesNV (void); +#endif +#endif /* GL_NV_sample_locations */ + +#ifndef GL_NV_sample_mask_override_coverage +#define GL_NV_sample_mask_override_coverage 1 +#endif /* GL_NV_sample_mask_override_coverage */ + +#ifndef GL_NV_scissor_exclusive +#define GL_NV_scissor_exclusive 1 +#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555 +#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556 +typedef void (GL_APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v); +#endif +#endif /* GL_NV_scissor_exclusive */ + +#ifndef GL_NV_shader_atomic_fp16_vector +#define GL_NV_shader_atomic_fp16_vector 1 +#endif /* GL_NV_shader_atomic_fp16_vector */ + +#ifndef GL_NV_shader_noperspective_interpolation +#define GL_NV_shader_noperspective_interpolation 1 +#endif /* GL_NV_shader_noperspective_interpolation */ + +#ifndef GL_NV_shader_subgroup_partitioned +#define GL_NV_shader_subgroup_partitioned 1 +#define GL_SUBGROUP_FEATURE_PARTITIONED_BIT_NV 0x00000100 +#endif /* GL_NV_shader_subgroup_partitioned */ + +#ifndef GL_NV_shader_texture_footprint +#define GL_NV_shader_texture_footprint 1 +#endif /* GL_NV_shader_texture_footprint */ + +#ifndef GL_NV_shading_rate_image +#define GL_NV_shading_rate_image 1 +#define GL_SHADING_RATE_IMAGE_NV 0x9563 +#define GL_SHADING_RATE_NO_INVOCATIONS_NV 0x9564 +#define GL_SHADING_RATE_1_INVOCATION_PER_PIXEL_NV 0x9565 +#define GL_SHADING_RATE_1_INVOCATION_PER_1X2_PIXELS_NV 0x9566 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X1_PIXELS_NV 0x9567 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X2_PIXELS_NV 0x9568 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X4_PIXELS_NV 0x9569 +#define GL_SHADING_RATE_1_INVOCATION_PER_4X2_PIXELS_NV 0x956A +#define GL_SHADING_RATE_1_INVOCATION_PER_4X4_PIXELS_NV 0x956B +#define GL_SHADING_RATE_2_INVOCATIONS_PER_PIXEL_NV 0x956C +#define GL_SHADING_RATE_4_INVOCATIONS_PER_PIXEL_NV 0x956D +#define GL_SHADING_RATE_8_INVOCATIONS_PER_PIXEL_NV 0x956E +#define GL_SHADING_RATE_16_INVOCATIONS_PER_PIXEL_NV 0x956F +#define GL_SHADING_RATE_IMAGE_BINDING_NV 0x955B +#define GL_SHADING_RATE_IMAGE_TEXEL_WIDTH_NV 0x955C +#define GL_SHADING_RATE_IMAGE_TEXEL_HEIGHT_NV 0x955D +#define GL_SHADING_RATE_IMAGE_PALETTE_SIZE_NV 0x955E +#define GL_MAX_COARSE_FRAGMENT_SAMPLES_NV 0x955F +#define GL_SHADING_RATE_SAMPLE_ORDER_DEFAULT_NV 0x95AE +#define GL_SHADING_RATE_SAMPLE_ORDER_PIXEL_MAJOR_NV 0x95AF +#define GL_SHADING_RATE_SAMPLE_ORDER_SAMPLE_MAJOR_NV 0x95B0 +typedef void (GL_APIENTRYP PFNGLBINDSHADINGRATEIMAGENVPROC) (GLuint texture); +typedef void (GL_APIENTRYP PFNGLGETSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint entry, GLenum *rate); +typedef void (GL_APIENTRYP PFNGLGETSHADINGRATESAMPLELOCATIONIVNVPROC) (GLenum rate, GLuint samples, GLuint index, GLint *location); +typedef void (GL_APIENTRYP PFNGLSHADINGRATEIMAGEBARRIERNVPROC) (GLboolean synchronize); +typedef void (GL_APIENTRYP PFNGLSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +typedef void (GL_APIENTRYP PFNGLSHADINGRATESAMPLEORDERNVPROC) (GLenum order); +typedef void (GL_APIENTRYP PFNGLSHADINGRATESAMPLEORDERCUSTOMNVPROC) (GLenum rate, GLuint samples, const GLint *locations); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBindShadingRateImageNV (GLuint texture); +GL_APICALL void GL_APIENTRY glGetShadingRateImagePaletteNV (GLuint viewport, GLuint entry, GLenum *rate); +GL_APICALL void GL_APIENTRY glGetShadingRateSampleLocationivNV (GLenum rate, GLuint samples, GLuint index, GLint *location); +GL_APICALL void GL_APIENTRY glShadingRateImageBarrierNV (GLboolean synchronize); +GL_APICALL void GL_APIENTRY glShadingRateImagePaletteNV (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +GL_APICALL void GL_APIENTRY glShadingRateSampleOrderNV (GLenum order); +GL_APICALL void GL_APIENTRY glShadingRateSampleOrderCustomNV (GLenum rate, GLuint samples, const GLint *locations); +#endif +#endif /* GL_NV_shading_rate_image */ + +#ifndef GL_NV_shadow_samplers_array +#define GL_NV_shadow_samplers_array 1 +#define GL_SAMPLER_2D_ARRAY_SHADOW_NV 0x8DC4 +#endif /* GL_NV_shadow_samplers_array */ + +#ifndef GL_NV_shadow_samplers_cube +#define GL_NV_shadow_samplers_cube 1 +#define GL_SAMPLER_CUBE_SHADOW_NV 0x8DC5 +#endif /* GL_NV_shadow_samplers_cube */ + +#ifndef GL_NV_stereo_view_rendering +#define GL_NV_stereo_view_rendering 1 +#endif /* GL_NV_stereo_view_rendering */ -/* GL_NV_texture_border_clamp */ #ifndef GL_NV_texture_border_clamp #define GL_NV_texture_border_clamp 1 -#endif +#define GL_TEXTURE_BORDER_COLOR_NV 0x1004 +#define GL_CLAMP_TO_BORDER_NV 0x812D +#endif /* GL_NV_texture_border_clamp */ -/* GL_NV_texture_compression_s3tc_update */ #ifndef GL_NV_texture_compression_s3tc_update #define GL_NV_texture_compression_s3tc_update 1 -#endif +#endif /* GL_NV_texture_compression_s3tc_update */ -/* GL_NV_texture_npot_2D_mipmap */ #ifndef GL_NV_texture_npot_2D_mipmap #define GL_NV_texture_npot_2D_mipmap 1 +#endif /* GL_NV_texture_npot_2D_mipmap */ + +#ifndef GL_NV_timeline_semaphore +#define GL_NV_timeline_semaphore 1 +#define GL_TIMELINE_SEMAPHORE_VALUE_NV 0x9595 +#define GL_SEMAPHORE_TYPE_NV 0x95B3 +#define GL_SEMAPHORE_TYPE_BINARY_NV 0x95B4 +#define GL_SEMAPHORE_TYPE_TIMELINE_NV 0x95B5 +#define GL_MAX_TIMELINE_SEMAPHORE_VALUE_DIFFERENCE_NV 0x95B6 +typedef void (GL_APIENTRYP PFNGLCREATESEMAPHORESNVPROC) (GLsizei n, GLuint *semaphores); +typedef void (GL_APIENTRYP PFNGLSEMAPHOREPARAMETERIVNVPROC) (GLuint semaphore, GLenum pname, const GLint *params); +typedef void (GL_APIENTRYP PFNGLGETSEMAPHOREPARAMETERIVNVPROC) (GLuint semaphore, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glCreateSemaphoresNV (GLsizei n, GLuint *semaphores); +GL_APICALL void GL_APIENTRY glSemaphoreParameterivNV (GLuint semaphore, GLenum pname, const GLint *params); +GL_APICALL void GL_APIENTRY glGetSemaphoreParameterivNV (GLuint semaphore, GLenum pname, GLint *params); #endif +#endif /* GL_NV_timeline_semaphore */ -/*------------------------------------------------------------------------* - * QCOM extension functions - *------------------------------------------------------------------------*/ +#ifndef GL_NV_viewport_array +#define GL_NV_viewport_array 1 +#define GL_MAX_VIEWPORTS_NV 0x825B +#define GL_VIEWPORT_SUBPIXEL_BITS_NV 0x825C +#define GL_VIEWPORT_BOUNDS_RANGE_NV 0x825D +#define GL_VIEWPORT_INDEX_PROVOKING_VERTEX_NV 0x825F +typedef void (GL_APIENTRYP PFNGLVIEWPORTARRAYVNVPROC) (GLuint first, GLsizei count, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLVIEWPORTINDEXEDFNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +typedef void (GL_APIENTRYP PFNGLVIEWPORTINDEXEDFVNVPROC) (GLuint index, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLSCISSORARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v); +typedef void (GL_APIENTRYP PFNGLSCISSORINDEXEDNVPROC) (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLSCISSORINDEXEDVNVPROC) (GLuint index, const GLint *v); +typedef void (GL_APIENTRYP PFNGLDEPTHRANGEARRAYFVNVPROC) (GLuint first, GLsizei count, const GLfloat *v); +typedef void (GL_APIENTRYP PFNGLDEPTHRANGEINDEXEDFNVPROC) (GLuint index, GLfloat n, GLfloat f); +typedef void (GL_APIENTRYP PFNGLGETFLOATI_VNVPROC) (GLenum target, GLuint index, GLfloat *data); +typedef void (GL_APIENTRYP PFNGLENABLEINVPROC) (GLenum target, GLuint index); +typedef void (GL_APIENTRYP PFNGLDISABLEINVPROC) (GLenum target, GLuint index); +typedef GLboolean (GL_APIENTRYP PFNGLISENABLEDINVPROC) (GLenum target, GLuint index); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glViewportArrayvNV (GLuint first, GLsizei count, const GLfloat *v); +GL_APICALL void GL_APIENTRY glViewportIndexedfNV (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +GL_APICALL void GL_APIENTRY glViewportIndexedfvNV (GLuint index, const GLfloat *v); +GL_APICALL void GL_APIENTRY glScissorArrayvNV (GLuint first, GLsizei count, const GLint *v); +GL_APICALL void GL_APIENTRY glScissorIndexedNV (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glScissorIndexedvNV (GLuint index, const GLint *v); +GL_APICALL void GL_APIENTRY glDepthRangeArrayfvNV (GLuint first, GLsizei count, const GLfloat *v); +GL_APICALL void GL_APIENTRY glDepthRangeIndexedfNV (GLuint index, GLfloat n, GLfloat f); +GL_APICALL void GL_APIENTRY glGetFloati_vNV (GLenum target, GLuint index, GLfloat *data); +GL_APICALL void GL_APIENTRY glEnableiNV (GLenum target, GLuint index); +GL_APICALL void GL_APIENTRY glDisableiNV (GLenum target, GLuint index); +GL_APICALL GLboolean GL_APIENTRY glIsEnablediNV (GLenum target, GLuint index); +#endif +#endif /* GL_NV_viewport_array */ + +#ifndef GL_NV_viewport_array2 +#define GL_NV_viewport_array2 1 +#endif /* GL_NV_viewport_array2 */ + +#ifndef GL_NV_viewport_swizzle +#define GL_NV_viewport_swizzle 1 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_X_NV 0x9350 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_X_NV 0x9351 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Y_NV 0x9352 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Y_NV 0x9353 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Z_NV 0x9354 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Z_NV 0x9355 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_W_NV 0x9356 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_W_NV 0x9357 +#define GL_VIEWPORT_SWIZZLE_X_NV 0x9358 +#define GL_VIEWPORT_SWIZZLE_Y_NV 0x9359 +#define GL_VIEWPORT_SWIZZLE_Z_NV 0x935A +#define GL_VIEWPORT_SWIZZLE_W_NV 0x935B +typedef void (GL_APIENTRYP PFNGLVIEWPORTSWIZZLENVPROC) (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glViewportSwizzleNV (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); +#endif +#endif /* GL_NV_viewport_swizzle */ + +#ifndef GL_OVR_multiview +#define GL_OVR_multiview 1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_NUM_VIEWS_OVR 0x9630 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_BASE_VIEW_INDEX_OVR 0x9632 +#define GL_MAX_VIEWS_OVR 0x9631 +#define GL_FRAMEBUFFER_INCOMPLETE_VIEW_TARGETS_OVR 0x9633 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferTextureMultiviewOVR (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#endif +#endif /* GL_OVR_multiview */ + +#ifndef GL_OVR_multiview2 +#define GL_OVR_multiview2 1 +#endif /* GL_OVR_multiview2 */ + +#ifndef GL_OVR_multiview_multisampled_render_to_texture +#define GL_OVR_multiview_multisampled_render_to_texture 1 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERTEXTUREMULTISAMPLEMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLsizei samples, GLint baseViewIndex, GLsizei numViews); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferTextureMultisampleMultiviewOVR (GLenum target, GLenum attachment, GLuint texture, GLint level, GLsizei samples, GLint baseViewIndex, GLsizei numViews); +#endif +#endif /* GL_OVR_multiview_multisampled_render_to_texture */ + +#ifndef GL_QCOM_YUV_texture_gather +#define GL_QCOM_YUV_texture_gather 1 +#endif /* GL_QCOM_YUV_texture_gather */ -/* GL_QCOM_alpha_test */ #ifndef GL_QCOM_alpha_test #define GL_QCOM_alpha_test 1 +#define GL_ALPHA_TEST_QCOM 0x0BC0 +#define GL_ALPHA_TEST_FUNC_QCOM 0x0BC1 +#define GL_ALPHA_TEST_REF_QCOM 0x0BC2 +typedef void (GL_APIENTRYP PFNGLALPHAFUNCQCOMPROC) (GLenum func, GLclampf ref); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glAlphaFuncQCOM (GLenum func, GLclampf ref); #endif -typedef void (GL_APIENTRYP PFNGLALPHAFUNCQCOMPROC) (GLenum func, GLclampf ref); -#endif +#endif /* GL_QCOM_alpha_test */ -/* GL_QCOM_binning_control */ #ifndef GL_QCOM_binning_control #define GL_QCOM_binning_control 1 -#endif +#define GL_BINNING_CONTROL_HINT_QCOM 0x8FB0 +#define GL_CPU_OPTIMIZED_QCOM 0x8FB1 +#define GL_GPU_OPTIMIZED_QCOM 0x8FB2 +#define GL_RENDER_DIRECT_TO_FRAMEBUFFER_QCOM 0x8FB3 +#endif /* GL_QCOM_binning_control */ -/* GL_QCOM_driver_control */ #ifndef GL_QCOM_driver_control #define GL_QCOM_driver_control 1 +typedef void (GL_APIENTRYP PFNGLGETDRIVERCONTROLSQCOMPROC) (GLint *num, GLsizei size, GLuint *driverControls); +typedef void (GL_APIENTRYP PFNGLGETDRIVERCONTROLSTRINGQCOMPROC) (GLuint driverControl, GLsizei bufSize, GLsizei *length, GLchar *driverControlString); +typedef void (GL_APIENTRYP PFNGLENABLEDRIVERCONTROLQCOMPROC) (GLuint driverControl); +typedef void (GL_APIENTRYP PFNGLDISABLEDRIVERCONTROLQCOMPROC) (GLuint driverControl); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glGetDriverControlsQCOM (GLint *num, GLsizei size, GLuint *driverControls); GL_APICALL void GL_APIENTRY glGetDriverControlStringQCOM (GLuint driverControl, GLsizei bufSize, GLsizei *length, GLchar *driverControlString); GL_APICALL void GL_APIENTRY glEnableDriverControlQCOM (GLuint driverControl); GL_APICALL void GL_APIENTRY glDisableDriverControlQCOM (GLuint driverControl); #endif -typedef void (GL_APIENTRYP PFNGLGETDRIVERCONTROLSQCOMPROC) (GLint *num, GLsizei size, GLuint *driverControls); -typedef void (GL_APIENTRYP PFNGLGETDRIVERCONTROLSTRINGQCOMPROC) (GLuint driverControl, GLsizei bufSize, GLsizei *length, GLchar *driverControlString); -typedef void (GL_APIENTRYP PFNGLENABLEDRIVERCONTROLQCOMPROC) (GLuint driverControl); -typedef void (GL_APIENTRYP PFNGLDISABLEDRIVERCONTROLQCOMPROC) (GLuint driverControl); -#endif +#endif /* GL_QCOM_driver_control */ -/* GL_QCOM_extended_get */ #ifndef GL_QCOM_extended_get #define GL_QCOM_extended_get 1 +#define GL_TEXTURE_WIDTH_QCOM 0x8BD2 +#define GL_TEXTURE_HEIGHT_QCOM 0x8BD3 +#define GL_TEXTURE_DEPTH_QCOM 0x8BD4 +#define GL_TEXTURE_INTERNAL_FORMAT_QCOM 0x8BD5 +#define GL_TEXTURE_FORMAT_QCOM 0x8BD6 +#define GL_TEXTURE_TYPE_QCOM 0x8BD7 +#define GL_TEXTURE_IMAGE_VALID_QCOM 0x8BD8 +#define GL_TEXTURE_NUM_LEVELS_QCOM 0x8BD9 +#define GL_TEXTURE_TARGET_QCOM 0x8BDA +#define GL_TEXTURE_OBJECT_VALID_QCOM 0x8BDB +#define GL_STATE_RESTORE 0x8BDC +typedef void (GL_APIENTRYP PFNGLEXTGETTEXTURESQCOMPROC) (GLuint *textures, GLint maxTextures, GLint *numTextures); +typedef void (GL_APIENTRYP PFNGLEXTGETBUFFERSQCOMPROC) (GLuint *buffers, GLint maxBuffers, GLint *numBuffers); +typedef void (GL_APIENTRYP PFNGLEXTGETRENDERBUFFERSQCOMPROC) (GLuint *renderbuffers, GLint maxRenderbuffers, GLint *numRenderbuffers); +typedef void (GL_APIENTRYP PFNGLEXTGETFRAMEBUFFERSQCOMPROC) (GLuint *framebuffers, GLint maxFramebuffers, GLint *numFramebuffers); +typedef void (GL_APIENTRYP PFNGLEXTGETTEXLEVELPARAMETERIVQCOMPROC) (GLuint texture, GLenum face, GLint level, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLEXTTEXOBJECTSTATEOVERRIDEIQCOMPROC) (GLenum target, GLenum pname, GLint param); +typedef void (GL_APIENTRYP PFNGLEXTGETTEXSUBIMAGEQCOMPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, void *texels); +typedef void (GL_APIENTRYP PFNGLEXTGETBUFFERPOINTERVQCOMPROC) (GLenum target, void **params); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glExtGetTexturesQCOM (GLuint *textures, GLint maxTextures, GLint *numTextures); GL_APICALL void GL_APIENTRY glExtGetBuffersQCOM (GLuint *buffers, GLint maxBuffers, GLint *numBuffers); @@ -1985,66 +3861,173 @@ GL_APICALL void GL_APIENTRY glExtGetRenderbuffersQCOM (GLuint *renderbuffers, GL GL_APICALL void GL_APIENTRY glExtGetFramebuffersQCOM (GLuint *framebuffers, GLint maxFramebuffers, GLint *numFramebuffers); GL_APICALL void GL_APIENTRY glExtGetTexLevelParameterivQCOM (GLuint texture, GLenum face, GLint level, GLenum pname, GLint *params); GL_APICALL void GL_APIENTRY glExtTexObjectStateOverrideiQCOM (GLenum target, GLenum pname, GLint param); -GL_APICALL void GL_APIENTRY glExtGetTexSubImageQCOM (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLvoid *texels); -GL_APICALL void GL_APIENTRY glExtGetBufferPointervQCOM (GLenum target, GLvoid **params); -#endif -typedef void (GL_APIENTRYP PFNGLEXTGETTEXTURESQCOMPROC) (GLuint *textures, GLint maxTextures, GLint *numTextures); -typedef void (GL_APIENTRYP PFNGLEXTGETBUFFERSQCOMPROC) (GLuint *buffers, GLint maxBuffers, GLint *numBuffers); -typedef void (GL_APIENTRYP PFNGLEXTGETRENDERBUFFERSQCOMPROC) (GLuint *renderbuffers, GLint maxRenderbuffers, GLint *numRenderbuffers); -typedef void (GL_APIENTRYP PFNGLEXTGETFRAMEBUFFERSQCOMPROC) (GLuint *framebuffers, GLint maxFramebuffers, GLint *numFramebuffers); -typedef void (GL_APIENTRYP PFNGLEXTGETTEXLEVELPARAMETERIVQCOMPROC) (GLuint texture, GLenum face, GLint level, GLenum pname, GLint *params); -typedef void (GL_APIENTRYP PFNGLEXTTEXOBJECTSTATEOVERRIDEIQCOMPROC) (GLenum target, GLenum pname, GLint param); -typedef void (GL_APIENTRYP PFNGLEXTGETTEXSUBIMAGEQCOMPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLvoid *texels); -typedef void (GL_APIENTRYP PFNGLEXTGETBUFFERPOINTERVQCOMPROC) (GLenum target, GLvoid **params); +GL_APICALL void GL_APIENTRY glExtGetTexSubImageQCOM (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, void *texels); +GL_APICALL void GL_APIENTRY glExtGetBufferPointervQCOM (GLenum target, void **params); #endif +#endif /* GL_QCOM_extended_get */ -/* GL_QCOM_extended_get2 */ #ifndef GL_QCOM_extended_get2 #define GL_QCOM_extended_get2 1 +typedef void (GL_APIENTRYP PFNGLEXTGETSHADERSQCOMPROC) (GLuint *shaders, GLint maxShaders, GLint *numShaders); +typedef void (GL_APIENTRYP PFNGLEXTGETPROGRAMSQCOMPROC) (GLuint *programs, GLint maxPrograms, GLint *numPrograms); +typedef GLboolean (GL_APIENTRYP PFNGLEXTISPROGRAMBINARYQCOMPROC) (GLuint program); +typedef void (GL_APIENTRYP PFNGLEXTGETPROGRAMBINARYSOURCEQCOMPROC) (GLuint program, GLenum shadertype, GLchar *source, GLint *length); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glExtGetShadersQCOM (GLuint *shaders, GLint maxShaders, GLint *numShaders); GL_APICALL void GL_APIENTRY glExtGetProgramsQCOM (GLuint *programs, GLint maxPrograms, GLint *numPrograms); GL_APICALL GLboolean GL_APIENTRY glExtIsProgramBinaryQCOM (GLuint program); GL_APICALL void GL_APIENTRY glExtGetProgramBinarySourceQCOM (GLuint program, GLenum shadertype, GLchar *source, GLint *length); #endif -typedef void (GL_APIENTRYP PFNGLEXTGETSHADERSQCOMPROC) (GLuint *shaders, GLint maxShaders, GLint *numShaders); -typedef void (GL_APIENTRYP PFNGLEXTGETPROGRAMSQCOMPROC) (GLuint *programs, GLint maxPrograms, GLint *numPrograms); -typedef GLboolean (GL_APIENTRYP PFNGLEXTISPROGRAMBINARYQCOMPROC) (GLuint program); -typedef void (GL_APIENTRYP PFNGLEXTGETPROGRAMBINARYSOURCEQCOMPROC) (GLuint program, GLenum shadertype, GLchar *source, GLint *length); -#endif +#endif /* GL_QCOM_extended_get2 */ + +#ifndef GL_QCOM_frame_extrapolation +#define GL_QCOM_frame_extrapolation 1 +typedef void (GL_APIENTRYP PFNGLEXTRAPOLATETEX2DQCOMPROC) (GLuint src1, GLuint src2, GLuint output, GLfloat scaleFactor); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glExtrapolateTex2DQCOM (GLuint src1, GLuint src2, GLuint output, GLfloat scaleFactor); +#endif +#endif /* GL_QCOM_frame_extrapolation */ + +#ifndef GL_QCOM_framebuffer_foveated +#define GL_QCOM_framebuffer_foveated 1 +#define GL_FOVEATION_ENABLE_BIT_QCOM 0x00000001 +#define GL_FOVEATION_SCALED_BIN_METHOD_BIT_QCOM 0x00000002 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERFOVEATIONCONFIGQCOMPROC) (GLuint framebuffer, GLuint numLayers, GLuint focalPointsPerLayer, GLuint requestedFeatures, GLuint *providedFeatures); +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERFOVEATIONPARAMETERSQCOMPROC) (GLuint framebuffer, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferFoveationConfigQCOM (GLuint framebuffer, GLuint numLayers, GLuint focalPointsPerLayer, GLuint requestedFeatures, GLuint *providedFeatures); +GL_APICALL void GL_APIENTRY glFramebufferFoveationParametersQCOM (GLuint framebuffer, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); +#endif +#endif /* GL_QCOM_framebuffer_foveated */ + +#ifndef GL_QCOM_motion_estimation +#define GL_QCOM_motion_estimation 1 +#define GL_MOTION_ESTIMATION_SEARCH_BLOCK_X_QCOM 0x8C90 +#define GL_MOTION_ESTIMATION_SEARCH_BLOCK_Y_QCOM 0x8C91 +typedef void (GL_APIENTRYP PFNGLTEXESTIMATEMOTIONQCOMPROC) (GLuint ref, GLuint target, GLuint output); +typedef void (GL_APIENTRYP PFNGLTEXESTIMATEMOTIONREGIONSQCOMPROC) (GLuint ref, GLuint target, GLuint output, GLuint mask); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTexEstimateMotionQCOM (GLuint ref, GLuint target, GLuint output); +GL_APICALL void GL_APIENTRY glTexEstimateMotionRegionsQCOM (GLuint ref, GLuint target, GLuint output, GLuint mask); +#endif +#endif /* GL_QCOM_motion_estimation */ -/* GL_QCOM_perfmon_global_mode */ #ifndef GL_QCOM_perfmon_global_mode #define GL_QCOM_perfmon_global_mode 1 -#endif +#define GL_PERFMON_GLOBAL_MODE_QCOM 0x8FA0 +#endif /* GL_QCOM_perfmon_global_mode */ -/* GL_QCOM_writeonly_rendering */ -#ifndef GL_QCOM_writeonly_rendering -#define GL_QCOM_writeonly_rendering 1 -#endif +#ifndef GL_QCOM_render_shared_exponent +#define GL_QCOM_render_shared_exponent 1 +#endif /* GL_QCOM_render_shared_exponent */ + +#ifndef GL_QCOM_shader_framebuffer_fetch_noncoherent +#define GL_QCOM_shader_framebuffer_fetch_noncoherent 1 +#define GL_FRAMEBUFFER_FETCH_NONCOHERENT_QCOM 0x96A2 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIERQCOMPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferFetchBarrierQCOM (void); +#endif +#endif /* GL_QCOM_shader_framebuffer_fetch_noncoherent */ + +#ifndef GL_QCOM_shader_framebuffer_fetch_rate +#define GL_QCOM_shader_framebuffer_fetch_rate 1 +#endif /* GL_QCOM_shader_framebuffer_fetch_rate */ + +#ifndef GL_QCOM_shading_rate +#define GL_QCOM_shading_rate 1 +#define GL_SHADING_RATE_QCOM 0x96A4 +#define GL_SHADING_RATE_PRESERVE_ASPECT_RATIO_QCOM 0x96A5 +#define GL_SHADING_RATE_1X1_PIXELS_QCOM 0x96A6 +#define GL_SHADING_RATE_1X2_PIXELS_QCOM 0x96A7 +#define GL_SHADING_RATE_2X1_PIXELS_QCOM 0x96A8 +#define GL_SHADING_RATE_2X2_PIXELS_QCOM 0x96A9 +#define GL_SHADING_RATE_4X2_PIXELS_QCOM 0x96AC +#define GL_SHADING_RATE_4X4_PIXELS_QCOM 0x96AE +typedef void (GL_APIENTRYP PFNGLSHADINGRATEQCOMPROC) (GLenum rate); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glShadingRateQCOM (GLenum rate); +#endif +#endif /* GL_QCOM_shading_rate */ + +#ifndef GL_QCOM_texture_foveated +#define GL_QCOM_texture_foveated 1 +#define GL_TEXTURE_FOVEATED_FEATURE_BITS_QCOM 0x8BFB +#define GL_TEXTURE_FOVEATED_MIN_PIXEL_DENSITY_QCOM 0x8BFC +#define GL_TEXTURE_FOVEATED_FEATURE_QUERY_QCOM 0x8BFD +#define GL_TEXTURE_FOVEATED_NUM_FOCAL_POINTS_QUERY_QCOM 0x8BFE +#define GL_FRAMEBUFFER_INCOMPLETE_FOVEATION_QCOM 0x8BFF +typedef void (GL_APIENTRYP PFNGLTEXTUREFOVEATIONPARAMETERSQCOMPROC) (GLuint texture, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTextureFoveationParametersQCOM (GLuint texture, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); +#endif +#endif /* GL_QCOM_texture_foveated */ + +#ifndef GL_QCOM_texture_foveated2 +#define GL_QCOM_texture_foveated2 1 +#define GL_TEXTURE_FOVEATED_CUTOFF_DENSITY_QCOM 0x96A0 +#endif /* GL_QCOM_texture_foveated2 */ + +#ifndef GL_QCOM_texture_foveated_subsampled_layout +#define GL_QCOM_texture_foveated_subsampled_layout 1 +#define GL_FOVEATION_SUBSAMPLED_LAYOUT_METHOD_BIT_QCOM 0x00000004 +#define GL_MAX_SHADER_SUBSAMPLED_IMAGE_UNITS_QCOM 0x8FA1 +#endif /* GL_QCOM_texture_foveated_subsampled_layout */ -/* GL_QCOM_tiled_rendering */ #ifndef GL_QCOM_tiled_rendering #define GL_QCOM_tiled_rendering 1 +#define GL_COLOR_BUFFER_BIT0_QCOM 0x00000001 +#define GL_COLOR_BUFFER_BIT1_QCOM 0x00000002 +#define GL_COLOR_BUFFER_BIT2_QCOM 0x00000004 +#define GL_COLOR_BUFFER_BIT3_QCOM 0x00000008 +#define GL_COLOR_BUFFER_BIT4_QCOM 0x00000010 +#define GL_COLOR_BUFFER_BIT5_QCOM 0x00000020 +#define GL_COLOR_BUFFER_BIT6_QCOM 0x00000040 +#define GL_COLOR_BUFFER_BIT7_QCOM 0x00000080 +#define GL_DEPTH_BUFFER_BIT0_QCOM 0x00000100 +#define GL_DEPTH_BUFFER_BIT1_QCOM 0x00000200 +#define GL_DEPTH_BUFFER_BIT2_QCOM 0x00000400 +#define GL_DEPTH_BUFFER_BIT3_QCOM 0x00000800 +#define GL_DEPTH_BUFFER_BIT4_QCOM 0x00001000 +#define GL_DEPTH_BUFFER_BIT5_QCOM 0x00002000 +#define GL_DEPTH_BUFFER_BIT6_QCOM 0x00004000 +#define GL_DEPTH_BUFFER_BIT7_QCOM 0x00008000 +#define GL_STENCIL_BUFFER_BIT0_QCOM 0x00010000 +#define GL_STENCIL_BUFFER_BIT1_QCOM 0x00020000 +#define GL_STENCIL_BUFFER_BIT2_QCOM 0x00040000 +#define GL_STENCIL_BUFFER_BIT3_QCOM 0x00080000 +#define GL_STENCIL_BUFFER_BIT4_QCOM 0x00100000 +#define GL_STENCIL_BUFFER_BIT5_QCOM 0x00200000 +#define GL_STENCIL_BUFFER_BIT6_QCOM 0x00400000 +#define GL_STENCIL_BUFFER_BIT7_QCOM 0x00800000 +#define GL_MULTISAMPLE_BUFFER_BIT0_QCOM 0x01000000 +#define GL_MULTISAMPLE_BUFFER_BIT1_QCOM 0x02000000 +#define GL_MULTISAMPLE_BUFFER_BIT2_QCOM 0x04000000 +#define GL_MULTISAMPLE_BUFFER_BIT3_QCOM 0x08000000 +#define GL_MULTISAMPLE_BUFFER_BIT4_QCOM 0x10000000 +#define GL_MULTISAMPLE_BUFFER_BIT5_QCOM 0x20000000 +#define GL_MULTISAMPLE_BUFFER_BIT6_QCOM 0x40000000 +#define GL_MULTISAMPLE_BUFFER_BIT7_QCOM 0x80000000 +typedef void (GL_APIENTRYP PFNGLSTARTTILINGQCOMPROC) (GLuint x, GLuint y, GLuint width, GLuint height, GLbitfield preserveMask); +typedef void (GL_APIENTRYP PFNGLENDTILINGQCOMPROC) (GLbitfield preserveMask); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glStartTilingQCOM (GLuint x, GLuint y, GLuint width, GLuint height, GLbitfield preserveMask); GL_APICALL void GL_APIENTRY glEndTilingQCOM (GLbitfield preserveMask); #endif -typedef void (GL_APIENTRYP PFNGLSTARTTILINGQCOMPROC) (GLuint x, GLuint y, GLuint width, GLuint height, GLbitfield preserveMask); -typedef void (GL_APIENTRYP PFNGLENDTILINGQCOMPROC) (GLbitfield preserveMask); -#endif +#endif /* GL_QCOM_tiled_rendering */ -/*------------------------------------------------------------------------* - * VIV extension tokens - *------------------------------------------------------------------------*/ +#ifndef GL_QCOM_writeonly_rendering +#define GL_QCOM_writeonly_rendering 1 +#define GL_WRITEONLY_RENDERING_QCOM 0x8823 +#endif /* GL_QCOM_writeonly_rendering */ -/* GL_VIV_shader_binary */ #ifndef GL_VIV_shader_binary #define GL_VIV_shader_binary 1 -#endif +#define GL_SHADER_BINARY_VIV 0x8FC4 +#endif /* GL_VIV_shader_binary */ #ifdef __cplusplus } #endif -#endif /* __gl2ext_h_ */ +#endif diff --git a/libs/SDL2/include/SDL_opengles2_gl2platform.h b/libs/SDL2/include/SDL_opengles2_gl2platform.h index c325686..426796e 100644 --- a/libs/SDL2/include/SDL_opengles2_gl2platform.h +++ b/libs/SDL2/include/SDL_opengles2_gl2platform.h @@ -1,20 +1,17 @@ #ifndef __gl2platform_h_ #define __gl2platform_h_ -/* $Revision: 10602 $ on $Date:: 2010-03-04 22:35:34 -0800 #$ */ - /* - * This document is licensed under the SGI Free Software B License Version - * 2.0. For details, see http://oss.sgi.com/projects/FreeB/ . - */ +** Copyright 2017-2020 The Khronos Group Inc. +** SPDX-License-Identifier: Apache-2.0 +*/ /* Platform-specific types and definitions for OpenGL ES 2.X gl2.h * * Adopters may modify khrplatform.h and this file to suit their platform. - * You are encouraged to submit all modifications to the Khronos group so that - * they can be included in future versions of this file. Please submit changes - * by sending them to the public Khronos Bugzilla (http://khronos.org/bugzilla) - * by filing a bug against product "OpenGL-ES" component "Registry". + * Please contribute modifications back to Khronos as pull requests on the + * public github repository: + * https://github.com/KhronosGroup/OpenGL-Registry */ /*#include */ diff --git a/libs/SDL2/include/SDL_opengles2_khrplatform.h b/libs/SDL2/include/SDL_opengles2_khrplatform.h index c9e6f17..0164644 100644 --- a/libs/SDL2/include/SDL_opengles2_khrplatform.h +++ b/libs/SDL2/include/SDL_opengles2_khrplatform.h @@ -2,7 +2,7 @@ #define __khrplatform_h_ /* -** Copyright (c) 2008-2009 The Khronos Group Inc. +** Copyright (c) 2008-2018 The Khronos Group Inc. ** ** Permission is hereby granted, free of charge, to any person obtaining a ** copy of this software and/or associated documentation files (the @@ -26,18 +26,16 @@ /* Khronos platform-specific types and definitions. * - * $Revision: 23298 $ on $Date: 2013-09-30 17:07:13 -0700 (Mon, 30 Sep 2013) $ + * The master copy of khrplatform.h is maintained in the Khronos EGL + * Registry repository at https://github.com/KhronosGroup/EGL-Registry + * The last semantic modification to khrplatform.h was at commit ID: + * 67a3e0864c2d75ea5287b9f3d2eb74a745936692 * * Adopters may modify this file to suit their platform. Adopters are * encouraged to submit platform specific modifications to the Khronos * group so that they can be included in future versions of this file. - * Please submit changes by sending them to the public Khronos Bugzilla - * (http://khronos.org/bugzilla) by filing a bug against product - * "Khronos (general)" component "Registry". - * - * A predefined template which fills in some of the bug fields can be - * reached using http://tinyurl.com/khrplatform-h-bugreport, but you - * must create a Bugzilla login first. + * Please submit changes by filing pull requests or issues on + * the EGL Registry repository linked above. * * * See the Implementer's Guidelines for information about where this file @@ -92,15 +90,25 @@ * int arg2) KHRONOS_APIATTRIBUTES; */ +#if defined(__SCITECH_SNAP__) && !defined(KHRONOS_STATIC) +# define KHRONOS_STATIC 1 +#endif + /*------------------------------------------------------------------------- * Definition of KHRONOS_APICALL *------------------------------------------------------------------------- * This precedes the return type of the function in the function prototype. */ -#if defined(_WIN32) && !defined(__SCITECH_SNAP__) +#if defined(KHRONOS_STATIC) + /* If the preprocessor constant KHRONOS_STATIC is defined, make the + * header compatible with static linking. */ +# define KHRONOS_APICALL +#elif defined(_WIN32) # define KHRONOS_APICALL __declspec(dllimport) #elif defined (__SYMBIAN32__) # define KHRONOS_APICALL IMPORT_C +#elif defined(__ANDROID__) +# define KHRONOS_APICALL __attribute__((visibility("default"))) #else # define KHRONOS_APICALL #endif @@ -145,6 +153,20 @@ typedef int64_t khronos_int64_t; typedef uint64_t khronos_uint64_t; #define KHRONOS_SUPPORT_INT64 1 #define KHRONOS_SUPPORT_FLOAT 1 +/* + * To support platform where unsigned long cannot be used interchangeably with + * inptr_t (e.g. CHERI-extended ISAs), we can use the stdint.h intptr_t. + * Ideally, we could just use (u)intptr_t everywhere, but this could result in + * ABI breakage if khronos_uintptr_t is changed from unsigned long to + * unsigned long long or similar (this results in different C++ name mangling). + * To avoid changes for existing platforms, we restrict usage of intptr_t to + * platforms where the size of a pointer is larger than the size of long. + */ +#if defined(__SIZEOF_LONG__) && defined(__SIZEOF_POINTER__) +#if __SIZEOF_POINTER__ > __SIZEOF_LONG__ +#define KHRONOS_USE_INTPTR_T +#endif +#endif #elif defined(__VMS ) || defined(__sgi) @@ -223,18 +245,25 @@ typedef signed short int khronos_int16_t; typedef unsigned short int khronos_uint16_t; /* - * Types that differ between LLP64 and LP64 architectures - in LLP64, + * Types that differ between LLP64 and LP64 architectures - in LLP64, * pointers are 64 bits, but 'long' is still 32 bits. Win64 appears * to be the only LLP64 architecture in current use. */ -#ifdef _WIN64 +#ifdef KHRONOS_USE_INTPTR_T +typedef intptr_t khronos_intptr_t; +typedef uintptr_t khronos_uintptr_t; +#elif defined(_WIN64) typedef signed long long int khronos_intptr_t; typedef unsigned long long int khronos_uintptr_t; -typedef signed long long int khronos_ssize_t; -typedef unsigned long long int khronos_usize_t; #else typedef signed long int khronos_intptr_t; typedef unsigned long int khronos_uintptr_t; +#endif + +#if defined(_WIN64) +typedef signed long long int khronos_ssize_t; +typedef unsigned long long int khronos_usize_t; +#else typedef signed long int khronos_ssize_t; typedef unsigned long int khronos_usize_t; #endif diff --git a/libs/SDL2/include/SDL_pixels.h b/libs/SDL2/include/SDL_pixels.h index 5d2c0c8..9abd57b 100644 --- a/libs/SDL2/include/SDL_pixels.h +++ b/libs/SDL2/include/SDL_pixels.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_platform.h b/libs/SDL2/include/SDL_platform.h index 79b8b6f..d2a7e05 100644 --- a/libs/SDL2/include/SDL_platform.h +++ b/libs/SDL2/include/SDL_platform.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -65,11 +65,15 @@ #undef __LINUX__ /* do we need to do this? */ #define __ANDROID__ 1 #endif +#if defined(__NGAGE__) +#undef __NGAGE__ +#define __NGAGE__ 1 +#endif #if defined(__APPLE__) /* lets us know what version of Mac OS X we're compiling on */ -#include "AvailabilityMacros.h" -#include "TargetConditionals.h" +#include +#include /* Fix building with older SDKs that don't define these See this for more information: @@ -104,9 +108,9 @@ /* if not compiling for iOS */ #undef __MACOSX__ #define __MACOSX__ 1 -#if MAC_OS_X_VERSION_MIN_REQUIRED < 1060 -# error SDL for Mac OS X only supports deploying on 10.6 and above. -#endif /* MAC_OS_X_VERSION_MIN_REQUIRED < 1060 */ +#if MAC_OS_X_VERSION_MIN_REQUIRED < 1070 +# error SDL for Mac OS X only supports deploying on 10.7 and above. +#endif /* MAC_OS_X_VERSION_MIN_REQUIRED < 1070 */ #endif /* TARGET_OS_IPHONE */ #endif /* defined(__APPLE__) */ @@ -140,7 +144,7 @@ #endif #if defined(WIN32) || defined(_WIN32) || defined(__CYGWIN__) || defined(__MINGW32__) -/* Try to find out if we're compiling for WinRT or non-WinRT */ +/* Try to find out if we're compiling for WinRT, GDK or non-WinRT/GDK */ #if defined(_MSC_VER) && defined(__has_include) #if __has_include() #define HAVE_WINAPIFAMILY_H 1 @@ -165,6 +169,15 @@ #if WINAPI_FAMILY_WINRT #undef __WINRT__ #define __WINRT__ 1 +#elif defined(_GAMING_DESKTOP) /* GDK project configuration always defines _GAMING_XXX */ +#undef __WINGDK__ +#define __WINGDK__ 1 +#elif defined(_GAMING_XBOX_XBOXONE) +#undef __XBOXONE__ +#define __XBOXONE__ 1 +#elif defined(_GAMING_XBOX_SCARLETT) +#undef __XBOXSERIES__ +#define __XBOXSERIES__ 1 #else #undef __WINDOWS__ #define __WINDOWS__ 1 @@ -175,10 +188,18 @@ #undef __WIN32__ #define __WIN32__ 1 #endif +/* This is to support generic "any GDK" separate from a platform-specific GDK */ +#if defined(__WINGDK__) || defined(__XBOXONE__) || defined(__XBOXSERIES__) +#undef __GDK__ +#define __GDK__ 1 +#endif #if defined(__PSP__) #undef __PSP__ #define __PSP__ 1 #endif +#if defined(PS2) +#define __PS2__ 1 +#endif /* The NACL compiler defines __native_client__ and __pnacl__ * Ref: http://www.chromium.org/nativeclient/pnacl/stability-of-the-pnacl-bitcode-abi @@ -200,6 +221,11 @@ #define __VITA__ 1 #endif +#if defined(__3DS__) +#undef __3DS__ +#define __3DS__ 1 +#endif + #include "begin_code.h" /* Set up for C function definitions, even when using C++ */ #ifdef __cplusplus diff --git a/libs/SDL2/include/SDL_power.h b/libs/SDL2/include/SDL_power.h index ecb3f4b..1d75704 100644 --- a/libs/SDL2/include/SDL_power.h +++ b/libs/SDL2/include/SDL_power.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -48,7 +48,6 @@ typedef enum SDL_POWERSTATE_CHARGED /**< Plugged in, battery charged */ } SDL_PowerState; - /** * Get the current power supply details. * @@ -65,17 +64,17 @@ typedef enum * It's possible a platform can only report battery percentage or time left * but not both. * - * \param secs seconds of battery life left, you can pass a NULL here if you - * don't care, will return -1 if we can't determine a value, or - * we're not running on a battery - * \param pct percentage of battery life left, between 0 and 100, you can pass - * a NULL here if you don't care, will return -1 if we can't - * determine a value, or we're not running on a battery + * \param seconds seconds of battery life left, you can pass a NULL here if + * you don't care, will return -1 if we can't determine a + * value, or we're not running on a battery + * \param percent percentage of battery life left, between 0 and 100, you can + * pass a NULL here if you don't care, will return -1 if we + * can't determine a value, or we're not running on a battery * \returns an SDL_PowerState enum representing the current battery state. * * \since This function is available since SDL 2.0.0. */ -extern DECLSPEC SDL_PowerState SDLCALL SDL_GetPowerInfo(int *secs, int *pct); +extern DECLSPEC SDL_PowerState SDLCALL SDL_GetPowerInfo(int *seconds, int *percent); /* Ends C function definitions when using C++ */ #ifdef __cplusplus diff --git a/libs/SDL2/include/SDL_quit.h b/libs/SDL2/include/SDL_quit.h index 4090f7f..d8ceb89 100644 --- a/libs/SDL2/include/SDL_quit.h +++ b/libs/SDL2/include/SDL_quit.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_rect.h b/libs/SDL2/include/SDL_rect.h index 6616ba6..9611a31 100644 --- a/libs/SDL2/include/SDL_rect.h +++ b/libs/SDL2/include/SDL_rect.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -54,8 +54,8 @@ typedef struct SDL_Point /** * The structure that defines a point (floating point) * - * \sa SDL_EnclosePoints - * \sa SDL_PointInRect + * \sa SDL_EncloseFPoints + * \sa SDL_PointInFRect */ typedef struct SDL_FPoint { @@ -71,6 +71,7 @@ typedef struct SDL_FPoint * \sa SDL_RectEquals * \sa SDL_HasIntersection * \sa SDL_IntersectRect + * \sa SDL_IntersectRectAndLine * \sa SDL_UnionRect * \sa SDL_EnclosePoints */ @@ -83,6 +84,16 @@ typedef struct SDL_Rect /** * A rectangle, with the origin at the upper left (floating point). + * + * \sa SDL_FRectEmpty + * \sa SDL_FRectEquals + * \sa SDL_FRectEqualsEpsilon + * \sa SDL_HasIntersectionF + * \sa SDL_IntersectFRect + * \sa SDL_IntersectFRectAndLine + * \sa SDL_UnionFRect + * \sa SDL_EncloseFPoints + * \sa SDL_PointInFRect */ typedef struct SDL_FRect { @@ -213,6 +224,147 @@ extern DECLSPEC SDL_bool SDLCALL SDL_IntersectRectAndLine(const SDL_Rect * int *Y1, int *X2, int *Y2); + +/* SDL_FRect versions... */ + +/** + * Returns true if point resides inside a rectangle. + */ +SDL_FORCE_INLINE SDL_bool SDL_PointInFRect(const SDL_FPoint *p, const SDL_FRect *r) +{ + return ( (p->x >= r->x) && (p->x < (r->x + r->w)) && + (p->y >= r->y) && (p->y < (r->y + r->h)) ) ? SDL_TRUE : SDL_FALSE; +} + +/** + * Returns true if the rectangle has no area. + */ +SDL_FORCE_INLINE SDL_bool SDL_FRectEmpty(const SDL_FRect *r) +{ + return ((!r) || (r->w <= 0.0f) || (r->h <= 0.0f)) ? SDL_TRUE : SDL_FALSE; +} + +/** + * Returns true if the two rectangles are equal, within some given epsilon. + * + * \since This function is available since SDL 2.0.22. + */ +SDL_FORCE_INLINE SDL_bool SDL_FRectEqualsEpsilon(const SDL_FRect *a, const SDL_FRect *b, const float epsilon) +{ + return (a && b && ((a == b) || + ((SDL_fabsf(a->x - b->x) <= epsilon) && + (SDL_fabsf(a->y - b->y) <= epsilon) && + (SDL_fabsf(a->w - b->w) <= epsilon) && + (SDL_fabsf(a->h - b->h) <= epsilon)))) + ? SDL_TRUE : SDL_FALSE; +} + +/** + * Returns true if the two rectangles are equal, using a default epsilon. + * + * \since This function is available since SDL 2.0.22. + */ +SDL_FORCE_INLINE SDL_bool SDL_FRectEquals(const SDL_FRect *a, const SDL_FRect *b) +{ + return SDL_FRectEqualsEpsilon(a, b, SDL_FLT_EPSILON); +} + +/** + * Determine whether two rectangles intersect with float precision. + * + * If either pointer is NULL the function will return SDL_FALSE. + * + * \param A an SDL_FRect structure representing the first rectangle + * \param B an SDL_FRect structure representing the second rectangle + * \returns SDL_TRUE if there is an intersection, SDL_FALSE otherwise. + * + * \since This function is available since SDL 2.0.22. + * + * \sa SDL_IntersectRect + */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasIntersectionF(const SDL_FRect * A, + const SDL_FRect * B); + +/** + * Calculate the intersection of two rectangles with float precision. + * + * If `result` is NULL then this function will return SDL_FALSE. + * + * \param A an SDL_FRect structure representing the first rectangle + * \param B an SDL_FRect structure representing the second rectangle + * \param result an SDL_FRect structure filled in with the intersection of + * rectangles `A` and `B` + * \returns SDL_TRUE if there is an intersection, SDL_FALSE otherwise. + * + * \since This function is available since SDL 2.0.22. + * + * \sa SDL_HasIntersectionF + */ +extern DECLSPEC SDL_bool SDLCALL SDL_IntersectFRect(const SDL_FRect * A, + const SDL_FRect * B, + SDL_FRect * result); + +/** + * Calculate the union of two rectangles with float precision. + * + * \param A an SDL_FRect structure representing the first rectangle + * \param B an SDL_FRect structure representing the second rectangle + * \param result an SDL_FRect structure filled in with the union of rectangles + * `A` and `B` + * + * \since This function is available since SDL 2.0.22. + */ +extern DECLSPEC void SDLCALL SDL_UnionFRect(const SDL_FRect * A, + const SDL_FRect * B, + SDL_FRect * result); + +/** + * Calculate a minimal rectangle enclosing a set of points with float + * precision. + * + * If `clip` is not NULL then only points inside of the clipping rectangle are + * considered. + * + * \param points an array of SDL_FPoint structures representing points to be + * enclosed + * \param count the number of structures in the `points` array + * \param clip an SDL_FRect used for clipping or NULL to enclose all points + * \param result an SDL_FRect structure filled in with the minimal enclosing + * rectangle + * \returns SDL_TRUE if any points were enclosed or SDL_FALSE if all the + * points were outside of the clipping rectangle. + * + * \since This function is available since SDL 2.0.22. + */ +extern DECLSPEC SDL_bool SDLCALL SDL_EncloseFPoints(const SDL_FPoint * points, + int count, + const SDL_FRect * clip, + SDL_FRect * result); + +/** + * Calculate the intersection of a rectangle and line segment with float + * precision. + * + * This function is used to clip a line segment to a rectangle. A line segment + * contained entirely within the rectangle or that does not intersect will + * remain unchanged. A line segment that crosses the rectangle at either or + * both ends will be clipped to the boundary of the rectangle and the new + * coordinates saved in `X1`, `Y1`, `X2`, and/or `Y2` as necessary. + * + * \param rect an SDL_FRect structure representing the rectangle to intersect + * \param X1 a pointer to the starting X-coordinate of the line + * \param Y1 a pointer to the starting Y-coordinate of the line + * \param X2 a pointer to the ending X-coordinate of the line + * \param Y2 a pointer to the ending Y-coordinate of the line + * \returns SDL_TRUE if there is an intersection, SDL_FALSE otherwise. + * + * \since This function is available since SDL 2.0.22. + */ +extern DECLSPEC SDL_bool SDLCALL SDL_IntersectFRectAndLine(const SDL_FRect * + rect, float *X1, + float *Y1, float *X2, + float *Y2); + /* Ends C function definitions when using C++ */ #ifdef __cplusplus } diff --git a/libs/SDL2/include/SDL_render.h b/libs/SDL2/include/SDL_render.h index a7e4908..2d3f073 100644 --- a/libs/SDL2/include/SDL_render.h +++ b/libs/SDL2/include/SDL_render.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -261,6 +261,17 @@ extern DECLSPEC SDL_Renderer * SDLCALL SDL_CreateSoftwareRenderer(SDL_Surface * */ extern DECLSPEC SDL_Renderer * SDLCALL SDL_GetRenderer(SDL_Window * window); +/** + * Get the window associated with a renderer. + * + * \param renderer the renderer to query + * \returns the window on success or NULL on failure; call SDL_GetError() for + * more information. + * + * \since This function is available since SDL 2.0.22. + */ +extern DECLSPEC SDL_Window * SDLCALL SDL_RenderGetWindow(SDL_Renderer *renderer); + /** * Get information about a rendering context. * @@ -356,11 +367,15 @@ extern DECLSPEC SDL_Texture * SDLCALL SDL_CreateTextureFromSurface(SDL_Renderer * \param texture the texture to query * \param format a pointer filled in with the raw format of the texture; the * actual format may differ, but pixel transfers will use this - * format (one of the SDL_PixelFormatEnum values) + * format (one of the SDL_PixelFormatEnum values). This argument + * can be NULL if you don't need this information. * \param access a pointer filled in with the actual access to the texture - * (one of the SDL_TextureAccess values) - * \param w a pointer filled in with the width of the texture in pixels - * \param h a pointer filled in with the height of the texture in pixels + * (one of the SDL_TextureAccess values). This argument can be + * NULL if you don't need this information. + * \param w a pointer filled in with the width of the texture in pixels. This + * argument can be NULL if you don't need this information. + * \param h a pointer filled in with the height of the texture in pixels. This + * argument can be NULL if you don't need this information. * \returns 0 on success or a negative error code on failure; call * SDL_GetError() for more information. * @@ -810,9 +825,13 @@ extern DECLSPEC int SDLCALL SDL_RenderSetLogicalSize(SDL_Renderer * renderer, in /** * Get device independent resolution for rendering. * - * This may return 0 for `w` and `h` if the SDL_Renderer has never had its - * logical size set by SDL_RenderSetLogicalSize() and never had a render - * target set. + * When using the main rendering target (eg no target texture is set): this + * may return 0 for `w` and `h` if the SDL_Renderer has never had its logical + * size set by SDL_RenderSetLogicalSize(). Otherwise it returns the logical + * width and height. + * + * When using a target texture: Never return 0 for `w` and `h` at first. Then + * it returns the logical width and height that are set. * * \param renderer a rendering context * \param w an int to be filled with the width @@ -985,7 +1004,7 @@ extern DECLSPEC void SDLCALL SDL_RenderGetScale(SDL_Renderer * renderer, * and logical renderer size set * * \param renderer the renderer from which the logical coordinates should be - * calcualted + * calculated * \param windowX the real X coordinate in the window * \param windowY the real Y coordinate in the window * \param logicalX the pointer filled with the logical x coordinate @@ -1002,19 +1021,23 @@ extern DECLSPEC void SDLCALL SDL_RenderWindowToLogical(SDL_Renderer * renderer, int windowX, int windowY, float *logicalX, float *logicalY); - /** - * Get real coordinates of point in window when given logical coordinates of point in renderer. - * Logical coordinates will differ from real coordinates when render is scaled and logical renderer size set - * - * \param renderer the renderer from which the window coordinates should be calculated + +/** + * Get real coordinates of point in window when given logical coordinates of + * point in renderer. + * + * Logical coordinates will differ from real coordinates when render is scaled + * and logical renderer size set + * + * \param renderer the renderer from which the window coordinates should be + * calculated * \param logicalX the logical x coordinate * \param logicalY the logical y coordinate * \param windowX the pointer filled with the real X coordinate in the window * \param windowY the pointer filled with the real Y coordinate in the window - - * + * * \since This function is available since SDL 2.0.18. - * + * * \sa SDL_RenderGetScale * \sa SDL_RenderSetScale * \sa SDL_RenderGetLogicalSize @@ -1603,6 +1626,7 @@ extern DECLSPEC int SDLCALL SDL_RenderCopyExF(SDL_Renderer * renderer, * vertex array Color and alpha modulation is done per vertex * (SDL_SetTextureColorMod and SDL_SetTextureAlphaMod are ignored). * + * \param renderer The rendering context. * \param texture (optional) The SDL texture to use. * \param vertices Vertices. * \param num_vertices Number of vertices. @@ -1627,6 +1651,7 @@ extern DECLSPEC int SDLCALL SDL_RenderGeometry(SDL_Renderer *renderer, * vertex arrays Color and alpha modulation is done per vertex * (SDL_SetTextureColorMod and SDL_SetTextureAlphaMod are ignored). * + * \param renderer The rendering context. * \param texture (optional) The SDL texture to use. * \param xy Vertex positions * \param xy_stride Byte size to move from one element to the next element @@ -1658,7 +1683,8 @@ extern DECLSPEC int SDLCALL SDL_RenderGeometryRaw(SDL_Renderer *renderer, * Read pixels from the current rendering target to an array of pixels. * * **WARNING**: This is a very slow operation, and should not be used - * frequently. + * frequently. If you're using this on the main rendering target, it should be + * called after rendering and before SDL_RenderPresent(). * * `pitch` specifies the number of bytes between rows in the destination * `pixels` data. This allows you to write to a subrectangle or have padded @@ -1705,6 +1731,11 @@ extern DECLSPEC int SDLCALL SDL_RenderReadPixels(SDL_Renderer * renderer, * * \param renderer the rendering context * + * \threadsafety You may only call this function on the main thread. If this + * happens to work on a background thread on any given platform + * or backend, it's purely by luck and you should not rely on it + * to work next time. + * * \since This function is available since SDL 2.0.0. * * \sa SDL_RenderClear @@ -1739,6 +1770,9 @@ extern DECLSPEC void SDLCALL SDL_DestroyTexture(SDL_Texture * texture); /** * Destroy the rendering context for a window and free associated textures. * + * If `renderer` is NULL, this function will return immediately after setting + * the SDL error message to "Invalid renderer". See SDL_GetError(). + * * \param renderer the rendering context * * \since This function is available since SDL 2.0.0. @@ -1856,7 +1890,7 @@ extern DECLSPEC void *SDLCALL SDL_RenderGetMetalLayer(SDL_Renderer * renderer); * Note that as of SDL 2.0.18, this will return NULL if Metal refuses to give * SDL a drawable to render to, which might happen if the window is * hidden/minimized/offscreen. This doesn't apply to command encoders for - * render targets, just the window's backbacker. Check your return values! + * render targets, just the window's backbuffer. Check your return values! * * \param renderer The renderer to query * \returns an `id` on success, or NULL if the diff --git a/libs/SDL2/include/SDL_revision.h b/libs/SDL2/include/SDL_revision.h index 3e9b63a..36691f5 100644 --- a/libs/SDL2/include/SDL_revision.h +++ b/libs/SDL2/include/SDL_revision.h @@ -1,2 +1,6 @@ +#ifdef SDL_VENDOR_INFO +#define SDL_REVISION SDL_VENDOR_INFO +#else #define SDL_REVISION "" +#endif #define SDL_REVISION_NUMBER 0 diff --git a/libs/SDL2/include/SDL_rwops.h b/libs/SDL2/include/SDL_rwops.h index 71e5c8d..8615cb5 100644 --- a/libs/SDL2/include/SDL_rwops.h +++ b/libs/SDL2/include/SDL_rwops.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -45,9 +45,6 @@ extern "C" { #define SDL_RWOPS_JNIFILE 3U /**< Android asset */ #define SDL_RWOPS_MEMORY 4U /**< Memory stream */ #define SDL_RWOPS_MEMORY_RO 5U /**< Read-Only memory stream */ -#if defined(__VITA__) -#define SDL_RWOPS_VITAFILE 6U /**< Vita file */ -#endif /** * This is the read/write operation structure -- very basic. @@ -101,7 +98,7 @@ typedef struct SDL_RWops { void *asset; } androidio; -#elif defined(__WIN32__) +#elif defined(__WIN32__) || defined(__GDK__) struct { SDL_bool append; @@ -113,17 +110,6 @@ typedef struct SDL_RWops size_t left; } buffer; } windowsio; -#elif defined(__VITA__) - struct - { - int h; - struct - { - void *data; - size_t size; - size_t left; - } buffer; - } vitaio; #endif #ifdef HAVE_STDIO_H diff --git a/libs/SDL2/include/SDL_scancode.h b/libs/SDL2/include/SDL_scancode.h index 5b2c67c..a960a79 100644 --- a/libs/SDL2/include/SDL_scancode.h +++ b/libs/SDL2/include/SDL_scancode.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -225,16 +225,16 @@ typedef enum SDL_SCANCODE_F23 = 114, SDL_SCANCODE_F24 = 115, SDL_SCANCODE_EXECUTE = 116, - SDL_SCANCODE_HELP = 117, - SDL_SCANCODE_MENU = 118, + SDL_SCANCODE_HELP = 117, /**< AL Integrated Help Center */ + SDL_SCANCODE_MENU = 118, /**< Menu (show menu) */ SDL_SCANCODE_SELECT = 119, - SDL_SCANCODE_STOP = 120, - SDL_SCANCODE_AGAIN = 121, /**< redo */ - SDL_SCANCODE_UNDO = 122, - SDL_SCANCODE_CUT = 123, - SDL_SCANCODE_COPY = 124, - SDL_SCANCODE_PASTE = 125, - SDL_SCANCODE_FIND = 126, + SDL_SCANCODE_STOP = 120, /**< AC Stop */ + SDL_SCANCODE_AGAIN = 121, /**< AC Redo/Repeat */ + SDL_SCANCODE_UNDO = 122, /**< AC Undo */ + SDL_SCANCODE_CUT = 123, /**< AC Cut */ + SDL_SCANCODE_COPY = 124, /**< AC Copy */ + SDL_SCANCODE_PASTE = 125, /**< AC Paste */ + SDL_SCANCODE_FIND = 126, /**< AC Find */ SDL_SCANCODE_MUTE = 127, SDL_SCANCODE_VOLUMEUP = 128, SDL_SCANCODE_VOLUMEDOWN = 129, @@ -265,9 +265,9 @@ typedef enum SDL_SCANCODE_LANG8 = 151, /**< reserved */ SDL_SCANCODE_LANG9 = 152, /**< reserved */ - SDL_SCANCODE_ALTERASE = 153, /**< Erase-Eaze */ + SDL_SCANCODE_ALTERASE = 153, /**< Erase-Eaze */ SDL_SCANCODE_SYSREQ = 154, - SDL_SCANCODE_CANCEL = 155, + SDL_SCANCODE_CANCEL = 155, /**< AC Cancel */ SDL_SCANCODE_CLEAR = 156, SDL_SCANCODE_PRIOR = 157, SDL_SCANCODE_RETURN2 = 158, @@ -345,6 +345,11 @@ typedef enum * \name Usage page 0x0C * * These values are mapped from usage page 0x0C (USB consumer page). + * See https://usb.org/sites/default/files/hut1_2.pdf + * + * There are way more keys in the spec than we can represent in the + * current scancode range, so pick the ones that commonly come up in + * real world usage. */ /* @{ */ @@ -354,17 +359,17 @@ typedef enum SDL_SCANCODE_AUDIOPLAY = 261, SDL_SCANCODE_AUDIOMUTE = 262, SDL_SCANCODE_MEDIASELECT = 263, - SDL_SCANCODE_WWW = 264, + SDL_SCANCODE_WWW = 264, /**< AL Internet Browser */ SDL_SCANCODE_MAIL = 265, - SDL_SCANCODE_CALCULATOR = 266, + SDL_SCANCODE_CALCULATOR = 266, /**< AL Calculator */ SDL_SCANCODE_COMPUTER = 267, - SDL_SCANCODE_AC_SEARCH = 268, - SDL_SCANCODE_AC_HOME = 269, - SDL_SCANCODE_AC_BACK = 270, - SDL_SCANCODE_AC_FORWARD = 271, - SDL_SCANCODE_AC_STOP = 272, - SDL_SCANCODE_AC_REFRESH = 273, - SDL_SCANCODE_AC_BOOKMARKS = 274, + SDL_SCANCODE_AC_SEARCH = 268, /**< AC Search */ + SDL_SCANCODE_AC_HOME = 269, /**< AC Home */ + SDL_SCANCODE_AC_BACK = 270, /**< AC Back */ + SDL_SCANCODE_AC_FORWARD = 271, /**< AC Forward */ + SDL_SCANCODE_AC_STOP = 272, /**< AC Stop */ + SDL_SCANCODE_AC_REFRESH = 273, /**< AC Refresh */ + SDL_SCANCODE_AC_BOOKMARKS = 274, /**< AC Bookmarks */ /* @} *//* Usage page 0x0C */ @@ -383,7 +388,7 @@ typedef enum SDL_SCANCODE_KBDILLUMDOWN = 279, SDL_SCANCODE_KBDILLUMUP = 280, SDL_SCANCODE_EJECT = 281, - SDL_SCANCODE_SLEEP = 282, + SDL_SCANCODE_SLEEP = 282, /**< SC System Sleep */ SDL_SCANCODE_APP1 = 283, SDL_SCANCODE_APP2 = 284, @@ -402,6 +407,26 @@ typedef enum /* @} *//* Usage page 0x0C (additional media keys) */ + /** + * \name Mobile keys + * + * These are values that are often used on mobile phones. + */ + /* @{ */ + + SDL_SCANCODE_SOFTLEFT = 287, /**< Usually situated below the display on phones and + used as a multi-function feature key for selecting + a software defined function shown on the bottom left + of the display. */ + SDL_SCANCODE_SOFTRIGHT = 288, /**< Usually situated below the display on phones and + used as a multi-function feature key for selecting + a software defined function shown on the bottom right + of the display. */ + SDL_SCANCODE_CALL = 289, /**< Used for accepting phone calls. */ + SDL_SCANCODE_ENDCALL = 290, /**< Used for rejecting phone calls. */ + + /* @} *//* Mobile keys */ + /* Add any other keys here. */ SDL_NUM_SCANCODES = 512 /**< not a key, just marks the number of scancodes diff --git a/libs/SDL2/include/SDL_sensor.h b/libs/SDL2/include/SDL_sensor.h index a2f30e0..9ecce44 100644 --- a/libs/SDL2/include/SDL_sensor.h +++ b/libs/SDL2/include/SDL_sensor.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -71,7 +71,11 @@ typedef enum SDL_SENSOR_INVALID = -1, /**< Returned for an invalid sensor */ SDL_SENSOR_UNKNOWN, /**< Unknown sensor type */ SDL_SENSOR_ACCEL, /**< Accelerometer */ - SDL_SENSOR_GYRO /**< Gyroscope */ + SDL_SENSOR_GYRO, /**< Gyroscope */ + SDL_SENSOR_ACCEL_L, /**< Accelerometer for left Joy-Con controller and Wii nunchuk */ + SDL_SENSOR_GYRO_L, /**< Gyroscope for left Joy-Con controller */ + SDL_SENSOR_ACCEL_R, /**< Accelerometer for right Joy-Con controller */ + SDL_SENSOR_GYRO_R /**< Gyroscope for right Joy-Con controller */ } SDL_SensorType; /** @@ -80,7 +84,7 @@ typedef enum * The accelerometer returns the current acceleration in SI meters per * second squared. This measurement includes the force of gravity, so * a device at rest will have an value of SDL_STANDARD_GRAVITY away - * from the center of the earth. + * from the center of the earth, which is a positive Y value. * * values[0]: Acceleration on the x axis * values[1]: Acceleration on the y axis @@ -263,7 +267,24 @@ extern DECLSPEC SDL_SensorID SDLCALL SDL_SensorGetInstanceID(SDL_Sensor *sensor) * * \since This function is available since SDL 2.0.9. */ -extern DECLSPEC int SDLCALL SDL_SensorGetData(SDL_Sensor * sensor, float *data, int num_values); +extern DECLSPEC int SDLCALL SDL_SensorGetData(SDL_Sensor *sensor, float *data, int num_values); + +/** + * Get the current state of an opened sensor with the timestamp of the last + * update. + * + * The number of values and interpretation of the data is sensor dependent. + * + * \param sensor The SDL_Sensor object to query + * \param timestamp A pointer filled with the timestamp in microseconds of the + * current sensor reading if available, or 0 if not + * \param data A pointer filled with the current sensor state + * \param num_values The number of values to write to data + * \returns 0 or -1 if an error occurred. + * + * \since This function is available since SDL 2.26.0. + */ +extern DECLSPEC int SDLCALL SDL_SensorGetDataWithTimestamp(SDL_Sensor *sensor, Uint64 *timestamp, float *data, int num_values); /** * Close a sensor previously opened with SDL_SensorOpen(). @@ -272,7 +293,7 @@ extern DECLSPEC int SDLCALL SDL_SensorGetData(SDL_Sensor * sensor, float *data, * * \since This function is available since SDL 2.0.9. */ -extern DECLSPEC void SDLCALL SDL_SensorClose(SDL_Sensor * sensor); +extern DECLSPEC void SDLCALL SDL_SensorClose(SDL_Sensor *sensor); /** * Update the current state of the open sensors. diff --git a/libs/SDL2/include/SDL_shape.h b/libs/SDL2/include/SDL_shape.h index 1bca927..f66babc 100644 --- a/libs/SDL2/include/SDL_shape.h +++ b/libs/SDL2/include/SDL_shape.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_stdinc.h b/libs/SDL2/include/SDL_stdinc.h index c0d194c..182ed86 100644 --- a/libs/SDL2/include/SDL_stdinc.h +++ b/libs/SDL2/include/SDL_stdinc.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -30,12 +30,6 @@ #include "SDL_config.h" -#ifdef __APPLE__ -#ifndef _DARWIN_C_SOURCE -#define _DARWIN_C_SOURCE 1 /* for memset_pattern4() */ -#endif -#endif - #ifdef HAVE_SYS_TYPES_H #include #endif @@ -80,12 +74,14 @@ # include #endif #ifdef HAVE_MATH_H -# if defined(__WINRT__) +# if defined(_MSC_VER) /* Defining _USE_MATH_DEFINES is required to get M_PI to be defined on - WinRT. See http://msdn.microsoft.com/en-us/library/4hwaceh6.aspx + Visual Studio. See http://msdn.microsoft.com/en-us/library/4hwaceh6.aspx for more information. */ -# define _USE_MATH_DEFINES +# ifndef _USE_MATH_DEFINES +# define _USE_MATH_DEFINES +# endif # endif # include #endif @@ -115,6 +111,12 @@ char *alloca(); # endif #endif +#ifdef SIZE_MAX +# define SDL_SIZE_MAX SIZE_MAX +#else +# define SDL_SIZE_MAX ((size_t) -1) +#endif + /** * Check if the compiler supports a given builtin. * Supported by virtually all clang versions and recent gcc. Use this @@ -234,13 +236,26 @@ typedef uint64_t Uint64; /* @} *//* Basic data types */ +/** + * \name Floating-point constants + */ +/* @{ */ + +#ifdef FLT_EPSILON +#define SDL_FLT_EPSILON FLT_EPSILON +#else +#define SDL_FLT_EPSILON 1.1920928955078125e-07F /* 0x0.000002p0 */ +#endif + +/* @} *//* Floating-point constants */ + /* Make sure we have macros for printing width-based integers. * should define these but this is not true all platforms. * (for example win32) */ #ifndef SDL_PRIs64 #ifdef PRIs64 #define SDL_PRIs64 PRIs64 -#elif defined(__WIN32__) +#elif defined(__WIN32__) || defined(__GDK__) #define SDL_PRIs64 "I64d" #elif defined(__LINUX__) && defined(__LP64__) #define SDL_PRIs64 "ld" @@ -251,7 +266,7 @@ typedef uint64_t Uint64; #ifndef SDL_PRIu64 #ifdef PRIu64 #define SDL_PRIu64 PRIu64 -#elif defined(__WIN32__) +#elif defined(__WIN32__) || defined(__GDK__) #define SDL_PRIu64 "I64u" #elif defined(__LINUX__) && defined(__LP64__) #define SDL_PRIu64 "lu" @@ -262,7 +277,7 @@ typedef uint64_t Uint64; #ifndef SDL_PRIx64 #ifdef PRIx64 #define SDL_PRIx64 PRIx64 -#elif defined(__WIN32__) +#elif defined(__WIN32__) || defined(__GDK__) #define SDL_PRIx64 "I64x" #elif defined(__LINUX__) && defined(__LP64__) #define SDL_PRIx64 "lx" @@ -273,7 +288,7 @@ typedef uint64_t Uint64; #ifndef SDL_PRIX64 #ifdef PRIX64 #define SDL_PRIX64 PRIX64 -#elif defined(__WIN32__) +#elif defined(__WIN32__) || defined(__GDK__) #define SDL_PRIX64 "I64X" #elif defined(__LINUX__) && defined(__LP64__) #define SDL_PRIX64 "lX" @@ -354,8 +369,22 @@ typedef uint64_t Uint64; #endif #endif /* SDL_DISABLE_ANALYZE_MACROS */ +#ifndef SDL_COMPILE_TIME_ASSERT +#if defined(__cplusplus) +#if (__cplusplus >= 201103L) +#define SDL_COMPILE_TIME_ASSERT(name, x) static_assert(x, #x) +#endif +#elif defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 201112L) +#define SDL_COMPILE_TIME_ASSERT(name, x) _Static_assert(x, #x) +#endif +#endif /* !SDL_COMPILE_TIME_ASSERT */ + +#ifndef SDL_COMPILE_TIME_ASSERT +/* universal, but may trigger -Wunused-local-typedefs */ #define SDL_COMPILE_TIME_ASSERT(name, x) \ typedef int SDL_compile_time_assert_ ## name[(x) * 2 - 1] +#endif + /** \cond */ #ifndef DOXYGEN_SHOULD_IGNORE_THIS SDL_COMPILE_TIME_ASSERT(uint8, sizeof(Uint8) == 1); @@ -377,7 +406,7 @@ SDL_COMPILE_TIME_ASSERT(sint64, sizeof(Sint64) == 8); /** \cond */ #ifndef DOXYGEN_SHOULD_IGNORE_THIS -#if !defined(__ANDROID__) && !defined(__VITA__) +#if !defined(__ANDROID__) && !defined(__VITA__) && !defined(__3DS__) /* TODO: include/SDL_stdinc.h:174: error: size of array 'SDL_dummy_enum' is negative */ typedef enum { @@ -413,6 +442,16 @@ typedef void *(SDLCALL *SDL_calloc_func)(size_t nmemb, size_t size); typedef void *(SDLCALL *SDL_realloc_func)(void *mem, size_t size); typedef void (SDLCALL *SDL_free_func)(void *mem); +/** + * Get the original set of SDL memory functions + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC void SDLCALL SDL_GetOriginalMemoryFunctions(SDL_malloc_func *malloc_func, + SDL_calloc_func *calloc_func, + SDL_realloc_func *realloc_func, + SDL_free_func *free_func); + /** * Get the current set of SDL memory functions * @@ -443,7 +482,8 @@ extern DECLSPEC int SDLCALL SDL_GetNumAllocations(void); extern DECLSPEC char *SDLCALL SDL_getenv(const char *name); extern DECLSPEC int SDLCALL SDL_setenv(const char *name, const char *value, int overwrite); -extern DECLSPEC void SDLCALL SDL_qsort(void *base, size_t nmemb, size_t size, int (*compare) (const void *, const void *)); +extern DECLSPEC void SDLCALL SDL_qsort(void *base, size_t nmemb, size_t size, int (SDLCALL *compare) (const void *, const void *)); +extern DECLSPEC void * SDLCALL SDL_bsearch(const void *key, const void *base, size_t nmemb, size_t size, int (SDLCALL *compare) (const void *, const void *)); extern DECLSPEC int SDLCALL SDL_abs(int x); @@ -467,6 +507,7 @@ extern DECLSPEC int SDLCALL SDL_isgraph(int x); extern DECLSPEC int SDLCALL SDL_toupper(int x); extern DECLSPEC int SDLCALL SDL_tolower(int x); +extern DECLSPEC Uint16 SDLCALL SDL_crc16(Uint16 crc, const void *data, size_t len); extern DECLSPEC Uint32 SDLCALL SDL_crc32(Uint32 crc, const void *data, size_t len); extern DECLSPEC void *SDLCALL SDL_memset(SDL_OUT_BYTECAP(len) void *dst, int c, size_t len); @@ -475,12 +516,15 @@ extern DECLSPEC void *SDLCALL SDL_memset(SDL_OUT_BYTECAP(len) void *dst, int c, #define SDL_zerop(x) SDL_memset((x), 0, sizeof(*(x))) #define SDL_zeroa(x) SDL_memset((x), 0, sizeof((x))) +#define SDL_copyp(dst, src) \ + { SDL_COMPILE_TIME_ASSERT(SDL_copyp, sizeof (*(dst)) == sizeof (*(src))); } \ + SDL_memcpy((dst), (src), sizeof (*(src))) + + /* Note that memset() is a byte assignment and this is a 32-bit assignment, so they're not directly equivalent. */ SDL_FORCE_INLINE void SDL_memset4(void *dst, Uint32 val, size_t dwords) { -#ifdef __APPLE__ - memset_pattern4(dst, &val, dwords * 4); -#elif defined(__GNUC__) && defined(__i386__) +#if defined(__GNUC__) && defined(__i386__) int u0, u1, u2; __asm__ __volatile__ ( "cld \n\t" @@ -533,8 +577,10 @@ extern DECLSPEC char *SDLCALL SDL_strlwr(char *str); extern DECLSPEC char *SDLCALL SDL_strchr(const char *str, int c); extern DECLSPEC char *SDLCALL SDL_strrchr(const char *str, int c); extern DECLSPEC char *SDLCALL SDL_strstr(const char *haystack, const char *needle); +extern DECLSPEC char *SDLCALL SDL_strcasestr(const char *haystack, const char *needle); extern DECLSPEC char *SDLCALL SDL_strtokr(char *s1, const char *s2, char **saveptr); extern DECLSPEC size_t SDLCALL SDL_utf8strlen(const char *str); +extern DECLSPEC size_t SDLCALL SDL_utf8strnlen(const char *str, size_t bytes); extern DECLSPEC char *SDLCALL SDL_itoa(int value, char *str, int radix); extern DECLSPEC char *SDLCALL SDL_uitoa(unsigned int value, char *str, int radix); @@ -642,7 +688,7 @@ extern DECLSPEC size_t SDLCALL SDL_iconv(SDL_iconv_t cd, const char **inbuf, size_t * outbytesleft); /** - * This function converts a string between encodings in one pass, returning a + * This function converts a buffer or string between encodings in one pass, returning a * string that must be freed with SDL_free() or NULL on error. * * \since This function is available since SDL 2.0.0. @@ -670,6 +716,20 @@ size_t strlcpy(char* dst, const char* src, size_t size); size_t strlcat(char* dst, const char* src, size_t size); #endif +#ifndef HAVE_WCSLCPY +size_t wcslcpy(wchar_t *dst, const wchar_t *src, size_t size); +#endif + +#ifndef HAVE_WCSLCAT +size_t wcslcat(wchar_t *dst, const wchar_t *src, size_t size); +#endif + +/* Starting LLVM 16, the analyser errors out if these functions do not have + their prototype defined (clang-diagnostic-implicit-function-declaration) */ +#include +#include +#include + #define SDL_malloc malloc #define SDL_calloc calloc #define SDL_realloc realloc @@ -708,6 +768,65 @@ SDL_FORCE_INLINE void *SDL_memcpy4(SDL_OUT_BYTECAP(dwords*4) void *dst, SDL_IN_B return SDL_memcpy(dst, src, dwords * 4); } +/** + * If a * b would overflow, return -1. Otherwise store a * b via ret + * and return 0. + * + * \since This function is available since SDL 2.24.0. + */ +SDL_FORCE_INLINE int SDL_size_mul_overflow (size_t a, + size_t b, + size_t *ret) +{ + if (a != 0 && b > SDL_SIZE_MAX / a) { + return -1; + } + *ret = a * b; + return 0; +} + +#if _SDL_HAS_BUILTIN(__builtin_mul_overflow) +/* This needs to be wrapped in an inline rather than being a direct #define, + * because __builtin_mul_overflow() is type-generic, but we want to be + * consistent about interpreting a and b as size_t. */ +SDL_FORCE_INLINE int _SDL_size_mul_overflow_builtin (size_t a, + size_t b, + size_t *ret) +{ + return __builtin_mul_overflow(a, b, ret) == 0 ? 0 : -1; +} +#define SDL_size_mul_overflow(a, b, ret) (_SDL_size_mul_overflow_builtin(a, b, ret)) +#endif + +/** + * If a + b would overflow, return -1. Otherwise store a + b via ret + * and return 0. + * + * \since This function is available since SDL 2.24.0. + */ +SDL_FORCE_INLINE int SDL_size_add_overflow (size_t a, + size_t b, + size_t *ret) +{ + if (b > SDL_SIZE_MAX - a) { + return -1; + } + *ret = a + b; + return 0; +} + +#if _SDL_HAS_BUILTIN(__builtin_add_overflow) +/* This needs to be wrapped in an inline rather than being a direct #define, + * the same as the call to __builtin_mul_overflow() above. */ +SDL_FORCE_INLINE int _SDL_size_add_overflow_builtin (size_t a, + size_t b, + size_t *ret) +{ + return __builtin_add_overflow(a, b, ret) == 0 ? 0 : -1; +} +#define SDL_size_add_overflow(a, b, ret) (_SDL_size_add_overflow_builtin(a, b, ret)) +#endif + /* Ends C function definitions when using C++ */ #ifdef __cplusplus } diff --git a/libs/SDL2/include/SDL_surface.h b/libs/SDL2/include/SDL_surface.h index 4412376..d6ee615 100644 --- a/libs/SDL2/include/SDL_surface.h +++ b/libs/SDL2/include/SDL_surface.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -61,6 +61,8 @@ extern "C" { */ #define SDL_MUSTLOCK(S) (((S)->flags & SDL_RLEACCEL) != 0) +typedef struct SDL_BlitMap SDL_BlitMap; /* this is an opaque type. */ + /** * \brief A collection of pixels used in software blitting. * @@ -88,7 +90,7 @@ typedef struct SDL_Surface SDL_Rect clip_rect; /**< Read-only */ /** info for fast blit mapping to other surfaces */ - struct SDL_BlitMap *map; /**< Private */ + SDL_BlitMap *map; /**< Private */ /** Reference count -- used when freeing surface */ int refcount; /**< Read-mostly */ diff --git a/libs/SDL2/include/SDL_system.h b/libs/SDL2/include/SDL_system.h index e2fa7b5..4b7eadd 100644 --- a/libs/SDL2/include/SDL_system.h +++ b/libs/SDL2/include/SDL_system.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -41,7 +41,7 @@ extern "C" { /* Platform specific functions for Windows */ -#ifdef __WIN32__ +#if defined(__WIN32__) || defined(__GDK__) typedef void (SDLCALL * SDL_WindowsMessageHook)(void *userdata, void *hWnd, unsigned int message, Uint64 wParam, Sint64 lParam); @@ -55,6 +55,10 @@ typedef void (SDLCALL * SDL_WindowsMessageHook)(void *userdata, void *hWnd, unsi */ extern DECLSPEC void SDLCALL SDL_SetWindowsMessageHook(SDL_WindowsMessageHook callback, void *userdata); +#endif /* defined(__WIN32__) || defined(__GDK__) */ + +#if defined(__WIN32__) || defined(__WINGDK__) + /** * Get the D3D9 adapter index that matches the specified display index. * @@ -102,6 +106,30 @@ typedef struct ID3D11Device ID3D11Device; */ extern DECLSPEC ID3D11Device* SDLCALL SDL_RenderGetD3D11Device(SDL_Renderer * renderer); +#endif /* defined(__WIN32__) || defined(__WINGDK__) */ + +#if defined(__WIN32__) || defined(__GDK__) + +typedef struct ID3D12Device ID3D12Device; + +/** + * Get the D3D12 device associated with a renderer. + * + * Once you are done using the device, you should release it to avoid a + * resource leak. + * + * \param renderer the renderer from which to get the associated D3D12 device + * \returns the D3D12 device associated with given renderer or NULL if it is + * not a D3D12 renderer; call SDL_GetError() for more information. + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC ID3D12Device* SDLCALL SDL_RenderGetD3D12Device(SDL_Renderer* renderer); + +#endif /* defined(__WIN32__) || defined(__GDK__) */ + +#if defined(__WIN32__) || defined(__WINGDK__) + /** * Get the DXGI Adapter and Output indices for the specified display index. * @@ -122,8 +150,7 @@ extern DECLSPEC ID3D11Device* SDLCALL SDL_RenderGetD3D11Device(SDL_Renderer * re */ extern DECLSPEC SDL_bool SDLCALL SDL_DXGIGetOutputInfo( int displayIndex, int *adapterIndex, int *outputIndex ); -#endif /* __WIN32__ */ - +#endif /* defined(__WIN32__) || defined(__WINGDK__) */ /* Platform specific functions for Linux */ #ifdef __LINUX__ @@ -178,7 +205,7 @@ extern DECLSPEC int SDLCALL SDL_LinuxSetThreadPriorityAndPolicy(Sint64 threadID, * This function is only available on Apple iOS. * * For more information see: - * [README-ios.md](https://hg.libsdl.org/SDL/file/default/docs/README-ios.md) + * https://github.com/libsdl-org/SDL/blob/main/docs/README-ios.md * * This functions is also accessible using the macro * SDL_iOSSetAnimationCallback() since SDL 2.0.4. @@ -195,7 +222,7 @@ extern DECLSPEC int SDLCALL SDL_LinuxSetThreadPriorityAndPolicy(Sint64 threadID, * * \sa SDL_iPhoneSetEventPump */ -extern DECLSPEC int SDLCALL SDL_iPhoneSetAnimationCallback(SDL_Window * window, int interval, void (*callback)(void*), void *callbackParam); +extern DECLSPEC int SDLCALL SDL_iPhoneSetAnimationCallback(SDL_Window * window, int interval, void (SDLCALL *callback)(void*), void *callbackParam); #define SDL_iOSSetEventPump(enabled) SDL_iPhoneSetEventPump(enabled) @@ -425,6 +452,18 @@ extern DECLSPEC SDL_bool SDLCALL SDL_AndroidRequestPermission(const char *permis */ extern DECLSPEC int SDLCALL SDL_AndroidShowToast(const char* message, int duration, int gravity, int xoffset, int yoffset); +/** + * Send a user command to SDLActivity. + * + * Override "boolean onUnhandledMessage(Message msg)" to handle the message. + * + * \param command user command that must be greater or equal to 0x8000 + * \param param user parameter + * + * \since This function is available since SDL 2.0.22. + */ +extern DECLSPEC int SDLCALL SDL_AndroidSendMessage(Uint32 command, int param); + #endif /* __ANDROID__ */ /* Platform specific functions for WinRT */ @@ -520,7 +559,7 @@ extern DECLSPEC const wchar_t * SDLCALL SDL_WinRTGetFSPathUNICODE(SDL_WinRT_Path extern DECLSPEC const char * SDLCALL SDL_WinRTGetFSPathUTF8(SDL_WinRT_Path pathType); /** - * Detects the device family of WinRT plattform at runtime. + * Detects the device family of WinRT platform at runtime. * * \returns a value from the SDL_WinRT_DeviceFamily enum. * @@ -552,6 +591,27 @@ extern DECLSPEC void SDLCALL SDL_OnApplicationDidBecomeActive(void); extern DECLSPEC void SDLCALL SDL_OnApplicationDidChangeStatusBarOrientation(void); #endif +/* Functions used only by GDK */ +#if defined(__GDK__) +typedef struct XTaskQueueObject * XTaskQueueHandle; + +/** + * Gets a reference to the global async task queue handle for GDK, + * initializing if needed. + * + * Once you are done with the task queue, you should call + * XTaskQueueCloseHandle to reduce the reference count to avoid a resource + * leak. + * + * \param outTaskQueue a pointer to be filled in with task queue handle. + * \returns 0 if success, -1 if any error occurs. + * + * \since This function is available since SDL 2.24.0. + */ +extern DECLSPEC int SDLCALL SDL_GDKGetTaskQueue(XTaskQueueHandle * outTaskQueue); + +#endif + /* Ends C function definitions when using C++ */ #ifdef __cplusplus } diff --git a/libs/SDL2/include/SDL_syswm.h b/libs/SDL2/include/SDL_syswm.h index f7cd670..b35734d 100644 --- a/libs/SDL2/include/SDL_syswm.h +++ b/libs/SDL2/include/SDL_syswm.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -298,6 +298,8 @@ struct SDL_SysWMinfo struct wl_egl_window *egl_window; /**< Wayland EGL window (native window) */ struct xdg_surface *xdg_surface; /**< Wayland xdg surface (window manager handle) */ struct xdg_toplevel *xdg_toplevel; /**< Wayland xdg toplevel role */ + struct xdg_popup *xdg_popup; /**< Wayland xdg popup role */ + struct xdg_positioner *xdg_positioner; /**< Wayland xdg positioner, for popup */ } wl; #endif #if defined(SDL_VIDEO_DRIVER_MIR) /* no longer available, left for API/ABI compatibility. Remove in 2.1! */ diff --git a/libs/SDL2/include/SDL_test.h b/libs/SDL2/include/SDL_test.h index 8cc9d61..80daaaf 100644 --- a/libs/SDL2/include/SDL_test.h +++ b/libs/SDL2/include/SDL_test.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_assert.h b/libs/SDL2/include/SDL_test_assert.h index 7342305..341e490 100644 --- a/libs/SDL2/include/SDL_test_assert.h +++ b/libs/SDL2/include/SDL_test_assert.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_common.h b/libs/SDL2/include/SDL_test_common.h index 0f50967..6de63ca 100644 --- a/libs/SDL2/include/SDL_test_common.h +++ b/libs/SDL2/include/SDL_test_common.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -50,6 +50,7 @@ #define VERBOSE_RENDER 0x00000004 #define VERBOSE_EVENT 0x00000008 #define VERBOSE_AUDIO 0x00000010 +#define VERBOSE_MOTION 0x00000020 typedef struct { diff --git a/libs/SDL2/include/SDL_test_compare.h b/libs/SDL2/include/SDL_test_compare.h index 8a7a070..5fce25c 100644 --- a/libs/SDL2/include/SDL_test_compare.h +++ b/libs/SDL2/include/SDL_test_compare.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_crc32.h b/libs/SDL2/include/SDL_test_crc32.h index 049da74..bf34782 100644 --- a/libs/SDL2/include/SDL_test_crc32.h +++ b/libs/SDL2/include/SDL_test_crc32.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_font.h b/libs/SDL2/include/SDL_test_font.h index c5cbbbb..18a82ff 100644 --- a/libs/SDL2/include/SDL_test_font.h +++ b/libs/SDL2/include/SDL_test_font.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -38,7 +38,8 @@ extern "C" { /* Function prototypes */ -#define FONT_CHARACTER_SIZE 8 +#define FONT_CHARACTER_SIZE 8 +#define FONT_LINE_HEIGHT (FONT_CHARACTER_SIZE + 2) /** * \brief Draw a string in the currently set font. @@ -50,10 +51,12 @@ extern "C" { * * \returns 0 on success, -1 on failure. */ -int SDLTest_DrawCharacter(SDL_Renderer *renderer, int x, int y, char c); +int SDLTest_DrawCharacter(SDL_Renderer *renderer, int x, int y, Uint32 c); /** - * \brief Draw a string in the currently set font. + * \brief Draw a UTF-8 string in the currently set font. + * + * The font currently only supports characters in the Basic Latin and Latin-1 Supplement sets. * * \param renderer The renderer to draw on. * \param x The X coordinate of the upper left corner of the string. @@ -64,6 +67,90 @@ int SDLTest_DrawCharacter(SDL_Renderer *renderer, int x, int y, char c); */ int SDLTest_DrawString(SDL_Renderer *renderer, int x, int y, const char *s); +/** + * \brief Data used for multi-line text output + */ +typedef struct SDLTest_TextWindow +{ + SDL_Rect rect; + int current; + int numlines; + char **lines; +} SDLTest_TextWindow; + +/** + * \brief Create a multi-line text output window + * + * \param x The X coordinate of the upper left corner of the window. + * \param y The Y coordinate of the upper left corner of the window. + * \param w The width of the window (currently ignored) + * \param h The height of the window (currently ignored) + * + * \returns the new window, or NULL on failure. + * + * \since This function is available since SDL 2.24.0 + */ +SDLTest_TextWindow *SDLTest_TextWindowCreate(int x, int y, int w, int h); + +/** + * \brief Display a multi-line text output window + * + * This function should be called every frame to display the text + * + * \param textwin The text output window + * \param renderer The renderer to use for display + * + * \since This function is available since SDL 2.24.0 + */ +void SDLTest_TextWindowDisplay(SDLTest_TextWindow *textwin, SDL_Renderer *renderer); + +/** + * \brief Add text to a multi-line text output window + * + * Adds UTF-8 text to the end of the current text. The newline character starts a + * new line of text. The backspace character deletes the last character or, if the + * line is empty, deletes the line and goes to the end of the previous line. + * + * \param textwin The text output window + * \param fmt A printf() style format string + * \param ... additional parameters matching % tokens in the `fmt` string, if any + * + * \since This function is available since SDL 2.24.0 + */ +void SDLTest_TextWindowAddText(SDLTest_TextWindow *textwin, SDL_PRINTF_FORMAT_STRING const char *fmt, ...) SDL_PRINTF_VARARG_FUNC(2); + +/** + * \brief Add text to a multi-line text output window + * + * Adds UTF-8 text to the end of the current text. The newline character starts a + * new line of text. The backspace character deletes the last character or, if the + * line is empty, deletes the line and goes to the end of the previous line. + * + * \param textwin The text output window + * \param text The text to add to the window + * \param len The length, in bytes, of the text to add to the window + * + * \since This function is available since SDL 2.24.0 + */ +void SDLTest_TextWindowAddTextWithLength(SDLTest_TextWindow *textwin, const char *text, size_t len); + +/** + * \brief Clear the text in a multi-line text output window + * + * \param textwin The text output window + * + * \since This function is available since SDL 2.24.0 + */ +void SDLTest_TextWindowClear(SDLTest_TextWindow *textwin); + +/** + * \brief Free the storage associated with a multi-line text output window + * + * \param textwin The text output window + * + * \since This function is available since SDL 2.24.0 + */ +void SDLTest_TextWindowDestroy(SDLTest_TextWindow *textwin); /** * \brief Cleanup textures used by font drawing functions. diff --git a/libs/SDL2/include/SDL_test_fuzzer.h b/libs/SDL2/include/SDL_test_fuzzer.h index bbe8eb8..cfe6a14 100644 --- a/libs/SDL2/include/SDL_test_fuzzer.h +++ b/libs/SDL2/include/SDL_test_fuzzer.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_harness.h b/libs/SDL2/include/SDL_test_harness.h index 1fd4236..26231dc 100644 --- a/libs/SDL2/include/SDL_test_harness.h +++ b/libs/SDL2/include/SDL_test_harness.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_images.h b/libs/SDL2/include/SDL_test_images.h index e2bfc36..1211371 100644 --- a/libs/SDL2/include/SDL_test_images.h +++ b/libs/SDL2/include/SDL_test_images.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_log.h b/libs/SDL2/include/SDL_test_log.h index e3d39ad..a27ffc2 100644 --- a/libs/SDL2/include/SDL_test_log.h +++ b/libs/SDL2/include/SDL_test_log.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_md5.h b/libs/SDL2/include/SDL_test_md5.h index 17b1d2b..538c7ae 100644 --- a/libs/SDL2/include/SDL_test_md5.h +++ b/libs/SDL2/include/SDL_test_md5.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_memory.h b/libs/SDL2/include/SDL_test_memory.h index cc2edc1..f959177 100644 --- a/libs/SDL2/include/SDL_test_memory.h +++ b/libs/SDL2/include/SDL_test_memory.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_test_random.h b/libs/SDL2/include/SDL_test_random.h index b1d6060..0035a80 100644 --- a/libs/SDL2/include/SDL_test_random.h +++ b/libs/SDL2/include/SDL_test_random.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_thread.h b/libs/SDL2/include/SDL_thread.h index 35e680d..b829bba 100644 --- a/libs/SDL2/include/SDL_thread.h +++ b/libs/SDL2/include/SDL_thread.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -35,7 +35,7 @@ #include "SDL_atomic.h" #include "SDL_mutex.h" -#if defined(__WIN32__) +#if (defined(__WIN32__) || defined(__GDK__)) && !defined(__WINRT__) #include /* _beginthreadex() and _endthreadex() */ #endif #if defined(__OS2__) /* for _beginthread() and _endthread() */ @@ -88,7 +88,7 @@ typedef enum { typedef int (SDLCALL * SDL_ThreadFunction) (void *data); -#if defined(__WIN32__) +#if (defined(__WIN32__) || defined(__GDK__)) && !defined(__WINRT__) /** * \file SDL_thread.h * @@ -129,7 +129,7 @@ SDL_CreateThread(SDL_ThreadFunction fn, const char *name, void *data, pfnSDL_CurrentEndThread pfnEndThread); extern DECLSPEC SDL_Thread *SDLCALL -SDL_CreateThreadWithStackSize(int (SDLCALL * fn) (void *), +SDL_CreateThreadWithStackSize(SDL_ThreadFunction fn, const char *name, const size_t stacksize, void *data, pfnSDL_CurrentBeginThread pfnBeginThread, pfnSDL_CurrentEndThread pfnEndThread); @@ -142,7 +142,7 @@ SDL_CreateThreadWithStackSize(int (SDLCALL * fn) (void *), #define SDL_CreateThreadWithStackSize(fn, name, stacksize, data) SDL_CreateThreadWithStackSize_REAL(fn, name, stacksize, data, (pfnSDL_CurrentBeginThread)SDL_beginthread, (pfnSDL_CurrentEndThread)SDL_endthread) #else #define SDL_CreateThread(fn, name, data) SDL_CreateThread(fn, name, data, (pfnSDL_CurrentBeginThread)SDL_beginthread, (pfnSDL_CurrentEndThread)SDL_endthread) -#define SDL_CreateThreadWithStackSize(fn, name, stacksize, data) SDL_CreateThreadWithStackSize(fn, name, data, (pfnSDL_CurrentBeginThread)_beginthreadex, (pfnSDL_CurrentEndThread)SDL_endthread) +#define SDL_CreateThreadWithStackSize(fn, name, stacksize, data) SDL_CreateThreadWithStackSize(fn, name, stacksize, data, (pfnSDL_CurrentBeginThread)SDL_beginthread, (pfnSDL_CurrentEndThread)SDL_endthread) #endif #elif defined(__OS2__) @@ -175,7 +175,7 @@ SDL_CreateThreadWithStackSize(SDL_ThreadFunction fn, const char *name, const siz #undef SDL_CreateThread #define SDL_CreateThread(fn, name, data) SDL_CreateThread_REAL(fn, name, data, (pfnSDL_CurrentBeginThread)SDL_beginthread, (pfnSDL_CurrentEndThread)SDL_endthread) #undef SDL_CreateThreadWithStackSize -#define SDL_CreateThreadWithStackSize(fn, name, stacksize, data) SDL_CreateThreadWithStackSize_REAL(fn, name, data, (pfnSDL_CurrentBeginThread)SDL_beginthread, (pfnSDL_CurrentEndThread)SDL_endthread) +#define SDL_CreateThreadWithStackSize(fn, name, stacksize, data) SDL_CreateThreadWithStackSize_REAL(fn, name, stacksize, data, (pfnSDL_CurrentBeginThread)SDL_beginthread, (pfnSDL_CurrentEndThread)SDL_endthread) #else #define SDL_CreateThread(fn, name, data) SDL_CreateThread(fn, name, data, (pfnSDL_CurrentBeginThread)SDL_beginthread, (pfnSDL_CurrentEndThread)SDL_endthread) #define SDL_CreateThreadWithStackSize(fn, name, stacksize, data) SDL_CreateThreadWithStackSize(fn, name, stacksize, data, (pfnSDL_CurrentBeginThread)SDL_beginthread, (pfnSDL_CurrentEndThread)SDL_endthread) diff --git a/libs/SDL2/include/SDL_timer.h b/libs/SDL2/include/SDL_timer.h index 62f81d4..98f9ad1 100644 --- a/libs/SDL2/include/SDL_timer.h +++ b/libs/SDL2/include/SDL_timer.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_touch.h b/libs/SDL2/include/SDL_touch.h index 9b00716..c12d4a1 100644 --- a/libs/SDL2/include/SDL_touch.h +++ b/libs/SDL2/include/SDL_touch.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -95,6 +95,14 @@ extern DECLSPEC int SDLCALL SDL_GetNumTouchDevices(void); */ extern DECLSPEC SDL_TouchID SDLCALL SDL_GetTouchDevice(int index); +/** + * Get the touch device name as reported from the driver or NULL if the index + * is invalid. + * + * \since This function is available since SDL 2.0.22. + */ +extern DECLSPEC const char* SDLCALL SDL_GetTouchName(int index); + /** * Get the type of the given touch device. * diff --git a/libs/SDL2/include/SDL_types.h b/libs/SDL2/include/SDL_types.h index 355fb50..b5d7192 100644 --- a/libs/SDL2/include/SDL_types.h +++ b/libs/SDL2/include/SDL_types.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages diff --git a/libs/SDL2/include/SDL_version.h b/libs/SDL2/include/SDL_version.h index 2716eba..7585eec 100644 --- a/libs/SDL2/include/SDL_version.h +++ b/libs/SDL2/include/SDL_version.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -58,8 +58,8 @@ typedef struct SDL_version /* Printable format: "%d.%d.%d", MAJOR, MINOR, PATCHLEVEL */ #define SDL_MAJOR_VERSION 2 -#define SDL_MINOR_VERSION 0 -#define SDL_PATCHLEVEL 20 +#define SDL_MINOR_VERSION 28 +#define SDL_PATCHLEVEL 5 /** * Macro to determine SDL version program was compiled against. @@ -83,6 +83,8 @@ typedef struct SDL_version (x)->patch = SDL_PATCHLEVEL; \ } +/* TODO: Remove this whole block in SDL 3 */ +#if SDL_MAJOR_VERSION < 3 /** * This macro turns the version numbers into a numeric value: * \verbatim @@ -90,21 +92,35 @@ typedef struct SDL_version \endverbatim * * This assumes that there will never be more than 100 patchlevels. + * + * In versions higher than 2.9.0, the minor version overflows into + * the thousands digit: for example, 2.23.0 is encoded as 4300, + * and 2.255.99 would be encoded as 25799. + * This macro will not be available in SDL 3.x. */ #define SDL_VERSIONNUM(X, Y, Z) \ ((X)*1000 + (Y)*100 + (Z)) /** * This is the version number macro for the current SDL version. + * + * In versions higher than 2.9.0, the minor version overflows into + * the thousands digit: for example, 2.23.0 is encoded as 4300. + * This macro will not be available in SDL 3.x. + * + * Deprecated, use SDL_VERSION_ATLEAST or SDL_VERSION instead. */ #define SDL_COMPILEDVERSION \ SDL_VERSIONNUM(SDL_MAJOR_VERSION, SDL_MINOR_VERSION, SDL_PATCHLEVEL) +#endif /* SDL_MAJOR_VERSION < 3 */ /** * This macro will evaluate to true if compiled with SDL at least X.Y.Z. */ #define SDL_VERSION_ATLEAST(X, Y, Z) \ - (SDL_COMPILEDVERSION >= SDL_VERSIONNUM(X, Y, Z)) + ((SDL_MAJOR_VERSION >= X) && \ + (SDL_MAJOR_VERSION > X || SDL_MINOR_VERSION >= Y) && \ + (SDL_MAJOR_VERSION > X || SDL_MINOR_VERSION > Y || SDL_PATCHLEVEL >= Z)) /** * Get the version of SDL that is linked against your program. diff --git a/libs/SDL2/include/SDL_video.h b/libs/SDL2/include/SDL_video.h index e43cb27..c8b2d7a 100644 --- a/libs/SDL2/include/SDL_video.h +++ b/libs/SDL2/include/SDL_video.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -187,7 +187,8 @@ typedef enum SDL_DISPLAYEVENT_NONE, /**< Never used */ SDL_DISPLAYEVENT_ORIENTATION, /**< Display orientation has changed to data1 */ SDL_DISPLAYEVENT_CONNECTED, /**< Display has been added to the system */ - SDL_DISPLAYEVENT_DISCONNECTED /**< Display has been removed from the system */ + SDL_DISPLAYEVENT_DISCONNECTED, /**< Display has been removed from the system */ + SDL_DISPLAYEVENT_MOVED /**< Display has changed position */ } SDL_DisplayEventID; /** @@ -248,7 +249,8 @@ typedef enum SDL_GL_FRAMEBUFFER_SRGB_CAPABLE, SDL_GL_CONTEXT_RELEASE_BEHAVIOR, SDL_GL_CONTEXT_RESET_NOTIFICATION, - SDL_GL_CONTEXT_NO_ERROR + SDL_GL_CONTEXT_NO_ERROR, + SDL_GL_FLOATBUFFERS } SDL_GLattr; typedef enum @@ -444,6 +446,15 @@ extern DECLSPEC int SDLCALL SDL_GetDisplayUsableBounds(int displayIndex, SDL_Rec * A failure of this function usually means that either no DPI information is * available or the `displayIndex` is out of range. * + * **WARNING**: This reports the DPI that the hardware reports, and it is not + * always reliable! It is almost always better to use SDL_GetWindowSize() to + * find the window size, which might be in logical points instead of pixels, + * and then SDL_GL_GetDrawableSize(), SDL_Vulkan_GetDrawableSize(), + * SDL_Metal_GetDrawableSize(), or SDL_GetRendererOutputSize(), and compare + * the two values to get an actual scaling value between the two. We will be + * rethinking how high-dpi details should be managed in SDL3 to make things + * more consistent, reliable, and clear. + * * \param displayIndex the index of the display from which DPI information * should be queried * \param ddpi a pointer filled in with the diagonal DPI of the display; may @@ -587,6 +598,35 @@ extern DECLSPEC int SDLCALL SDL_GetCurrentDisplayMode(int displayIndex, SDL_Disp */ extern DECLSPEC SDL_DisplayMode * SDLCALL SDL_GetClosestDisplayMode(int displayIndex, const SDL_DisplayMode * mode, SDL_DisplayMode * closest); +/** + * Get the index of the display containing a point + * + * \param point the point to query + * \returns the index of the display containing the point or a negative error + * code on failure; call SDL_GetError() for more information. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GetDisplayBounds + * \sa SDL_GetNumVideoDisplays + */ +extern DECLSPEC int SDLCALL SDL_GetPointDisplayIndex(const SDL_Point * point); + +/** + * Get the index of the display primarily containing a rect + * + * \param rect the rect to query + * \returns the index of the display entirely containing the rect or closest + * to the center of the rect on success or a negative error code on + * failure; call SDL_GetError() for more information. + * + * \since This function is available since SDL 2.24.0. + * + * \sa SDL_GetDisplayBounds + * \sa SDL_GetNumVideoDisplays + */ +extern DECLSPEC int SDLCALL SDL_GetRectDisplayIndex(const SDL_Rect * rect); + /** * Get the index of the display associated with a window. * @@ -697,7 +737,10 @@ extern DECLSPEC Uint32 SDLCALL SDL_GetWindowPixelFormat(SDL_Window * window); * in pixels may differ from its size in screen coordinates on platforms with * high-DPI support (e.g. iOS and macOS). Use SDL_GetWindowSize() to query the * client area's size in screen coordinates, and SDL_GL_GetDrawableSize() or - * SDL_GetRendererOutputSize() to query the drawable size in pixels. + * SDL_GetRendererOutputSize() to query the drawable size in pixels. Note that + * when this flag is set, the drawable size can vary after the window is + * created and should be queried after major window events such as when the + * window is resized or moved between displays. * * If the window is set fullscreen, the width and height parameters `w` and * `h` will not be used. However, invalid size parameters (e.g. too large) may @@ -1004,6 +1047,27 @@ extern DECLSPEC int SDLCALL SDL_GetWindowBordersSize(SDL_Window * window, int *top, int *left, int *bottom, int *right); +/** + * Get the size of a window in pixels. + * + * This may differ from SDL_GetWindowSize() if we're rendering to a high-DPI + * drawable, i.e. the window was created with `SDL_WINDOW_ALLOW_HIGHDPI` on a + * platform with high-DPI support (Apple calls this "Retina"), and not + * disabled by the `SDL_HINT_VIDEO_HIGHDPI_DISABLED` hint. + * + * \param window the window from which the drawable size should be queried + * \param w a pointer to variable for storing the width in pixels, may be NULL + * \param h a pointer to variable for storing the height in pixels, may be + * NULL + * + * \since This function is available since SDL 2.26.0. + * + * \sa SDL_CreateWindow + * \sa SDL_GetWindowSize + */ +extern DECLSPEC void SDLCALL SDL_GetWindowSizeInPixels(SDL_Window * window, + int *w, int *h); + /** * Set the minimum size of a window's client area. * @@ -1211,6 +1275,17 @@ extern DECLSPEC void SDLCALL SDL_RestoreWindow(SDL_Window * window); extern DECLSPEC int SDLCALL SDL_SetWindowFullscreen(SDL_Window * window, Uint32 flags); +/** + * Return whether the window has a surface associated with it. + * + * \returns SDL_TRUE if there is a surface associated with the window, or SDL_FALSE otherwise. + * + * \since This function is available since SDL 2.28.0. + * + * \sa SDL_GetWindowSurface + */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasWindowSurface(SDL_Window *window); + /** * Get the SDL surface associated with the window. * @@ -1231,6 +1306,8 @@ extern DECLSPEC int SDLCALL SDL_SetWindowFullscreen(SDL_Window * window, * * \since This function is available since SDL 2.0.0. * + * \sa SDL_DestroyWindowSurface + * \sa SDL_HasWindowSurface * \sa SDL_UpdateWindowSurface * \sa SDL_UpdateWindowSurfaceRects */ @@ -1265,7 +1342,7 @@ extern DECLSPEC int SDLCALL SDL_UpdateWindowSurface(SDL_Window * window); * * \param window the window to update * \param rects an array of SDL_Rect structures representing areas of the - * surface to copy + * surface to copy, in pixels * \param numrects the number of rectangles * \returns 0 on success or a negative error code on failure; call * SDL_GetError() for more information. @@ -1279,6 +1356,20 @@ extern DECLSPEC int SDLCALL SDL_UpdateWindowSurfaceRects(SDL_Window * window, const SDL_Rect * rects, int numrects); +/** + * Destroy the surface associated with the window. + * + * \param window the window to update + * \returns 0 on success or a negative error code on failure; call + * SDL_GetError() for more information. + * + * \since This function is available since SDL 2.28.0. + * + * \sa SDL_GetWindowSurface + * \sa SDL_HasWindowSurface + */ +extern DECLSPEC int SDLCALL SDL_DestroyWindowSurface(SDL_Window *window); + /** * Set a window's input grab mode. * @@ -1337,6 +1428,7 @@ extern DECLSPEC void SDLCALL SDL_SetWindowKeyboardGrab(SDL_Window * window, * Mouse grab confines the mouse cursor to the window. * * \param window The window for which the mouse grab mode should be set. + * \param grabbed This is SDL_TRUE to grab mouse, and SDL_FALSE to release. * * \since This function is available since SDL 2.0.16. * @@ -1747,6 +1839,9 @@ extern DECLSPEC void SDLCALL SDL_EnableScreenSaver(void); * If you disable the screensaver, it is automatically re-enabled when SDL * quits. * + * The screensaver is disabled by default since SDL 2.0.2. Before SDL 2.0.2 + * the screensaver was enabled by default. + * * \since This function is available since SDL 2.0.0. * * \sa SDL_EnableScreenSaver @@ -2008,13 +2103,8 @@ extern DECLSPEC void SDLCALL SDL_GL_GetDrawableSize(SDL_Window * window, int *w, * retry the call with 1 for the interval. * * Adaptive vsync is implemented for some glX drivers with - * GLX_EXT_swap_control_tear: - * - * https://www.opengl.org/registry/specs/EXT/glx_swap_control_tear.txt - * - * and for some Windows drivers with WGL_EXT_swap_control_tear: - * - * https://www.opengl.org/registry/specs/EXT/wgl_swap_control_tear.txt + * GLX_EXT_swap_control_tear, and for some Windows drivers with + * WGL_EXT_swap_control_tear. * * Read more on the Khronos wiki: * https://www.khronos.org/opengl/wiki/Swap_Interval#Adaptive_Vsync diff --git a/libs/SDL2/include/begin_code.h b/libs/SDL2/include/begin_code.h index 63f064b..4142ffe 100644 --- a/libs/SDL2/include/begin_code.h +++ b/libs/SDL2/include/begin_code.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -28,13 +28,13 @@ */ /* This shouldn't be nested -- included it around code only. */ -#ifdef _begin_code_h +#ifdef SDL_begin_code_h #error Nested inclusion of begin_code.h #endif -#define _begin_code_h +#define SDL_begin_code_h #ifndef SDL_DEPRECATED -# if (__GNUC__ >= 4) /* technically, this arrived in gcc 3.1, but oh well. */ +# if defined(__GNUC__) && (__GNUC__ >= 4) /* technically, this arrived in gcc 3.1, but oh well. */ # define SDL_DEPRECATED __attribute__((deprecated)) # else # define SDL_DEPRECATED @@ -51,7 +51,7 @@ /* Some compilers use a special export keyword */ #ifndef DECLSPEC -# if defined(__WIN32__) || defined(__WINRT__) || defined(__CYGWIN__) +# if defined(__WIN32__) || defined(__WINRT__) || defined(__CYGWIN__) || defined(__GDK__) # ifdef DLL_EXPORT # define DECLSPEC __declspec(dllexport) # else @@ -74,7 +74,7 @@ /* By default SDL uses the C calling convention */ #ifndef SDLCALL -#if (defined(__WIN32__) || defined(__WINRT__)) && !defined(__GNUC__) +#if (defined(__WIN32__) || defined(__WINRT__) || defined(__GDK__)) && !defined(__GNUC__) #define SDLCALL __cdecl #elif defined(__OS2__) || defined(__EMX__) #define SDLCALL _System @@ -107,7 +107,7 @@ #ifdef __BORLANDC__ #pragma nopackwarning #endif -#ifdef _M_X64 +#ifdef _WIN64 /* Use 8-byte alignment on 64-bit architectures, so pointers are aligned */ #pragma pack(push,8) #else @@ -171,17 +171,17 @@ #define SDL_FALLTHROUGH [[fallthrough]] #else #if defined(__has_attribute) -#define _HAS_FALLTHROUGH __has_attribute(__fallthrough__) +#define SDL_HAS_FALLTHROUGH __has_attribute(__fallthrough__) #else -#define _HAS_FALLTHROUGH 0 +#define SDL_HAS_FALLTHROUGH 0 #endif /* __has_attribute */ -#if _HAS_FALLTHROUGH && \ +#if SDL_HAS_FALLTHROUGH && \ ((defined(__GNUC__) && __GNUC__ >= 7) || \ (defined(__clang_major__) && __clang_major__ >= 10)) #define SDL_FALLTHROUGH __attribute__((__fallthrough__)) #else #define SDL_FALLTHROUGH do {} while (0) /* fallthrough */ -#endif /* _HAS_FALLTHROUGH */ -#undef _HAS_FALLTHROUGH +#endif /* SDL_HAS_FALLTHROUGH */ +#undef SDL_HAS_FALLTHROUGH #endif /* C++17 or C2x */ #endif /* SDL_FALLTHROUGH not defined */ diff --git a/libs/SDL2/include/close_code.h b/libs/SDL2/include/close_code.h index dc73432..b5ff3e2 100644 --- a/libs/SDL2/include/close_code.h +++ b/libs/SDL2/include/close_code.h @@ -1,6 +1,6 @@ /* Simple DirectMedia Layer - Copyright (C) 1997-2022 Sam Lantinga + Copyright (C) 1997-2023 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages @@ -26,10 +26,10 @@ * after you finish any function and structure declarations in your headers */ -#ifndef _begin_code_h +#ifndef SDL_begin_code_h #error close_code.h included without matching begin_code.h #endif -#undef _begin_code_h +#undef SDL_begin_code_h /* Reset structure packing at previous byte alignment */ #if defined(_MSC_VER) || defined(__MWERKS__) || defined(__BORLANDC__) diff --git a/libs/SDL2/lib/iOS-Sim/libSDL2.a b/libs/SDL2/lib/iOS-Sim/libSDL2.a new file mode 100644 index 0000000..cbf3f73 Binary files /dev/null and b/libs/SDL2/lib/iOS-Sim/libSDL2.a differ diff --git a/libs/SDL2/lib/iOS/libSDL2.a b/libs/SDL2/lib/iOS/libSDL2.a index 8f87ae6..9000e04 100644 Binary files a/libs/SDL2/lib/iOS/libSDL2.a and b/libs/SDL2/lib/iOS/libSDL2.a differ diff --git a/libs/SDL2/lib/tvOS-Sim/libSDL2.a b/libs/SDL2/lib/tvOS-Sim/libSDL2.a new file mode 100644 index 0000000..4642371 Binary files /dev/null and b/libs/SDL2/lib/tvOS-Sim/libSDL2.a differ diff --git a/libs/SDL2/lib/tvOS/libSDL2.a b/libs/SDL2/lib/tvOS/libSDL2.a index d96b320..112073d 100644 Binary files a/libs/SDL2/lib/tvOS/libSDL2.a and b/libs/SDL2/lib/tvOS/libSDL2.a differ